selenocysteine insertion sequence-binding protein 2-like isoform X2

Overview
Nameselenocysteine insertion sequence-binding protein 2-like isoform X2
Smed IDSMED30012418
Length (bp)2184
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of selenocysteine insertion sequence-binding protein 2-like isoform X2 (SMED30012418) t-SNE clustered cells

Violin plots show distribution of expression levels for selenocysteine insertion sequence-binding protein 2-like isoform X2 (SMED30012418) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of selenocysteine insertion sequence-binding protein 2-like isoform X2 (SMED30012418) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for selenocysteine insertion sequence-binding protein 2-like isoform X2 (SMED30012418) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012418

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30012418SMESG000034836.1 dd_Smed_v4_7771_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012418SMESG000034836.1 dd_Smed_v4_7771_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012418SMESG000034836.1 dd_Smed_v4_7771_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30012418SMESG000034836.1 Contig32799newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30012418SMESG000034836.1 dd_Smed_v4_7771_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Human
Match: SECISBP2L (SECIS binding protein 2 like [Source:HGNC Symbol;Acc:HGNC:28997])

HSP 1 Score: 159.073 bits (401), Expect = 1.291e-39
Identity = 82/224 (36.61%), Postives = 128/224 (57.14%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIME 1958
            ++HSK FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DP +AK +RRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+FNY GAE+   +L+   ++AR+ Y  +   ME    +                      ++    + +H GHSR PS A        +SEPIS++ E
Sbjct:  623 KIHSKRFREYCNQVLCKEIDECVTLLLQELVSFQERIYQKDPVRAKARRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFNYFGAESLFNKLVELTEEARKAYKDMVAAMEQEQAE--------------------EALKNVKKVPHHMGHSRNPSAASAISFCSVISEPISEVNE 826          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Human
Match: SECISBP2L (SECIS binding protein 2 like [Source:HGNC Symbol;Acc:HGNC:28997])

HSP 1 Score: 159.073 bits (401), Expect = 1.416e-39
Identity = 82/224 (36.61%), Postives = 128/224 (57.14%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIME 1958
            ++HSK FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DP +AK +RRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+FNY GAE+   +L+   ++AR+ Y  +   ME    +                      ++    + +H GHSR PS A        +SEPIS++ E
Sbjct:  668 KIHSKRFREYCNQVLCKEIDECVTLLLQELVSFQERIYQKDPVRAKARRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFNYFGAESLFNKLVELTEEARKAYKDMVAAMEQEQAE--------------------EALKNVKKVPHHMGHSRNPSAASAISFCSVISEPISEVNE 871          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Human
Match: SECISBP2L (SECIS binding protein 2 like [Source:HGNC Symbol;Acc:HGNC:28997])

HSP 1 Score: 156.377 bits (394), Expect = 2.039e-39
Identity = 81/221 (36.65%), Postives = 126/221 (57.01%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISD 1949
            ++HSK FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DP +AK +RRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+FNY GAE+   +L+   ++AR+ Y  +   ME    +                      ++    + +H GHSR PS A        +SEPIS+
Sbjct:  430 KIHSKRFREYCNQVLCKEIDECVTLLLQELVSFQERIYQKDPVRAKARRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFNYFGAESLFNKLVELTEEARKAYKDMVAAMEQEQAE--------------------EALKNVKKVPHHMGHSRNPSAASAISFCSVISEPISE 630          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Human
Match: SECISBP2 (SECIS binding protein 2 [Source:HGNC Symbol;Acc:HGNC:30972])

HSP 1 Score: 142.895 bits (359), Expect = 1.443e-34
Identity = 70/165 (42.42%), Postives = 111/165 (67.27%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDI 1805
            ++HS+ FR+YC+ M+  ++++ V+ LLK L+ FQD++Y +DP KAK KRRL  GLREV K + +KKL+ +II+P+ EKI+ +GGLDD +  II  A E  IP+VF L+R +L     K   V  +G+F+YDGA+    +++     AR+ Y   K ++E++ Q++
Sbjct:  555 KIHSRRFRDYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAY---KTMLENVQQEL 716          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Human
Match: SECISBP2 (SECIS binding protein 2 [Source:HGNC Symbol;Acc:HGNC:30972])

HSP 1 Score: 142.51 bits (358), Expect = 1.458e-34
Identity = 70/165 (42.42%), Postives = 111/165 (67.27%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDI 1805
            ++HS+ FR+YC+ M+  ++++ V+ LLK L+ FQD++Y +DP KAK KRRL  GLREV K + +KKL+ +II+P+ EKI+ +GGLDD +  II  A E  IP+VF L+R +L     K   V  +G+F+YDGA+    +++     AR+ Y   K ++E++ Q++
Sbjct:  550 KIHSRRFRDYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAY---KTMLENVQQEL 711          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Fly
Match: Sbp2 (gene:FBgn0087039 transcript:FBtr0076707)

HSP 1 Score: 92.4337 bits (228), Expect = 3.684e-20
Identity = 60/222 (27.03%), Postives = 108/222 (48.65%), Query Frame = 3
Query: 1152 AILLYRNLKKELREKSNFPTPANENDREI---------DNAIISEAEIKILPEKQKPE-------NSANRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQ 1769
            ++ +YR  KK  RE         END E           NAI  E +++ L   + P         + + +HS+ FR YC++    ++  + +QLL+ L  FQ + + ++  KA+   RL  G+RE    + + K++L+ +A D E    E GLD  +  +    ++  +PY F L R  L+Y   K+ ++  + + ++DGA     +LL  ++ AR +Y +
Sbjct:   95 SVRVYRTSKKAERE-------VAENDLEGVPVVGQDINPNAIPLEQQVQNLSLSKTPAPNNPSQAKTVHAIHSRRFRSYCDNCTRPRLKELSTQLLRDLDRFQKRAFAKNEIKARAHPRLVLGVREALARLRINKVKLLFLATDCEICPGESGLDATIEGLKFQCQQQQVPYCFPLLRRELSYALQKRAQICCVAILDFDGANATYADLLNEIEDARAEYKR 309          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Zebrafish
Match: secisbp2 (SECIS binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-050208-263])

HSP 1 Score: 144.436 bits (363), Expect = 4.328e-36
Identity = 71/190 (37.37%), Postives = 119/190 (62.63%), Query Frame = 3
Query: 1194 KSNFPTPANENDREIDNAIISEAEIKILPEKQKPENSANRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQY 1763
            +S    PA+ +D ++D+ +     ++       P +   ++HS+ FR+YCN ++   ++  VS LLK L+ FQD+LY +DP KA++KRRL  GLREV K + +KK++ +II+P+ E+I+ +GGLD+ +  II   R+  +P+VF LSR +L     K   V  +G+FNYDGA+ +  +++    +AR+ Y
Sbjct:  281 ESKIEQPASPSDDKLDDGLSENPTLQTEIPNSNPISKVPKIHSRKFRDYCNQVLSKDVDECVSNLLKELVRFQDRLYQKDPMKARMKRRLVMGLREVLKHLKLKKVKCVIISPNCERIQSKGGLDEALHNIIDTCRDQSVPFVFALSRKALGRCVNKAVPVSLVGIFNYDGAQDHYHKMIELSAEARKSY 470          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Xenopus
Match: atp4b (ATPase H+/K+ transporting subunit beta [Source:Xenbase;Acc:XB-GENE-944891])

HSP 1 Score: 160.614 bits (405), Expect = 3.319e-40
Identity = 91/265 (34.34%), Postives = 145/265 (54.72%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIMEMN-KLLFNSIME--DQFNSTNSEKEDITPVVCEEKAEDDLI 2072
            ++HSK FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DP KAK KRRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+F+Y GAE+    L+   ++AR+ Y  +   ME                      ++      N     H GHSR PS A        +SEPIS++ E + +  + +++E  D   ++ +E+  +T    E+ A   L+
Sbjct:  651 KIHSKRFREYCNQVLSKEIDECVTVLLQELVSFQERVYQKDPVKAKSKRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFSYSGAESLFHNLVSLTEEARKAYKDMVSSME---------------------QEQAEEALKNIKKVPHMGHSRNPSAASAISFCSVISEPISEVNEKDYETNWRNMVETSDGLETSENEECSVTTTGSEQAASAPLV 894          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Xenopus
Match: atp4b (ATPase H+/K+ transporting subunit beta [Source:Xenbase;Acc:XB-GENE-944891])

HSP 1 Score: 160.614 bits (405), Expect = 3.550e-40
Identity = 91/265 (34.34%), Postives = 145/265 (54.72%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIMEMN-KLLFNSIME--DQFNSTNSEKEDITPVVCEEKAEDDLI 2072
            ++HSK FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DP KAK KRRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+F+Y GAE+    L+   ++AR+ Y  +   ME                      ++      N     H GHSR PS A        +SEPIS++ E + +  + +++E  D   ++ +E+  +T    E+ A   L+
Sbjct:  656 KIHSKRFREYCNQVLSKEIDECVTVLLQELVSFQERVYQKDPVKAKSKRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFSYSGAESLFHNLVSLTEEARKAYKDMVSSME---------------------QEQAEEALKNIKKVPHMGHSRNPSAASAISFCSVISEPISEVNEKDYETNWRNMVETSDGLETSENEECSVTTTGSEQAASAPLV 899          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Xenopus
Match: atp4b (ATPase H+/K+ transporting subunit beta [Source:Xenbase;Acc:XB-GENE-944891])

HSP 1 Score: 160.614 bits (405), Expect = 3.839e-40
Identity = 91/265 (34.34%), Postives = 145/265 (54.72%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIMEMN-KLLFNSIME--DQFNSTNSEKEDITPVVCEEKAEDDLI 2072
            ++HSK FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DP KAK KRRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+F+Y GAE+    L+   ++AR+ Y  +   ME                      ++      N     H GHSR PS A        +SEPIS++ E + +  + +++E  D   ++ +E+  +T    E+ A   L+
Sbjct:  632 KIHSKRFREYCNQVLSKEIDECVTVLLQELVSFQERVYQKDPVKAKSKRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFSYSGAESLFHNLVSLTEEARKAYKDMVSSME---------------------QEQAEEALKNIKKVPHMGHSRNPSAASAISFCSVISEPISEVNEKDYETNWRNMVETSDGLETSENEECSVTTTGSEQAASAPLV 875          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Xenopus
Match: atp4b (ATPase H+/K+ transporting subunit beta [Source:Xenbase;Acc:XB-GENE-944891])

HSP 1 Score: 160.614 bits (405), Expect = 3.921e-40
Identity = 91/265 (34.34%), Postives = 145/265 (54.72%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIMEMN-KLLFNSIME--DQFNSTNSEKEDITPVVCEEKAEDDLI 2072
            ++HSK FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DP KAK KRRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+F+Y GAE+    L+   ++AR+ Y  +   ME                      ++      N     H GHSR PS A        +SEPIS++ E + +  + +++E  D   ++ +E+  +T    E+ A   L+
Sbjct:  659 KIHSKRFREYCNQVLSKEIDECVTVLLQELVSFQERVYQKDPVKAKSKRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFSYSGAESLFHNLVSLTEEARKAYKDMVSSME---------------------QEQAEEALKNIKKVPHMGHSRNPSAASAISFCSVISEPISEVNEKDYETNWRNMVETSDGLETSENEECSVTTTGSEQAASAPLV 902          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Xenopus
Match: atp4b (ATPase H+/K+ transporting subunit beta [Source:Xenbase;Acc:XB-GENE-944891])

HSP 1 Score: 160.614 bits (405), Expect = 4.313e-40
Identity = 91/265 (34.34%), Postives = 145/265 (54.72%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIMEMN-KLLFNSIME--DQFNSTNSEKEDITPVVCEEKAEDDLI 2072
            ++HSK FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DP KAK KRRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+F+Y GAE+    L+   ++AR+ Y  +   ME                      ++      N     H GHSR PS A        +SEPIS++ E + +  + +++E  D   ++ +E+  +T    E+ A   L+
Sbjct:  656 KIHSKRFREYCNQVLSKEIDECVTVLLQELVSFQERVYQKDPVKAKSKRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFSYSGAESLFHNLVSLTEEARKAYKDMVSSME---------------------QEQAEEALKNIKKVPHMGHSRNPSAASAISFCSVISEPISEVNEKDYETNWRNMVETSDGLETSENEECSVTTTGSEQAASAPLV 899          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Mouse
Match: Secisbp2l (SECIS binding protein 2-like [Source:MGI Symbol;Acc:MGI:1917604])

HSP 1 Score: 160.614 bits (405), Expect = 2.925e-40
Identity = 88/253 (34.78%), Postives = 144/253 (56.92%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIMEMN-KLLFNSIMEDQFNSTNSEKEDITPVV 2042
            ++HSK FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DP +AK +RRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+FNY GAE+    L+   ++AR+ Y   K ++ +  Q+ +              ++   +++   ++ +H GHSR PS A        +SEPIS++ E   +  + S++E       SE E   P  
Sbjct:  666 KIHSKRFREYCNQVLSKEIDECVTLLLQELVSFQERIYQKDPVRAKARRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFNYFGAESLFNRLVELTEEARKAY---KDMVAATEQEQA--------------EEALRSVK---TVPHHMGHSRNPSAASAISFCSVISEPISEVNEKEYETNWRSMVETSDGLEPSEMEKAAPCT 898          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Mouse
Match: Secisbp2l (SECIS binding protein 2-like [Source:MGI Symbol;Acc:MGI:1917604])

HSP 1 Score: 141.354 bits (355), Expect = 9.627e-36
Identity = 62/138 (44.93%), Postives = 95/138 (68.84%), Query Frame = 3
Query: 1299 NSANRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAE 1712
            ++  ++HSK FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DP +AK +RRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+FNY GAE
Sbjct:  288 STITKIHSKRFREYCNQVLSKEIDECVTLLLQELVSFQERIYQKDPVRAKARRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFNYFGAE 425          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Mouse
Match: Secisbp2 (SECIS binding protein 2 [Source:MGI Symbol;Acc:MGI:1922670])

HSP 1 Score: 141.354 bits (355), Expect = 3.068e-34
Identity = 69/164 (42.07%), Postives = 109/164 (66.46%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQD 1802
            ++HS+ FR+YC+ M+  ++++ V+ LLK L+ FQD++Y +DP KAK KRRL  GLREV K + ++KL+ III+P+ EK + +GGLDD +  II  A E  IP+VF L+R +L     K   V  +G+F+YDGA+    +++     AR+ Y   K ++E++ Q+
Sbjct:  628 KIHSRRFRDYCSQMLSKEVDACVTGLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLRKLKCIIISPNCEKTQSKGGLDDTLHTIIDCACEQNIPFVFALNRKALGRSLNKAVPVSIVGIFSYDGAQDQFHKMVELTMAARQAY---KTMLETMRQE 788          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. UniProt/SwissProt
Match: sp|Q6A098|SBP2L_MOUSE (Selenocysteine insertion sequence-binding protein 2-like OS=Mus musculus OX=10090 GN=Secisbp2l PE=1 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 1.968e-39
Identity = 88/253 (34.78%), Postives = 144/253 (56.92%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIMEMN-KLLFNSIMEDQFNSTNSEKEDITPVV 2042
            ++HSK FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DP +AK +RRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+FNY GAE+    L+   ++AR+ Y   K ++ +  Q+ +              ++   +++   ++ +H GHSR PS A        +SEPIS++ E   +  + S++E       SE E   P  
Sbjct:  663 KIHSKRFREYCNQVLSKEIDECVTLLLQELVSFQERIYQKDPVRAKARRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFNYFGAESLFNRLVELTEEARKAY---KDMVAATEQEQA--------------EEALRSVK---TVPHHMGHSRNPSAASAISFCSVISEPISEVNEKEYETNWRSMVETSDGLEPSEMEKAAPCT 895          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. UniProt/SwissProt
Match: sp|Q93073|SBP2L_HUMAN (Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens OX=9606 GN=SECISBP2L PE=1 SV=3)

HSP 1 Score: 159.073 bits (401), Expect = 6.799e-39
Identity = 82/224 (36.61%), Postives = 128/224 (57.14%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIME 1958
            ++HSK FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DP +AK +RRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+FNY GAE+   +L+   ++AR+ Y  +   ME    +                      ++    + +H GHSR PS A        +SEPIS++ E
Sbjct:  668 KIHSKRFREYCNQVLCKEIDECVTLLLQELVSFQERIYQKDPVRAKARRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFNYFGAESLFNKLVELTEEARKAYKDMVAAMEQEQAE--------------------EALKNVKKVPHHMGHSRNPSAASAISFCSVISEPISEVNE 871          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. UniProt/SwissProt
Match: sp|Q9QX72|SEBP2_RAT (Selenocysteine insertion sequence-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Secisbp2 PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 2.476e-34
Identity = 103/283 (36.40%), Postives = 166/283 (58.66%), Query Frame = 3
Query: 1065 NPLDLSAPLVXXXXXXXXXXXXXXXXXXXAILLYRN--LKKELREKSNFPTPANENDREIDNAIISE--------------------------------AEIKILPEKQKPE-NSAN--RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQD 1802
            NPLD SAPL+K+GK+R  PK KKP+ LKK IL  R   +++ L+E +  PT A+++ +++++ + ++                                 E +  PE  +P  +SA   ++HS+ FR+YC+ M+  ++++ V+ LLK L+ FQD++Y +DP KAK KRRL  GLREV K + ++KL+ III+P+ EK + +GGLDD +  II  A E  IP+VF L+R +L     K   V  +G+F+YDGA+    +++     AR+ Y   K ++E++ Q+
Sbjct:  497 NPLDSSAPLMKKGKQREIPKAKKPTSLKKIILKERQERMQQRLQESAVSPTVASDDSQDVESGVTNQIPSPDNPTGPEKTEEPMSSTPVVEGESEEPAGTEFQRDPEACQPAPDSATFPKIHSRRFRDYCSQMLSKEVDACVTGLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLRKLKCIIISPNCEKTQSKGGLDDTLHTIIDCACEQNIPFVFALNRKALGRSLNKAVPVSIVGIFSYDGAQDQFHKMVELTMAARQAY---KTMLETMRQE 776          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. UniProt/SwissProt
Match: sp|Q96T21|SEBP2_HUMAN (Selenocysteine insertion sequence-binding protein 2 OS=Homo sapiens OX=9606 GN=SECISBP2 PE=1 SV=2)

HSP 1 Score: 142.895 bits (359), Expect = 8.156e-34
Identity = 70/165 (42.42%), Postives = 111/165 (67.27%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDI 1805
            ++HS+ FR+YC+ M+  ++++ V+ LLK L+ FQD++Y +DP KAK KRRL  GLREV K + +KKL+ +II+P+ EKI+ +GGLDD +  II  A E  IP+VF L+R +L     K   V  +G+F+YDGA+    +++     AR+ Y   K ++E++ Q++
Sbjct:  623 KIHSRRFRDYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAY---KTMLENVQQEL 784          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. TrEMBL
Match: A0A1S3JHA2 (selenocysteine insertion sequence-binding protein 2-like isoform X3 OS=Lingula unguis OX=7574 GN=LOC106173259 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 5.341e-43
Identity = 89/223 (39.91%), Postives = 141/223 (63.23%), Query Frame = 3
Query: 1308 NRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTP---------SNALSEPISD 1949
            +++HS+ FREYC+ ++D +I+   +QLL+ L+ FQD+LY++DPSKAK KRR+  GLREVTK + + K++ ++I+P+LE+I+ +GGLDD +  I+   +E  +P++F L R +L   C K   V  +GVFN++GAET+  +L+   +KAR+ Y ++  ++E   Q+ +P   +PTV   Y+                H GHSRTP         S+ LSEPIS+
Sbjct:  747 SKIHSRRFREYCHQVLDKEIDDCCTQLLQELVRFQDRLYHKDPSKAKSKRRIVLGLREVTKHLKLNKIKSVVISPNLERIQSKGGLDDALHNILDLCQEQDVPFIFALGRRALGRACAKLVPVSVVGVFNFEGAETHFHKLVSLTEKARQVYREMVTVLEKEIQE-NPMKTSPTVPHLYA----------------HMGHSRTPSACSAISFTSSILSEPISE 952          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. TrEMBL
Match: A0A1S3JI12 (selenocysteine insertion sequence-binding protein 2-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106173259 PE=4 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 5.800e-43
Identity = 89/223 (39.91%), Postives = 141/223 (63.23%), Query Frame = 3
Query: 1308 NRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTP---------SNALSEPISD 1949
            +++HS+ FREYC+ ++D +I+   +QLL+ L+ FQD+LY++DPSKAK KRR+  GLREVTK + + K++ ++I+P+LE+I+ +GGLDD +  I+   +E  +P++F L R +L   C K   V  +GVFN++GAET+  +L+   +KAR+ Y ++  ++E   Q+ +P   +PTV   Y+                H GHSRTP         S+ LSEPIS+
Sbjct:  748 SKIHSRRFREYCHQVLDKEIDDCCTQLLQELVRFQDRLYHKDPSKAKSKRRIVLGLREVTKHLKLNKIKSVVISPNLERIQSKGGLDDALHNILDLCQEQDVPFIFALGRRALGRACAKLVPVSVVGVFNFEGAETHFHKLVSLTEKARQVYREMVTVLEKEIQE-NPMKTSPTVPHLYA----------------HMGHSRTPSACSAISFTSSILSEPISE 953          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. TrEMBL
Match: A0A402FMN9 (Ribosomal_L7Ae domain-containing protein OS=Paroedura picta OX=143630 GN=parPi_0020540 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 2.316e-40
Identity = 83/225 (36.89%), Postives = 129/225 (57.33%), Query Frame = 3
Query: 1308 NRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIME 1958
             ++HSK FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DP +AK KRRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+FNY GAE+   +L+   ++AR+ Y  +   ME   ++                      ++    + +H GHSR PS A        +SEPIS++ E
Sbjct:  173 TKIHSKRFREYCNQVLSKEIDECVTLLLQELVSFQERIYQKDPMRAKAKRRLVMGLREVTKHMKLNKIKCVIISPNCEKIQSKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFNYAGAESLFNKLVSLTEEARQAYRDMVAAMEQEQEE---------------------ALKNIKKVPHHMGHSRNPSAASAISFCSVISEPISEVNE 376          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. TrEMBL
Match: G9KMW2 (SECIS binding protein 2 (Fragment) OS=Mustela putorius furo OX=9669 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 6.120e-40
Identity = 112/291 (38.49%), Postives = 168/291 (57.73%), Query Frame = 3
Query: 1065 NPLDLSAPLVXXXXXXXXXXXXXXXXXXXAILLYRNLKKELREKSNFPTPANENDREIDN-------------------------AIISEAEIKILPEKQK--------PENSA-NRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDIS--PFSPAPT 1829
            NPLD S PL+K+GK+R  PK KKP+ LKK IL  R  +K+ R + N  +PA  +D  +D                          A+  E+E  +  E QK        P ++A  ++HS+ FR+YC+ M+  ++++ VS+LL+ L+ FQD+ Y +DP KAK KRRL  GLREV K + ++KL+ +II+P+ EKI+ +GGLDD +  II  A E  IP+VF L+R +L     K   V A+G+F+YDGA+     ++     AR  Y   K ++ES+ Q+++  P  PAP+
Sbjct:  198 NPLDSSGPLMKKGKQREGPKAKKPTSLKKIILKERQERKQQRLQENTGSPAPASDTVLDGESGGDDGAPEQAVPSEGSDVSSSAPALEGESEGLLRAELQKEVEGCHLVPSSAACPKIHSRRFRDYCSQMLSKEVDACVSELLRELVRFQDRTYQKDPVKAKTKRRLVLGLREVLKHLRLRKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQSIPFVFALNRKALGRSLNKAVPVSAVGIFSYDGAQDQFHRMVELTMAARLAY---KTMLESVRQELAGEPGPPAPS 485          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. TrEMBL
Match: M3YAS3 (Ribosomal_L7Ae domain-containing protein OS=Mustela putorius furo OX=9669 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 7.663e-40
Identity = 112/291 (38.49%), Postives = 168/291 (57.73%), Query Frame = 3
Query: 1065 NPLDLSAPLVXXXXXXXXXXXXXXXXXXXAILLYRNLKKELREKSNFPTPANENDREIDN-------------------------AIISEAEIKILPEKQK--------PENSA-NRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDIS--PFSPAPT 1829
            NPLD S PL+K+GK+R  PK KKP+ LKK IL  R  +K+ R + N  +PA  +D  +D                          A+  E+E  +  E QK        P ++A  ++HS+ FR+YC+ M+  ++++ VS+LL+ L+ FQD+ Y +DP KAK KRRL  GLREV K + ++KL+ +II+P+ EKI+ +GGLDD +  II  A E  IP+VF L+R +L     K   V A+G+F+YDGA+     ++     AR  Y   K ++ES+ Q+++  P  PAP+
Sbjct:  205 NPLDSSGPLMKKGKQREGPKAKKPTSLKKIILKERQERKQQRLQENTGSPAPASDTVLDGESGGDDGAPEQAVPSEGSDVSSSAPALEGESEGLLRAELQKEVEGCHLVPSSAACPKIHSRRFRDYCSQMLSKEVDACVSELLRELVRFQDRTYQKDPVKAKTKRRLVLGLREVLKHLRLRKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQSIPFVFALNRKALGRSLNKAVPVSAVGIFSYDGAQDQFHRMVELTMAARLAY---KTMLESVRQELAGEPGPPAPS 492          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Cavefish
Match: SECISBP2L (SECIS binding protein 2 like [Source:HGNC Symbol;Acc:HGNC:28997])

HSP 1 Score: 163.696 bits (413), Expect = 1.591e-41
Identity = 83/224 (37.05%), Postives = 135/224 (60.27%), Query Frame = 3
Query: 1311 RMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIME 1958
            ++HS+ FREYCN +++ +I+  V+ LL+ L+ FQ+++Y ++P+KAK KRRL  GLREVTK + + K+R +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+FNY GAE     L+   ++AR  Y   K+++ ++ Q+ +              ++    ++    +++H GHSR PS A        +SEPIS++ E
Sbjct:  498 KIHSRRFREYCNQVLNKEIDESVTLLLQELVRFQERVYQKEPTKAKSKRRLVMGLREVTKHMKLNKIRCVIISPNCEKIQAKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFNYSGAEGLFNRLVSLTEEARRAY---KEMVSALEQEQA--------------EEALKNVK---KVSHHMGHSRNPSAASAISFCSVISEPISEVNE 701          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Cavefish
Match: secisbp2 (SECIS binding protein 2 [Source:NCBI gene;Acc:103040756])

HSP 1 Score: 161.77 bits (408), Expect = 5.092e-41
Identity = 69/159 (43.40%), Postives = 108/159 (67.92%), Query Frame = 3
Query: 1293 PENSANR--MHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQY 1763
            P+ S +R  +HS+ FREYC+ M+   ++  V+ LLK L+ FQD+LY +DP KA++KRRL  GLREV K + ++K++ +II+P+ E+++ +GGLD+ +  II   RE G+P+VF LSR SL     K   V  +G+FNYDGA+ +  +++    +AR+ Y
Sbjct:  540 PDTSLDRPKIHSRKFREYCSQMLSKDVDECVTTLLKELVRFQDRLYQKDPMKARMKRRLVMGLREVLKHLKLRKVKCVIISPNCERVQSKGGLDEALHTIIDTCREQGVPFVFALSRKSLGRCVNKAVPVSLVGIFNYDGAQDHYHKMIELTSQARKAY 698          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Cavefish
Match: SECISBP2L (SECIS binding protein 2 like [Source:HGNC Symbol;Acc:HGNC:28997])

HSP 1 Score: 162.155 bits (409), Expect = 5.960e-41
Identity = 83/225 (36.89%), Postives = 135/225 (60.00%), Query Frame = 3
Query: 1308 NRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIME 1958
             ++HS+ FREYCN +++ +I+  V+ LL+ L+ FQ+++Y ++P+KAK KRRL  GLREVTK + + K+R +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+FNY GAE     L+   ++AR  Y   K+++ ++ Q+ +              ++    ++    +++H GHSR PS A        +SEPIS++ E
Sbjct:  553 TKIHSRRFREYCNQVLNKEIDESVTLLLQELVRFQERVYQKEPTKAKSKRRLVMGLREVTKHMKLNKIRCVIISPNCEKIQAKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFNYSGAEGLFNRLVSLTEEARRAY---KEMVSALEQEQA--------------EEALKNVK---KVSHHMGHSRNPSAASAISFCSVISEPISEVNE 757          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Sea Lamprey
Match: secisbp2 (SECIS binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-050208-263])

HSP 1 Score: 77.7962 bits (190), Expect = 1.694e-15
Identity = 38/115 (33.04%), Postives = 63/115 (54.78%), Query Frame = 3
Query: 1434 PSKAKLKRRLCFGLREVTKFVNMKKL--RLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQI 1772
            PS+A   +R   G+R +   + +K +  R I+ A     +   GGLD+ +  +I  A E  +P+VF L+R +L +   KK  V  +GVF+Y GAET+ + L+   ++AR  Y  +
Sbjct:  254 PSEASAGKRCGLGVRAILSILELKLIGPRCIVCACVCRSVMTAGGLDEALQTVIALASEQSVPFVFALNRKALGHCLNKKVPVSVVGVFHYGGAETHFQRLVALTEEARSAYRNM 368          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Sea Lamprey
Match: secisbp2 (SECIS binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-050208-263])

HSP 1 Score: 75.0998 bits (183), Expect = 2.042e-14
Identity = 36/114 (31.58%), Postives = 63/114 (55.26%), Query Frame = 3
Query: 1437 SKAKLKRRLCFGLREVTKFVNMKKL--RLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQI 1772
            +++  +RR   G+R +   + +K +  R I+ A     +   GGLD+ +  +I  A E  +P+VF L+R +L +   KK  V  +GVF+Y GAET+ + L+   ++AR  Y  +
Sbjct:  324 AESDAERRCGLGVRAILSILELKLIGPRCIVCACVCRSVMTAGGLDEALQTVIALASEQSVPFVFALNRKALGHCLNKKVPVSVVGVFHYGGAETHFQRLVALTEEARSAYRNM 437          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Nematostella
Match: EDO32907 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STR7])

HSP 1 Score: 77.411 bits (189), Expect = 1.417e-17
Identity = 32/71 (45.07%), Postives = 55/71 (77.46%), Query Frame = 3
Query: 1338 YCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIE 1550
            YC+ ++D ++N++  +LL  L+ FQD++Y +DP KAK KRR   GLREVTK + +KK++ +I++P++E+I+
Sbjct:    7 YCDQVLDKELNTVTLKLLSELVRFQDRVYFKDPEKAKAKRRYVVGLREVTKHLKLKKIKCVILSPNIEQIK 77          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Nematostella
Match: EDO32908 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STR8])

HSP 1 Score: 56.9954 bits (136), Expect = 2.714e-10
Identity = 30/75 (40.00%), Postives = 40/75 (53.33%), Query Frame = 3
Query: 1545 IEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQ 1769
            +   GGLDD +  II  A  + IP VF L R  L     KK  V A+G+FNYDGA+   K L+   +  R+ Y +
Sbjct:    3 LSFTGGLDDALHNIISLAHTNRIPVVFSLRRQILGRAVCKKVPVSAVGIFNYDGAQDLFKNLMELTENGRKVYAE 77          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Medaka
Match: SECISBP2L (SECIS binding protein 2 like [Source:NCBI gene;Acc:101171149])

HSP 1 Score: 164.081 bits (414), Expect = 1.889e-41
Identity = 88/256 (34.38%), Postives = 143/256 (55.86%), Query Frame = 3
Query: 1299 NSANRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIMEMN-KLLFNSIMEDQFNSTNSEKEDITPV 2039
            N+  ++HS+ FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DPSKAK KRRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+FNY GAE    +L+   ++AR+ Y ++   +E    +                      ++ +  + +H GHSR  S A        LSEPIS++ E   +  + +++E+      +E+E   P 
Sbjct:  672 NAITKIHSRRFREYCNQVLSKEIDESVTLLLQELVRFQERVYQKDPSKAKSKRRLVMGLREVTKHMKLHKIKCVIISPNCEKIQAKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFNYSGAEGLFNQLVSLTEEARKAYKEMVSALEQEQAE--------------------EALKHDKKVPHHMGHSRNHSAASAISFCSILSEPISEVNEKEYETNWRTMVENSDAPETAEEEPSRPA 907          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Medaka
Match: SECISBP2L (SECIS binding protein 2 like [Source:NCBI gene;Acc:101171149])

HSP 1 Score: 163.696 bits (413), Expect = 2.205e-41
Identity = 88/256 (34.38%), Postives = 143/256 (55.86%), Query Frame = 3
Query: 1299 NSANRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNA--------LSEPISDIMEMN-KLLFNSIMEDQFNSTNSEKEDITPV 2039
            N+  ++HS+ FREYCN ++  +I+  V+ LL+ L+ FQ+++Y +DPSKAK KRRL  GLREVTK + + K++ +II+P+ EKI+ +GGLD+ +  +I  ARE  IP+VF L R +L     K   V  +G+FNY GAE    +L+   ++AR+ Y ++   +E    +                      ++ +  + +H GHSR  S A        LSEPIS++ E   +  + +++E+      +E+E   P 
Sbjct:  635 NAITKIHSRRFREYCNQVLSKEIDESVTLLLQELVRFQERVYQKDPSKAKSKRRLVMGLREVTKHMKLHKIKCVIISPNCEKIQAKGGLDEALYNVIAMAREQEIPFVFALGRKALGRCVNKLVPVSVVGIFNYSGAEGLFNQLVSLTEEARKAYKEMVSALEQEQAE--------------------EALKHDKKVPHHMGHSRNHSAASAISFCSILSEPISEVNEKEYETNWRTMVENSDAPETAEEEPSRPA 870          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Medaka
Match: secisbp2 (SECIS binding protein 2 [Source:NCBI gene;Acc:101171671])

HSP 1 Score: 159.458 bits (402), Expect = 9.095e-41
Identity = 75/202 (37.13%), Postives = 124/202 (61.39%), Query Frame = 3
Query: 1194 KSNFPTPANENDREIDNAIISEAEIKILPEKQKPENSANRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQ 1799
            +SN P P  E +   D  +   A   + P    P     ++HS+ FR+YC+ M+   ++  V+ LLK L+ FQD+LY++DP KA++KRRL  GLREV K + ++K++ +II+P+ E+I+ +GGLD+ +  II+  RE  +P+VF LSR +L +   K   V  +G+FNYDGA+ +  +++    +AR+ Y  +   +E  +Q
Sbjct:  377 ESNEPNPVPEEEANEDKTVQQTATSPVPPPANVP-----KIHSRKFRDYCSQMLRKDVDECVTVLLKELVRFQDRLYHKDPIKARMKRRLVMGLREVLKHLKLRKVKCVIISPNCEQIQSKGGLDEALHTIIQTCREQAVPFVFALSRKALGHCVNKAVPVSLVGIFNYDGAQDHYHKMIELSAEARKAYEVLVSSLEPGDQ 573          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Medaka
Match: secisbp2 (SECIS binding protein 2 [Source:NCBI gene;Acc:101171671])

HSP 1 Score: 159.844 bits (403), Expect = 9.096e-41
Identity = 75/202 (37.13%), Postives = 124/202 (61.39%), Query Frame = 3
Query: 1194 KSNFPTPANENDREIDNAIISEAEIKILPEKQKPENSANRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQ 1799
            +SN P P  E +   D  +   A   + P    P     ++HS+ FR+YC+ M+   ++  V+ LLK L+ FQD+LY++DP KA++KRRL  GLREV K + ++K++ +II+P+ E+I+ +GGLD+ +  II+  RE  +P+VF LSR +L +   K   V  +G+FNYDGA+ +  +++    +AR+ Y  +   +E  +Q
Sbjct:  394 ESNEPNPVPEEEANEDKTVQQTATSPVPPPANVP-----KIHSRKFRDYCSQMLRKDVDECVTVLLKELVRFQDRLYHKDPIKARMKRRLVMGLREVLKHLKLRKVKCVIISPNCEQIQSKGGLDEALHTIIQTCREQAVPFVFALSRKALGHCVNKAVPVSLVGIFNYDGAQDHYHKMIELSAEARKAYEVLVSSLEPGDQ 590          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Medaka
Match: secisbp2 (SECIS binding protein 2 [Source:NCBI gene;Acc:101171671])

HSP 1 Score: 159.844 bits (403), Expect = 1.426e-40
Identity = 75/202 (37.13%), Postives = 124/202 (61.39%), Query Frame = 3
Query: 1194 KSNFPTPANENDREIDNAIISEAEIKILPEKQKPENSANRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQ 1799
            +SN P P  E +   D  +   A   + P    P     ++HS+ FR+YC+ M+   ++  V+ LLK L+ FQD+LY++DP KA++KRRL  GLREV K + ++K++ +II+P+ E+I+ +GGLD+ +  II+  RE  +P+VF LSR +L +   K   V  +G+FNYDGA+ +  +++    +AR+ Y  +   +E  +Q
Sbjct:  466 ESNEPNPVPEEEANEDKTVQQTATSPVPPPANVP-----KIHSRKFRDYCSQMLRKDVDECVTVLLKELVRFQDRLYHKDPIKARMKRRLVMGLREVLKHLKLRKVKCVIISPNCEQIQSKGGLDEALHTIIQTCREQAVPFVFALSRKALGHCVNKAVPVSLVGIFNYDGAQDHYHKMIELSAEARKAYEVLVSSLEPGDQ 662          
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Planmine SMEST
Match: SMESG000034836.1 (SMESG000034836.1)

HSP 1 Score: 1218.76 bits (3152), Expect = 0.000e+0
Identity = 679/684 (99.27%), Postives = 680/684 (99.42%), Query Frame = 3
Query:   84 MEENKFYDLYGFHLNPLEMNNWMLCQQQYFNYPLDGFPGSIGISYGGLPLQNEYDQLYLQGNYQNISKSNIFSAKPNNDHQSIRPNNKNEYYKKSDKNSRFQGVSHSSQKNQNKVQTIESSQTLKIESCKGTFEILNRNKKGDDEKFRKAFSSTVKIDLDKDFPPISASVMNEPSSVNERTLDYRLALQKPKPVVLSDNKVEKENIXXXXXXXXXXXXXXXXXXXXXXXPADPFSFVDEEFPSXXXXXXXXXXXXXXXXXXXVQDTVKINKVANNDERKKTKKRKLLFILPGDMEGQVRVIQAPTVQKNKTKRKVNQDRMKKPIGVLNPLDLSAPLVXXXXXXXXXXXXXXXXXXXAILLYRNLKKELREKSNFPTPANENDREIDNAIISEAEIKILPEKQKPENSANRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLNDSIAYHAGHSRTPSNALSEPISDIMEMNKLLFNSIMEDQFNSTNSEKEDITPVVCEEKAEDDLIDDFVENILNSVAKLNFHGEIV 2135
            MEENKFYDLYGFHLNPLEMNNWMLCQQQYFNYPLDGFPGSIGISYGGLPLQNEYDQLYLQGNYQNISKSNIFSAKPNNDHQS RPNNKNEYYKKSDKNSRFQGVSHSSQKNQNKVQTIESSQTLKIESCKGTFEILNRNKKGDDEKFRKAFSSTVKIDLDKDFPPISASV+NEPSSVNERTLDYRLALQKPKPVVLSDNKVEKENIKDENQEKVKKKRKRNRKKKVVEKPADPFSFVDEEFPSLENVKIEEKLKIEKQEPKLVQDTVKINKVANNDERKKTKKRKLLFILPGDMEGQVRVIQAPTVQKNKTKRKVNQDRMKKPIGVLNPLDLSAPLVKRGKERLKPKPKKPSKLKKAILLYRNLKKELREKSNFPTPANENDREIDNAIISEAEIKILPEKQKPENSANRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSP PTVNCTYSFDDKCNTIQ NDSIA HAGHSRTPSNALSEPISDIMEMNKLLFNSIMEDQFNSTNSEKEDITPVVCEEKAEDDLIDDFVENILNSVAKLNFHGEIV
Sbjct:    1 MEENKFYDLYGFHLNPLEMNNWMLCQQQYFNYPLDGFPGSIGISYGGLPLQNEYDQLYLQGNYQNISKSNIFSAKPNNDHQSFRPNNKNEYYKKSDKNSRFQGVSHSSQKNQNKVQTIESSQTLKIESCKGTFEILNRNKKGDDEKFRKAFSSTVKIDLDKDFPPISASVINEPSSVNERTLDYRLALQKPKPVVLSDNKVEKENIKDENQEKVKKKRKRNRKKKVVEKPADPFSFVDEEFPSLENVKIEEKLKIEKQEPKLVQDTVKINKVANNDERKKTKKRKLLFILPGDMEGQVRVIQAPTVQKNKTKRKVNQDRMKKPIGVLNPLDLSAPLVKRGKERLKPKPKKPSKLKKAILLYRNLKKELREKSNFPTPANENDREIDNAIISEAEIKILPEKQKPENSANRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRDPSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSLIIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELLVCVDKAREQYNQIKQIMESINQDISPFSPTPTVNCTYSFDDKCNTIQSNDSIACHAGHSRTPSNALSEPISDIMEMNKLLFNSIMEDQFNSTNSEKEDITPVVCEEKAEDDLIDDFVENILNSVAKLNFHGEIV 684          
The following BLAST results are available for this feature:
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SECISBP2L1.291e-3936.61SECIS binding protein 2 like [Source:HGNC Symbol;A... [more]
SECISBP2L1.416e-3936.61SECIS binding protein 2 like [Source:HGNC Symbol;A... [more]
SECISBP2L2.039e-3936.65SECIS binding protein 2 like [Source:HGNC Symbol;A... [more]
SECISBP21.443e-3442.42SECIS binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
SECISBP21.458e-3442.42SECIS binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sbp23.684e-2027.03gene:FBgn0087039 transcript:FBtr0076707[more]
back to top
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
secisbp24.328e-3637.37SECIS binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp4b3.319e-4034.34ATPase H+/K+ transporting subunit beta [Source:Xen... [more]
atp4b3.550e-4034.34ATPase H+/K+ transporting subunit beta [Source:Xen... [more]
atp4b3.839e-4034.34ATPase H+/K+ transporting subunit beta [Source:Xen... [more]
atp4b3.921e-4034.34ATPase H+/K+ transporting subunit beta [Source:Xen... [more]
atp4b4.313e-4034.34ATPase H+/K+ transporting subunit beta [Source:Xen... [more]
back to top
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Secisbp2l2.925e-4034.78SECIS binding protein 2-like [Source:MGI Symbol;Ac... [more]
Secisbp2l9.627e-3644.93SECIS binding protein 2-like [Source:MGI Symbol;Ac... [more]
Secisbp23.068e-3442.07SECIS binding protein 2 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q6A098|SBP2L_MOUSE1.968e-3934.78Selenocysteine insertion sequence-binding protein ... [more]
sp|Q93073|SBP2L_HUMAN6.799e-3936.61Selenocysteine insertion sequence-binding protein ... [more]
sp|Q9QX72|SEBP2_RAT2.476e-3436.40Selenocysteine insertion sequence-binding protein ... [more]
sp|Q96T21|SEBP2_HUMAN8.156e-3442.42Selenocysteine insertion sequence-binding protein ... [more]
back to top
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JHA25.341e-4339.91selenocysteine insertion sequence-binding protein ... [more]
A0A1S3JI125.800e-4339.91selenocysteine insertion sequence-binding protein ... [more]
A0A402FMN92.316e-4036.89Ribosomal_L7Ae domain-containing protein OS=Paroed... [more]
G9KMW26.120e-4038.49SECIS binding protein 2 (Fragment) OS=Mustela puto... [more]
M3YAS37.663e-4038.49Ribosomal_L7Ae domain-containing protein OS=Mustel... [more]
back to top
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SECISBP2L1.591e-4137.05SECIS binding protein 2 like [Source:HGNC Symbol;A... [more]
secisbp25.092e-4143.40SECIS binding protein 2 [Source:NCBI gene;Acc:1030... [more]
SECISBP2L5.960e-4136.89SECIS binding protein 2 like [Source:HGNC Symbol;A... [more]
back to top
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
secisbp21.694e-1533.04SECIS binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
secisbp22.042e-1431.58SECIS binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO329071.417e-1745.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329082.714e-1040.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SECISBP2L1.889e-4134.38SECIS binding protein 2 like [Source:NCBI gene;Acc... [more]
SECISBP2L2.205e-4134.38SECIS binding protein 2 like [Source:NCBI gene;Acc... [more]
secisbp29.095e-4137.13SECIS binding protein 2 [Source:NCBI gene;Acc:1011... [more]
secisbp29.096e-4137.13SECIS binding protein 2 [Source:NCBI gene;Acc:1011... [more]
secisbp21.426e-4037.13SECIS binding protein 2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of selenocysteine insertion sequence-binding protein 2-like isoform X2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000034836.10.000e+099.27SMESG000034836.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012418 ID=SMED30012418|Name=selenocysteine insertion sequence-binding protein 2-like isoform X2|organism=Schmidtea mediterranea sexual|type=transcript|length=2184bp
CGAAGTATGATTTAAGTGTCGATTATTTCCTATTTACATTATAAATTTCT
AATTAAAAATAAAAAAGGAAATTTTACAAGAATATGGAGGAAAATAAGTT
TTATGATTTATATGGTTTTCATCTCAATCCATTAGAAATGAATAATTGGA
TGTTATGTCAGCAACAATATTTTAATTATCCTTTGGATGGATTTCCCGGA
AGTATAGGTATAAGCTATGGTGGCTTACCTTTGCAAAACGAATATGATCA
GCTTTATTTACAAGGAAATTATCAAAATATTTCTAAATCAAATATTTTCT
CAGCAAAACCAAATAACGACCACCAATCTATTCGTCCGAATAATAAAAAT
GAATATTATAAAAAATCTGACAAAAATTCACGTTTCCAAGGTGTAAGTCA
CAGTTCACAAAAGAATCAAAATAAAGTACAAACAATCGAAAGTAGTCAGA
CTTTGAAGATTGAATCTTGTAAAGGAACATTTGAAATATTAAATAGAAAT
AAAAAAGGTGACGACGAAAAATTTAGAAAAGCATTTTCATCAACAGTTAA
AATTGATCTTGATAAGGATTTCCCACCAATATCAGCAAGTGTAATGAATG
AACCATCATCAGTGAACGAACGAACTCTGGATTATCGACTTGCATTACAG
AAACCGAAACCTGTCGTTTTATCAGATAATAAAGTCGAAAAAGAAAATAT
TAAAGATGAAAATCAGGAAAAAGTAAAAAAAAAGCGTAAAAGAAATAGAA
AAAAGAAAGTTGTCGAAAAACCAGCAGATCCATTTTCGTTTGTTGATGAA
GAATTTCCAAGTTTAGAAAATGTAAAAATTGAAGAGAAATTAAAAATTGA
AAAACAAGAACCAAAACTAGTGCAAGACACTGTGAAAATTAATAAAGTTG
CCAATAACGACGAAAGAAAAAAAACGAAAAAACGAAAACTTTTATTCATT
CTTCCTGGCGATATGGAAGGCCAAGTTAGAGTTATTCAAGCGCCAACTGT
TCAGAAAAATAAAACAAAAAGAAAAGTAAATCAAGATCGAATGAAAAAAC
CGATTGGTGTATTGAATCCACTTGATCTTTCGGCTCCTTTAGTTAAACGT
GGTAAAGAACGTTTGAAACCAAAACCGAAAAAACCATCAAAACTCAAGAA
AGCAATTCTACTTTATCGAAATCTAAAAAAAGAACTCCGAGAAAAATCGA
ATTTTCCCACGCCAGCCAATGAAAACGACCGAGAAATCGATAATGCTATC
ATTAGTGAAGCGGAAATTAAAATCCTCCCAGAAAAGCAAAAACCCGAGAA
TTCAGCCAATCGAATGCACAGTAAAAATTTCCGGGAATATTGCAATCATA
TGATTGACAATAAAATCAATTCAATTGTTTCACAACTGCTAAAAACTCTA
ATCGGATTCCAGGATAAACTCTACAATAGAGATCCATCGAAAGCGAAATT
GAAACGGAGACTTTGCTTCGGATTGAGAGAAGTAACAAAGTTTGTCAACA
TGAAGAAGTTGCGGTTGATAATTATCGCTCCAGACCTGGAAAAGATTGAA
ATCGAAGGAGGACTGGATGATATTGTCAGCTTAATTATCAAAGGCGCTAG
AGAATCGGGAATTCCTTACGTGTTTGGATTGAGTAGAAGTTCGTTGGCGT
ATTTATGTTACAAAAAATATCGAGTCGGTGCAATCGGTGTTTTCAATTAT
GATGGTGCCGAAACCTATGTGAAAGAGTTATTGGTGTGCGTAGATAAAGC
CAGAGAGCAATATAATCAGATAAAACAGATAATGGAATCTATCAATCAAG
ATATTTCACCATTTTCACCAGCTCCCACTGTTAATTGCACATATTCGTTT
GATGATAAATGTAATACTATTCAATTAAATGACAGCATTGCTTACCATGC
TGGCCATTCACGCACGCCTTCAAATGCCTTGAGTGAACCAATTTCCGATA
TTATGGAAATGAATAAATTGCTTTTTAATTCTATCATGGAAGATCAATTC
AATAGCACGAATTCCGAGAAAGAGGACATTACTCCTGTTGTATGTGAAGA
AAAAGCTGAAGACGATTTGATTGATGATTTCGTGGAAAATATATTGAATT
CCGTTGCTAAGCTAAATTTCCATGGTGAAATTGTATAAAATATTCCTCCC
TTCGCTGTCCATATTTATTATTATTATTATTATT
back to top

protein sequence of SMED30012418-orf-1

>SMED30012418-orf-1 ID=SMED30012418-orf-1|Name=SMED30012418-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=685bp
MEENKFYDLYGFHLNPLEMNNWMLCQQQYFNYPLDGFPGSIGISYGGLPL
QNEYDQLYLQGNYQNISKSNIFSAKPNNDHQSIRPNNKNEYYKKSDKNSR
FQGVSHSSQKNQNKVQTIESSQTLKIESCKGTFEILNRNKKGDDEKFRKA
FSSTVKIDLDKDFPPISASVMNEPSSVNERTLDYRLALQKPKPVVLSDNK
VEKENIKDENQEKVKKKRKRNRKKKVVEKPADPFSFVDEEFPSLENVKIE
EKLKIEKQEPKLVQDTVKINKVANNDERKKTKKRKLLFILPGDMEGQVRV
IQAPTVQKNKTKRKVNQDRMKKPIGVLNPLDLSAPLVKRGKERLKPKPKK
PSKLKKAILLYRNLKKELREKSNFPTPANENDREIDNAIISEAEIKILPE
KQKPENSANRMHSKNFREYCNHMIDNKINSIVSQLLKTLIGFQDKLYNRD
PSKAKLKRRLCFGLREVTKFVNMKKLRLIIIAPDLEKIEIEGGLDDIVSL
IIKGARESGIPYVFGLSRSSLAYLCYKKYRVGAIGVFNYDGAETYVKELL
VCVDKAREQYNQIKQIMESINQDISPFSPAPTVNCTYSFDDKCNTIQLND
SIAYHAGHSRTPSNALSEPISDIMEMNKLLFNSIMEDQFNSTNSEKEDIT
PVVCEEKAEDDLIDDFVENILNSVAKLNFHGEIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002056medial muscle cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR040051SECISBP2
IPR004038Ribosomal_L7Ae/L30e/S12e/Gad45
IPR029064L30e-like
Vocabulary: biological process
TermDefinition
GO:0001514selenocysteine incorporation
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003730mRNA 3'-UTR binding
GO:0035368selenocysteine insertion sequence binding
GO:0043021ribonucleoprotein complex binding
Vocabulary: cellular component
TermDefinition
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 199..219
NoneNo IPR availableCOILSCoilCoilcoord: 553..573
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 95..119
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 101..119
IPR004038Ribosomal protein L7Ae/L30e/S12e/Gadd45PFAMPF01248Ribosomal_L7Aecoord: 451..543
e-value: 7.2E-14
score: 51.3
IPR02906450S ribosomal protein L30e-likeGENE3DG3DSA:3.30.1330.30coord: 436..570
e-value: 2.2E-17
score: 64.8
IPR02906450S ribosomal protein L30e-likeSUPERFAMILYSSF55315L30e-likecoord: 422..550
IPR040051Selenocysteine insertion sequence-binding protein 2PANTHERPTHR13284FAMILY NOT NAMEDcoord: 113..572