Mitochondrial tRNA specific 2 thiouridylase

Overview
NameMitochondrial tRNA specific 2 thiouridylase
Smed IDSMED30012399
Length (bp)1724
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial tRNA specific 2 thiouridylase (SMED30012399) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial tRNA specific 2 thiouridylase (SMED30012399) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial tRNA specific 2 thiouridylase (SMED30012399) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial tRNA specific 2 thiouridylase (SMED30012399) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012399

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012399SMESG000018923.1 SmedASXL_015341SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012399SMESG000018923.1 SmedASXL_015341SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymal cellSMED30012399SMESG000018923.1 dd_Smed_v4_12984_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Human
Match: TRMU (tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [Source:HGNC Symbol;Acc:HGNC:25481])

HSP 1 Score: 301.597 bits (771), Expect = 2.852e-96
Identity = 158/388 (40.72%), Postives = 229/388 (59.02%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSF---------------GNFLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKV-----QFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQIL 1224
            +  +R V C +SGGVDSAV+A LL+++ + V GVFMKNWD  DE G C+ D D  D+  VC+ L IPF +V++VKEYWN+VF + L+ YEKG TPNPD++CNKHIKF+ F  + ++ L  DA ATGHYAR+S                G F  +   +    L++  D  KDQ+F+L Q++   L + IFPL  LTK  VKKIA E  L   L +KESMGMCFIGKR F +F+  Y++P+ G+F  +E+ +V+G HKG   YTLGQ+  +   +   Y    D    ++ +   ++HPAL+   L T   HW+  +       R K+     +F+++   +PC + +  DG  + +   +  R +  GQ+AV Y  D+  C+GS +IL
Sbjct:    1 MQALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEE-PPAALVRDKMMECHFRFRHQMALVPCVLTLNQDG-TVWVTAVQAVRALATGQFAVFYKGDE--CLGSGKIL 384          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Human
Match: TRMU (tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [Source:HGNC Symbol;Acc:HGNC:25481])

HSP 1 Score: 277.715 bits (709), Expect = 1.139e-87
Identity = 139/316 (43.99%), Postives = 194/316 (61.39%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSF---------------GNFLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQ 1023
            +  +R V C +SGGVDSAV+A LL+++ + V GVFMKNWD  DE G C+ D D  D+  VC+ L IPF +V++VKEYWN+VF + L+ YEKG TPNPD++CNKHIKF+ F  + ++ L  DA ATGHYAR+S                G F  +   +    L++  D  KDQ+F+L Q++   L + IFPL  LTK  VKKIA E  L   L +KESMGMCFIGKR F +F+  Y++P+ G+F  +E+ +V+G HKG   YTLGQ+  +   +   Y    D    ++ +   ++HPAL+   L T   HW+  +
Sbjct:    1 MQALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEE 316          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Human
Match: TRMU (tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [Source:HGNC Symbol;Acc:HGNC:25481])

HSP 1 Score: 247.669 bits (631), Expect = 1.192e-76
Identity = 128/316 (40.51%), Postives = 183/316 (57.91%), Query Frame = 1
Query:  226 MKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSF---------------GNFLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKV-----QFQNKFCSIPCSVNVTNDG 1113
            MKNWD  DE G C+ D D  D+  VC+ L IPF +V++VKEYWN+VF + L+ YEKG TPNPD++CNKHIKF+ F  + ++ L  DA ATGHYAR+S                G F  +   +    L++  D  KDQ+F+L Q++   L + IFPL  LTK  VKKIA E  L   L +KESMGMCFIGKR F +F+  Y++P+ G+F  +E+ +V+G HKG   YTLGQ+  +   +   Y    D    ++ +   ++HPAL+   L T   HW+  +       R K+     +F+++   +PC + +  DG
Sbjct:    1 MKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEE-PPAALVRDKMMECHFRFRHQMALVPCVLTLNQDG 315          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Human
Match: TRMU (tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [Source:HGNC Symbol;Acc:HGNC:25481])

HSP 1 Score: 239.58 bits (610), Expect = 1.973e-73
Identity = 121/281 (43.06%), Postives = 168/281 (59.79%), Query Frame = 1
Query:  226 MKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSF---------------GNFLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQ 1023
            MKNWD  DE G C+ D D  D+  VC+ L IPF +V++VKEYWN+VF + L+ YEKG TPNPD++CNKHIKF+ F  + ++ L  DA ATGHYAR+S                G F  +   +    L++  D  KDQ+F+L Q++   L + IFPL  LTK  VKKIA E  L   L +KESMGMCFIGKR F +F+  Y++P+ G+F  +E+ +V+G HKG   YTLGQ+  +   +   Y    D    ++ +   ++HPAL+   L T   HW+  +
Sbjct:    1 MKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEE 281          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Human
Match: TRMU (tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [Source:HGNC Symbol;Acc:HGNC:25481])

HSP 1 Score: 171.014 bits (432), Expect = 2.846e-49
Identity = 88/206 (42.72%), Postives = 125/206 (60.68%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGN--FLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESM 732
            +  +R V C +SGGVDSAV+A LL+++ + V GVFMKNWD  DE G C+ D D  D+  VC+ L IPF +V++VKEYWN+VF + L+ YEKG TPNPD++CNKHIKF+ F  + ++ L  DA ATGHYAR+S  +    E+ + K+   L R    V+++   LCQ     +++     A  +   V    Q   +  T +R   M
Sbjct:    1 MQALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNERISLCQPGWSTVARSWLAAASTSWAQVILPPQPHQVAGTTARFPRM 206          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Celegans
Match: mttu-1 (Probable mitochondrial tRNA-specific 2-thiouridylase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q17440])

HSP 1 Score: 263.462 bits (672), Expect = 1.391e-82
Identity = 147/371 (39.62%), Postives = 214/371 (57.68%), Query Frame = 1
Query:  142 VACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDE-KGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGNFLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRK-FRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTG----LSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWL--CNQYKNLTSFRSKVQFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILS 1227
            V  G+SGGVDSAVSAFLLKK+ F+VIG+ M NWD ++E    C    D +D++ VC+ L IPF  VNFVKEYWN+VF + L +Y+ G T  PD+ CN+ IKF+ F +   EK   D  ATGHYA ++FG+F + A   +   L    D +KDQ+F+LC +N + L + +FPL  L K  VK+IA+E G  +   + ESMG+CFIGK+K F +F+D YIEPK G   LL+NG  +G H GIH +T+G++       +      + +H+   T +I     S+HP L+      + P W+   + +  ++S     + Q     IPC         ++  R+    R   PGQ  V Y+  +E C+G  +I++
Sbjct:    4 VVIGMSGGVDSAVSAFLLKKRGFDVIGLHMINWDVQEEGTSHCPRSKDESDARNVCDRLNIPFHTVNFVKEYWNDVFLKFLENYKNGRTTVPDIDCNQSIKFDVFHKIAREKFNADFIATGHYATTNFGDFQQNAKDSDEIRLFSGKDPLKDQTFFLCTVNQEQLKRAMFPLGSLQKSEVKRIAEEQGFQEVAKKPESMGICFIGKKKRFSDFLDEYIEPKPGRI-LLKNGSEIGNHHGIHQFTIGKRINGKYLEARSHLGFFVSHIHSDTGDIIACEGSHHPDLYASRFLINHPKWIRTFDPFNRISSNNFLCRIQRTHPPIPCVAEKQEQFLSVIPRL--ALRATAPGQMCVFYNTKNE-CLGGGEIMN 370          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Fly
Match: CG3021 (gene:FBgn0040337 transcript:FBtr0070173)

HSP 1 Score: 315.079 bits (806), Expect = 3.126e-102
Identity = 163/372 (43.82%), Postives = 232/372 (62.37%), Query Frame = 1
Query:  130 MIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGNFLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLT----SFRSKVQFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILSS 1230
            MIR V  G+SGGVDSAVSA LL ++ F V+GVFM+NWD+ DE G+CS + D  D+++ C  L +   +VN+V+EYW  VF + L  Y+ G TPNPD+LCN+HIKF+ F +  LE L  DA ATGHYAR+S GN+LE         L+ P D  KDQ+F+L  I+ K L + +FPL D  K  VK +A++IG  +   +KES G+CF+GKR F++FI  YI  K G F  +++G VVG H+GIH +T+GQ+  LS      + A  +  +  I +    NHPAL    +  D P+WLC++ + +     S R + +FQ+    + C ++++     L + +D   R I PGQYAV Y  DD  C+GS++ILS+
Sbjct:    1 MIRNVVVGVSGGVDSAVSAHLLAEQGFKVLGVFMRNWDEADEVGRCSGEADLKDAEWACRQLGVELRQVNYVREYWTAVFSQFLDDYQMGLTPNPDILCNRHIKFDLFHKHALENLGYDAVATGHYARNSLGNYLEGIASNNDARLLIPADTFKDQTFFLAGISRKALQRTMFPLGDFQKSQVKDLAKKIGFQRLAKKKESTGICFVGKRNFKDFIQEYITSKRGPFLDIDSGAVVGHHEGIHQWTVGQRCRLSSFLQPYFVARKEAASNTIYVASGHNHPALLSTHIAVDPPNWLCSKSQQILSDTGSLRCRFRFQHTKPLVDCQLSISPSNTFL-VELDAPLRAITPGQYAVFY--DDTACLGSARILSA 369          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Zebrafish
Match: trmu (tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [Source:NCBI gene;Acc:553625])

HSP 1 Score: 311.997 bits (798), Expect = 1.261e-100
Identity = 171/387 (44.19%), Postives = 237/387 (61.24%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKK-KFNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSS------FGNFLEKAN---FKETPLLMRPV------DRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKVQ----FQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQIL 1224
            + ++R V C +SGGVDS+VSA LLK+  ++V GVFMKNWD ++EKG CS D D  D+  VC+ L IPF EV++VKEYW+ VF   L  YE+G TPNPD++CNKHIKF  F ++ +  L  DA ATGHYAR+S      F   L +A    F++   + +PV      D +KDQ+F+L QI+   L   +FPLA LTK  VKKIA E G    L +KESMG+CFIGKR F NFI  Y+EP+ GNF  +E+G+++GKHKG    TLGQ+  +    +A +    D  T ++ +  S+ HPALF  +L TD  HW+  +          +     F N+    PC+V +  DG ++ + + E  R +  GQ+AVLY  D+  C+GS +I+
Sbjct:    1 MGVLRHVVCAMSGGVDSSVSALLLKRMGYHVTGVFMKNWDSQEEKGLCSSDRDCEDAYKVCKMLDIPFHEVSYVKEYWHEVFSNLLWEYERGRTPNPDIICNKHIKFKHFYQYAVNTLGADAMATGHYARTSQEDEEVFQQKLTEAPKSLFRDRFEIRKPVRLYQGADLLKDQTFFLSQISQDALRHTLFPLAGLTKGYVKKIAAEAGFQHVLKKKESMGICFIGKRDFENFILEYLEPRPGNFVSIEDGKIMGKHKGWFTLTLGQRARIGGRADAWFVVDKDVTTADVFVCPSTFHPALFRDTLQTDRFHWIAEEPPAELVHTQMMDCHFCFNNRMPLTPCTVTLNLDG-SVWVMVKEPMRGMATGQFAVLYKGDE--CLGSGKII 384          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Xenopus
Match: ahctf1 (AT-hook containing transcription factor 1 [Source:Xenbase;Acc:XB-GENE-855756])

HSP 1 Score: 317.005 bits (811), Expect = 2.043e-102
Identity = 167/406 (41.13%), Postives = 241/406 (59.36%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGN---------------FLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLC----NQYKNLTSFRSKVQFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILS---SISAWQEGHSEQLKW 1272
            +  +R V C +SGGVDS+V+A LL+++ + V GVFM NWD  DE G CS + D  D+  VC+ L IPF +V++VKEYW+ VF   L+ YEKG TPNPD+LCNKHIKFN F  + ++ L  DA ATGHYAR+S  +               F  +   +    L++  DR+KDQ+F+L QI+   L K IFPL +LTK  VKKIA E G    L RKESMG+CFIG+R F NFI  Y+E + GNF   E+G+++G+HKG   +TLGQ+  +   ++A +    D  T  + +  +++HPAL+   L TD  HWL     ++           +FQ++   +PC + +  DG  +   + +  R + PGQ+AV Y  ++  C+GS +IL    S+   Q+G   ++KW
Sbjct:    1 MQTVRRVVCAMSGGVDSSVAALLLRRRGYEVTGVFMNNWDAVDEHGVCSAERDCEDAYRVCKKLDIPFHQVSYVKEYWHEVFSYFLNEYEKGRTPNPDILCNKHIKFNHFLSYAIDILGADAIATGHYARTSLEDEEIFQQKYIKSPQNLFRNRFEIRHDAKLLQAADRIKDQTFFLSQISQYALRKTIFPLGELTKDFVKKIAAEAGFHHVLKRKESMGICFIGERNFENFILEYLEAQPGNFVSAEDGKIMGRHKGWFLFTLGQRARIGGQRDAWFVVDKDVTTGNVYVAPTTDHPALYRDLLRTDRMHWLSEDPPDELVKNKMMECHFRFQHQMALVPCVLTLNQDG-TVWATLVKPIRALTPGQFAVFYKGEE--CLGSGKILRLGPSVYTLQQGQ-HRMKW 402          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Xenopus
Match: ahctf1 (AT-hook containing transcription factor 1 [Source:Xenbase;Acc:XB-GENE-855756])

HSP 1 Score: 315.079 bits (806), Expect = 2.033e-101
Identity = 167/408 (40.93%), Postives = 242/408 (59.31%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGN---------------FLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLC----NQYKNLTSFRSKVQFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILS---SISAWQEGHSEQLKWDS 1278
            +  +R V C +SGGVDS+V+A LL+++ + V GVFM NWD  DE G CS + D  D+  VC+ L IPF +V++VKEYW+ VF   L+ YEKG TPNPD+LCNKHIKFN F  + ++ L  DA ATGHYAR+S  +               F  +   +    L++  DR+KDQ+F+L QI+   L K IFPL +LTK  VKKIA E G    L RKESMG+CFIG+R F NFI  Y+E + GNF   E+G+++G+HKG   +TLGQ+  +   ++A +    D  T  + +  +++HPAL+   L TD  HWL     ++           +FQ++   +PC + +  DG  +   + +  R + PGQ+AV Y  ++  C+GS +IL    S+   Q+G   ++K D+
Sbjct:    1 MQTVRRVVCAMSGGVDSSVAALLLRRRGYEVTGVFMNNWDAVDEHGVCSAERDCEDAYRVCKKLDIPFHQVSYVKEYWHEVFSYFLNEYEKGRTPNPDILCNKHIKFNHFLSYAIDILGADAIATGHYARTSLEDEEIFQQKYIKSPQNLFRNRFEIRHDAKLLQAADRIKDQTFFLSQISQYALRKTIFPLGELTKDFVKKIAAEAGFHHVLKRKESMGICFIGERNFENFILEYLEAQPGNFVSAEDGKIMGRHKGWFLFTLGQRARIGGQRDAWFVVDKDVTTGNVYVAPTTDHPALYRDLLRTDRMHWLSEDPPDELVKNKMMECHFRFQHQMALVPCVLTLNQDG-TVWATLVKPIRALTPGQFAVFYKGEE--CLGSGKILRLGPSVYTLQQG-QHRMKSDA 404          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Xenopus
Match: ahctf1 (AT-hook containing transcription factor 1 [Source:Xenbase;Acc:XB-GENE-855756])

HSP 1 Score: 314.309 bits (804), Expect = 2.207e-101
Identity = 165/400 (41.25%), Postives = 237/400 (59.25%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGN---------------FLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLC----NQYKNLTSFRSKVQFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILS---SISAWQEGH 1254
            +  +R V C +SGGVDS+V+A LL+++ + V GVFM NWD  DE G CS + D  D+  VC+ L IPF +V++VKEYW+ VF   L+ YEKG TPNPD+LCNKHIKFN F  + ++ L  DA ATGHYAR+S  +               F  +   +    L++  DR+KDQ+F+L QI+   L K IFPL +LTK  VKKIA E G    L RKESMG+CFIG+R F NFI  Y+E + GNF   E+G+++G+HKG   +TLGQ+  +   ++A +    D  T  + +  +++HPAL+   L TD  HWL     ++           +FQ++   +PC + +  DG  +   + +  R + PGQ+AV Y  ++  C+GS +IL    S+   Q+G 
Sbjct:    1 MQTVRRVVCAMSGGVDSSVAALLLRRRGYEVTGVFMNNWDAVDEHGVCSAERDCEDAYRVCKKLDIPFHQVSYVKEYWHEVFSYFLNEYEKGRTPNPDILCNKHIKFNHFLSYAIDILGADAIATGHYARTSLEDEEIFQQKYIKSPQNLFRNRFEIRHDAKLLQAADRIKDQTFFLSQISQYALRKTIFPLGELTKDFVKKIAAEAGFHHVLKRKESMGICFIGERNFENFILEYLEAQPGNFVSAEDGKIMGRHKGWFLFTLGQRARIGGQRDAWFVVDKDVTTGNVYVAPTTDHPALYRDLLRTDRMHWLSEDPPDELVKNKMMECHFRFQHQMALVPCVLTLNQDG-TVWATLVKPIRALTPGQFAVFYKGEE--CLGSGKILRLGPSVYTLQQGQ 397          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Xenopus
Match: ahctf1 (AT-hook containing transcription factor 1 [Source:Xenbase;Acc:XB-GENE-855756])

HSP 1 Score: 310.457 bits (794), Expect = 8.979e-100
Identity = 169/415 (40.72%), Postives = 244/415 (58.80%), Query Frame = 1
Query:  121 LLNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGN---------------FLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKE------SMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLC----NQYKNLTSFRSKVQFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILS---SISAWQEGHSEQLKWDS 1278
            LL+ +R V C +SGGVDS+V+A LL+++ + V GVFM NWD  DE G CS + D  D+  VC+ L IPF +V++VKEYW+ VF   L+ YEKG TPNPD+LCNKHIKFN F  + ++ L  DA ATGHYAR+S  +               F  +   +    L++  DR+KDQ+F+L QI+   L K IFPL +LTK  VKKIA E G    L RKE      SMG+CFIG+R F NFI  Y+E + GNF   E+G+++G+HKG   +TLGQ+  +   ++A +    D  T  + +  +++HPAL+   L TD  HWL     ++           +FQ++   +PC + +  DG  +   + +  R + PGQ+AV Y  ++  C+GS +IL    S+   Q+G   ++K D+
Sbjct:    1 LLSSVRRVVCAMSGGVDSSVAALLLRRRGYEVTGVFMNNWDAVDEHGVCSAERDCEDAYRVCKKLDIPFHQVSYVKEYWHEVFSYFLNEYEKGRTPNPDILCNKHIKFNHFLSYAIDILGADAIATGHYARTSLEDEEIFQQKYIKSPQNLFRNRFEIRHDAKLLQAADRIKDQTFFLSQISQYALRKTIFPLGELTKDFVKKIAAEAGFHHVLKRKEDFPYQSSMGICFIGERNFENFILEYLEAQPGNFVSAEDGKIMGRHKGWFLFTLGQRARIGGQRDAWFVVDKDVTTGNVYVAPTTDHPALYRDLLRTDRMHWLSEDPPDELVKNKMMECHFRFQHQMALVPCVLTLNQDG-TVWATLVKPIRALTPGQFAVFYKGEE--CLGSGKILRLGPSVYTLQQGQ-HRMKSDA 411          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Xenopus
Match: ahctf1 (AT-hook containing transcription factor 1 [Source:Xenbase;Acc:XB-GENE-855756])

HSP 1 Score: 308.531 bits (789), Expect = 5.163e-99
Identity = 167/415 (40.24%), Postives = 242/415 (58.31%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGN---------------FLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFI-------DAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLC----NQYKNLTSFRSKVQFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILS---SISAWQEGHSEQLKWDS 1278
            +  +R V C +SGGVDS+V+A LL+++ + V GVFM NWD  DE G CS + D  D+  VC+ L IPF +V++VKEYW+ VF   L+ YEKG TPNPD+LCNKHIKFN F  + ++ L  DA ATGHYAR+S  +               F  +   +    L++  DR+KDQ+F+L QI+   L K IFPL +LTK  VKKIA E G    L RKESMG+CFIG+R F NFI         Y+E + GNF   E+G+++G+HKG   +TLGQ+  +   ++A +    D  T  + +  +++HPAL+   L TD  HWL     ++           +FQ++   +PC + +  DG  +   + +  R + PGQ+AV Y  ++  C+GS +IL    S+   Q+G   ++K D+
Sbjct:    1 MQTVRRVVCAMSGGVDSSVAALLLRRRGYEVTGVFMNNWDAVDEHGVCSAERDCEDAYRVCKKLDIPFHQVSYVKEYWHEVFSYFLNEYEKGRTPNPDILCNKHIKFNHFLSYAIDILGADAIATGHYARTSLEDEEIFQQKYIKSPQNLFRNRFEIRHDAKLLQAADRIKDQTFFLSQISQYALRKTIFPLGELTKDFVKKIAAEAGFHHVLKRKESMGICFIGERNFENFILEVISLLIKYLEAQPGNFVSAEDGKIMGRHKGWFLFTLGQRARIGGQRDAWFVVDKDVTTGNVYVAPTTDHPALYRDLLRTDRMHWLSEDPPDELVKNKMMECHFRFQHQMALVPCVLTLNQDG-TVWATLVKPIRALTPGQFAVFYKGEE--CLGSGKILRLGPSVYTLQQGQ-HRMKSDA 411          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Mouse
Match: Trmu (tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [Source:MGI Symbol;Acc:MGI:1919276])

HSP 1 Score: 294.278 bits (752), Expect = 1.085e-93
Identity = 162/421 (38.48%), Postives = 239/421 (56.77%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSF---------------GNFLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKV-----QFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQIL---SSISAWQEGHSEQLKWDSGKLENKYLHNTT 1314
            ++ +R V C +SGGVDSAV+A LL+++ + V GVFMKNWD  DE+G C+ D D  D+  VC+ L IPF +V++VKEYWN+VF + L+ YEKG TPNPD+ CNKHIKF+ F  + ++ L  DA ATGHYAR+S                G F  +   +    L++  D  KDQ+F+L Q++   L + IFPL +LTK  VKKIA E  L   L ++ESMG+CFIGKR   +F+  Y++P+ G F  +E+  V+G HKG   YTLGQ+  +S  +   Y    D    ++ +    +HPAL+   L T+  HW+  +       R K+     +F+++   +PC + +  DG  + +   +  R +  GQ+AV Y    E C+GS +IL    S    Q+G +          ++  LH T+
Sbjct:    1 MSALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEQGVCAADKDCEDAYKVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDINCNKHIKFSCFYHYAVDNLGADAVATGHYARTSLEDEEVFEQKHTKKPDGLFRNRFEVRNPVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGELTKDFVKKIAAENSLHHVLQKRESMGICFIGKRNLEHFLLQYLQPRPGKFVSIEDNTVLGTHKGWFLYTLGQRAKISGLREPWYVVEKDGTKGDVLVAPRVDHPALYRDLLRTNRVHWIAEE-PPAALVRDKMMECHFRFRHQMALVPCVLTLNQDG-TVWVTAVKAVRGLALGQFAVFYK--GEECLGSGKILRLGPSAYTLQKGKNRTRVAPEASSDSPGLHPTS 417          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Mouse
Match: Trmu (tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [Source:MGI Symbol;Acc:MGI:1919276])

HSP 1 Score: 103.605 bits (257), Expect = 3.658e-26
Identity = 45/82 (54.88%), Postives = 62/82 (75.61%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVF 366
            ++ +R V C +SGGVDSAV+A LL+++ + V GVFMKNWD  DE+G C+ D D  D+  VC+ L IPF +V++VKEYWN+VF
Sbjct:    1 MSALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEQGVCAADKDCEDAYKVCQILDIPFHQVSYVKEYWNDVF 82          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. UniProt/SwissProt
Match: sp|Q5ZKW0|MTU1_CHICK (Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Gallus gallus OX=9031 GN=TRMU PE=2 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 2.036e-101
Identity = 174/413 (42.13%), Postives = 246/413 (59.56%), Query Frame = 1
Query:  121 LLNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGN---------------FLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKE--------SMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKV-----QFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQIL---SSISAWQEGHSEQ 1263
            +L   R VAC +SGGVDSAV+A LL+++ + V GVFMKNWD  DE+G CSVD D  D+  VC+ L IPF +V++VKEYWN VF + L  YE G TPNPD++CNKHIKFN F  + ++ L  DA ATGHYAR+S  +               F  +   + T  L++  D  KDQ+F+L QI+   L K IFPL DLTK  V+KIA E GL   L +KE        SMG+CFIG+R F  F+  Y+EP+ GNF  +E+ +V+G HKG   YT+GQ+  L+  Q A +    D  T +I +  S++HPALF   L T+  HW+  +       R K+     +F+++   +PC + +  DG ++ + + +  R + PGQ+AV Y  D+  C+GS +IL    S+   Q+G + +
Sbjct:    1 MLAAGRRVACAVSGGVDSAVAALLLRRRGYQVTGVFMKNWDPLDEQGACSVDRDCEDAYRVCQKLDIPFHQVSYVKEYWNEVFSDLLKEYELGRTPNPDIVCNKHIKFNHFLHYAMDNLGADAIATGHYARTSLEDEEVFQQKHTKRPRELFRNRFEVRNTVKLLQGADLFKDQTFFLSQISQDALRKTIFPLGDLTKSFVRKIASEHGLHHVLKKKEACTTFPFQSMGVCFIGERNFEKFLLEYLEPQPGNFVSIEDKKVMGTHKGWFLYTIGQRARLAGLQGAWFVVDKDVSTGDIFVAPSTDHPALFRDLLRTNRVHWIAEE-PPAELVRDKMMECHFRFRHQMALVPCVLTLNQDG-SVWVTLVKPARALTPGQFAVFYKGDE--CLGSGKILRLGPSVFTMQQGRNRE 409          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. UniProt/SwissProt
Match: sp|Q9W5B6|MTU1_DROME (Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Drosophila melanogaster OX=7227 GN=CG3021 PE=2 SV=3)

HSP 1 Score: 315.079 bits (806), Expect = 3.133e-101
Identity = 163/372 (43.82%), Postives = 232/372 (62.37%), Query Frame = 1
Query:  130 MIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGNFLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLT----SFRSKVQFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILSS 1230
            MIR V  G+SGGVDSAVSA LL ++ F V+GVFM+NWD+ DE G+CS + D  D+++ C  L +   +VN+V+EYW  VF + L  Y+ G TPNPD+LCN+HIKF+ F +  LE L  DA ATGHYAR+S GN+LE         L+ P D  KDQ+F+L  I+ K L + +FPL D  K  VK +A++IG  +   +KES G+CF+GKR F++FI  YI  K G F  +++G VVG H+GIH +T+GQ+  LS      + A  +  +  I +    NHPAL    +  D P+WLC++ + +     S R + +FQ+    + C ++++     L + +D   R I PGQYAV Y  DD  C+GS++ILS+
Sbjct:    1 MIRNVVVGVSGGVDSAVSAHLLAEQGFKVLGVFMRNWDEADEVGRCSGEADLKDAEWACRQLGVELRQVNYVREYWTAVFSQFLDDYQMGLTPNPDILCNRHIKFDLFHKHALENLGYDAVATGHYARNSLGNYLEGIASNNDARLLIPADTFKDQTFFLAGISRKALQRTMFPLGDFQKSQVKDLAKKIGFQRLAKKKESTGICFVGKRNFKDFIQEYITSKRGPFLDIDSGAVVGHHEGIHQWTVGQRCRLSSFLQPYFVARKEAASNTIYVASGHNHPALLSTHIAVDPPNWLCSKSQQILSDTGSLRCRFRFQHTKPLVDCQLSISPSNTFL-VELDAPLRAITPGQYAVFY--DDTACLGSARILSA 369          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. UniProt/SwissProt
Match: sp|Q503J2|MTU1_DANRE (Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Danio rerio OX=7955 GN=trmu PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 6.793e-99
Identity = 170/387 (43.93%), Postives = 236/387 (60.98%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKK-KFNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSS------FGNFLEKAN---FKETPLLMRPV------DRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKVQ----FQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQIL 1224
            + ++R V C +SGGVDS+VSA LLK+  ++V GVFMKNWD ++EKG CS D D  D+  VC+ L IPF EV++VKEYW+ VF   L  YE+G TPNPD++CNKHIKF  F ++ +  L  DA ATGHYAR+S      F   L +A    F++   + +PV      D +KDQ+F+L QI+   L   +FPLA LTK  VKKIA E G    L +KESMG+CFIGKR F NFI  Y+EP+ GNF  +E+G+++GKHKG    TLGQ+  +    +A +    D  T ++ +  S+ HPALF  +L TD  HW+  +          +     F N+    PC+V +  DG ++ + + E  R +  GQ+AVLY   +  C+GS +I+
Sbjct:    1 MGVLRHVVCAMSGGVDSSVSALLLKRMGYHVTGVFMKNWDSQEEKGLCSSDRDCEDAYKVCKMLDIPFHEVSYVKEYWHEVFSNLLWEYERGRTPNPDIICNKHIKFKHFYQYAVNTLGADAMATGHYARTSQEDEEVFQQKLTEAPKSLFRDRFEIRKPVRLYQGADLLKDQTFFLSQISQDALRHTLFPLAGLTKGYVKKIAAEAGFQHVLKKKESMGICFIGKRDFENFILEYLEPRPGNFVSIEDGQIMGKHKGWFTLTLGQRARIGGRADAWFVVDKDVTTADVFVCPSTFHPALFRDTLQTDRFHWIAEEPPAELVHTQMMDCHFCFNNRMPLTPCTVTLNLDG-SVWVMVKEPMRGMATGQFAVLYKGHE--CLGSGKII 384          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. UniProt/SwissProt
Match: sp|O75648|MTU1_HUMAN (Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Homo sapiens OX=9606 GN=TRMU PE=1 SV=2)

HSP 1 Score: 301.597 bits (771), Expect = 1.370e-95
Identity = 158/388 (40.72%), Postives = 229/388 (59.02%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSF---------------GNFLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKV-----QFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQIL 1224
            +  +R V C +SGGVDSAV+A LL+++ + V GVFMKNWD  DE G C+ D D  D+  VC+ L IPF +V++VKEYWN+VF + L+ YEKG TPNPD++CNKHIKF+ F  + ++ L  DA ATGHYAR+S                G F  +   +    L++  D  KDQ+F+L Q++   L + IFPL  LTK  VKKIA E  L   L +KESMGMCFIGKR F +F+  Y++P+ G+F  +E+ +V+G HKG   YTLGQ+  +   +   Y    D    ++ +   ++HPAL+   L T   HW+  +       R K+     +F+++   +PC + +  DG  + +   +  R +  GQ+AV Y  D+  C+GS +IL
Sbjct:    1 MQALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEE-PPAALVRDKMMECHFRFRHQMALVPCVLTLNQDG-TVWVTAVQAVRALATGQFAVFYKGDE--CLGSGKIL 384          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. UniProt/SwissProt
Match: sp|Q5RB73|MTU1_PONAB (Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Pongo abelii OX=9601 GN=TRMU PE=2 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 7.435e-93
Identity = 157/389 (40.36%), Postives = 229/389 (58.87%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSF---------------GNFLEKANFKETPLLMRPVDRVKDQSFWLCQI-NPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKV-----QFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQIL 1224
            +  +R V C +SGGVDSAV+A LL+++ + V GVFMKNWD  DE G C+ D D  D+  VC+ L IPF +V++VKEYWN+VF + L+ YEKG TPNPD++CNKHIKF+ F  + ++ L  DA ATGHYAR+S                G F  +   +    L++  D  K Q+F+L Q+ +   L + IFPL  LTK  VKKIA E  L   L +KESMGMCFIGKR F +F+  Y++P+ G+F  +E+ +V+G HKG   YTLGQ+  +   +   Y    D    ++ +   ++HPAL+   L T   HW+  +   +   R K+     +F+++   +PC + +  DG  + +   +  R +  GQ+AV Y  D+  C+GS +IL
Sbjct:    1 MQAVRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFEQKHIKKPEGLFRNRFEVRNAVKLLQAADSFKGQTFFLSQVFSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAVL-VRDKMMECHFRFRHQMALVPCVLTLNQDG-TVWVTAVQAVRALATGQFAVFYKGDE--CLGSGKIL 385          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. TrEMBL
Match: A0A0X3P4W7 (Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Schistocephalus solidus OX=70667 GN=MTU1 PE=4 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 8.594e-125
Identity = 191/396 (48.23%), Postives = 258/396 (65.15%), Query Frame = 1
Query:  133 IRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLE---------------KLEVDAFATGHYARSSFGNFLEKANFK---ETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKT-GLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKVQFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILSSISAWQEGHSE 1260
            +  VAC +SGGVDSAVSAFLLK++ FNV+GVFM+NWD  DE   CS D DR D+K++C  L I F E+NFVKEYW  VF   + +Y +G TPNPD+LCN  +KF   A+  L+                ++ DAFATGHYA++SFGNFLE+   +   E PLL+R  D VKDQ+FWLC +  KYL   +FP+  LTK  VK+IA+EIGL K ++R+ESMG+CFIGKRKFR+FID YIEP+ G F   E GEV+G+H G+HH+TLGQ+  G++ GQ   Y A +   +QEI +V  + HPALFM+   T+ P W+      L S     Q+QNK+ ++P  +   +D   L I +++  RC+  GQ+A LY  +  +C+G + I  SIS  +EG +E
Sbjct:    8 VYRVACAVSGGVDSAVSAFLLKQRGFNVVGVFMRNWDQHDETLHCSSDADREDAKFICHKLGIEFCELNFVKEYWQRVFMPLVDAYTRGLTPNPDILCNSFVKFQMLAKTTLKPELRSVFSSDSLGITSVDADAFATGHYAQNSFGNFLERRLSRPESEMPLLLRSADPVKDQTFWLCTVAAKYLQCAMFPVGKLTKPVVKEIAREIGLDKIVARRESMGICFIGKRKFRDFIDNYIEPRPGIFKDYETGEVLGEHSGVHHFTLGQRVPGITKGQVPFYIAKLIASSQEISVVRGATHPALFMRRCLTEPPIWVSGYAPKLPSSDYSFQWQNKWRAVPALIAPISDSSGLSICLEKPMRCVASGQHAALYHRN--VCLGGAVIRKSISLAEEGLTE 401          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. TrEMBL
Match: A0A564YIX1 (Uncharacterized protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6422 PE=4 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 9.009e-124
Identity = 199/401 (49.63%), Postives = 260/401 (64.84%), Query Frame = 1
Query:  133 IRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARF-------CLEKLEVDAFATGHYARSSFGNFLEKANFKET-PLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKT-GLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKVQFQNKFCSIPCSVNV-TNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILSSISAWQEG-HSEQLKWDSGKLENKY 1299
            IR VAC ISGGVDSAVSA+LLK+K F+V+GVFM NW  +DEK KCSVD DR  +++V + L I FVE+NFVKEYWN+VF + +  Y  G TPNPD+LCN+ +KF   + +       C   +  DAFATGHYA++SFGNFLEK N   + PLL+R VDRVKDQ+FWLC I+ ++L  C+FP+  LTK  VK+IA  IGL K   +KESMG+CFIGKR F  FID YIEP  G    LE G + G+H G+HH+TLGQK  G++ G  A Y A +D K+QE+ +V    HP+L+M+S  T+   W+  +Y +L S     Q+QNK+  I C ++    + + L I +    RCI PGQ+A +Y    EIC+G + I SS S + EG H     W     E  Y
Sbjct:    5 IRRVACAISGGVDSAVSAYLLKRKGFDVVGVFMTNWSQQDEKFKCSVDADREHARFVAKKLGIDFVELNFVKEYWNDVFSKIVEVYAGGKTPNPDILCNRFVKFEKLSEYALKHSSDCHPSICADAFATGHYAQNSFGNFLEKRNGHSSRPLLLRSVDRVKDQTFWLCNISWRHLQHCMFPIGTLTKPKVKEIAVSIGLEKIAKKKESMGICFIGKRNFSEFIDKYIEPTRGLIIELETGHIFGEHSGVHHFTLGQKIPGVTWGNEAFYVAKLDSKSQEVFIVQGDCHPSLYMQSCVTEPAVWISEKYPSLPSDEFHFQWQNKWRPIGCRIDRDIFNPQALSIYLQRPMRCIAPGQFAAIYK--GEICLGGAMIKSSRSLFDEGRHKPFSDWHISDFEVHY 403          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. TrEMBL
Match: A0A068WSH1 (Mitochondrial tRNA specific 2 thiouridylase OS=Echinococcus granulosus OX=6210 GN=EgrG_001192300 PE=4 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 2.811e-122
Identity = 194/407 (47.67%), Postives = 263/407 (64.62%), Query Frame = 1
Query:  121 LLNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARF-------CLEKLEVDAFATGHYARSSFGNFLE-KANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKT-GLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKVQFQNKFCSIPCSV-NVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILSSISAWQEGHSEQ-LKWDSGKLENKYLH 1305
            L   IR VAC ISGGVDSAVSA+LLK K F+V+G+FM NWD +DE  KCS DVDR D+++VC  L I FVE+NFVKEYWN+VF +T+ SY +G TPNPD+LCN+++KF             C   +  DA ATGHYA++S+GNFLE +A     P L+R VD VKDQ+FWLC I+ ++L  C+FP+ +L K  VK+IA  +GL +   RKESMG+CFIGKR F +FID YIEP+ G    LE G V G+H G+HH+T+GQK  G++ G+   Y A +D K QE+ +V  + HP+LFM+   T+   W+  +   L S   + Q+QNK+  +PC + N  ND   L I++ +  RCI  GQYA  Y  +  +C+G + I S+ S ++ G+ E    W     E K +H
Sbjct:    4 LSGPIRRVACAISGGVDSAVSAYLLKHKGFDVVGMFMTNWDQQDEAIKCSTDVDREDARFVCRKLGIEFVELNFVKEYWNDVFVKTIDSYAEGKTPNPDILCNRYVKFQKLTECALRWSPKCHPAVHADAVATGHYAQNSYGNFLEDRAILSSPPKLLRSVDPVKDQTFWLCNISWRHLQHCMFPVGNLMKSRVKEIAASVGLERIAKRKESMGICFIGKRNFCDFIDKYIEPRRGLIIGLETGLVFGEHSGVHHFTIGQKVPGITWGKEPFYIAKLDSKAQEVFIVQGTYHPSLFMRECWTEPAVWIAEESPPLPSTDYEFQWQNKWRPVPCFMQNTQNDKSGLYIQLQKPMRCIAAGQYAAFYKGN--VCLGGAMINSAKSLFEIGNIEPYYNWRLSDFEGKSVH 408          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. TrEMBL
Match: A0A0R3SQ77 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7205 PE=4 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 4.456e-122
Identity = 200/406 (49.26%), Postives = 260/406 (64.04%), Query Frame = 1
Query:  133 IRTVACGISGGVDSAVSAFLLKKK---FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEET---LSSYEKGFTPNPDVLCNKHIKFNSFARF-------CLEKLEVDAFATGHYARSSFGNFLEKANFKET-PLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKT-GLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKVQFQNKFCSIPCSVNV-TNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILSSISAWQEG-HSEQLKWDSGKLENKY 1299
            IR VAC ISGGVDSAVSA+LLK+K   F+V+GVFM NW  +DEK KCSVD DR  +++V + L I FVE+NFVKEYWN+VF E    +  Y  G TPNPD+LCN+ +KF   + +       C   +  DAFATGHYA++SFGNFLEK N   + PLL+R VDRVKDQ+FWLC I+ ++L  C+FP+  LTK  VK+IA  IGL K   +KESMG+CFIGKR F  FID YIEP  G    LE G + G+H G+HH+TLGQK  G++ G  A Y A +D K+QE+ +V    HP+L+M+S  T+   W+  +Y +L S     Q+QNK+  I C ++    + + L I +    RCI PGQ+A +Y    EIC+G + I SS S + EG H     W     E  Y
Sbjct:    8 IRRVACAISGGVDSAVSAYLLKRKGNSFDVVGVFMTNWSQQDEKFKCSVDADREHARFVAKKLGIDFVELNFVKEYWNDVFRENSKIVEVYAGGKTPNPDILCNRFVKFEKLSEYALKHSSDCHPSICADAFATGHYAQNSFGNFLEKRNGHSSRPLLLRSVDRVKDQTFWLCNISWRHLQHCMFPIGTLTKPKVKEIAVSIGLEKIAKKKESMGICFIGKRNFSEFIDKYIEPTRGLIIELETGHIFGEHSGVHHFTLGQKIPGVTWGNEAFYVAKLDSKSQEVFIVQGDCHPSLYMQSCVTEPAVWISEKYPSLPSDEFHFQWQNKWRPIGCRIDRDIFNPQALSIYLQRPMRCIAPGQFAAIYK--GEICLGGAMIKSSRSLFDEGRHKPFSDWHISDFEVHY 411          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. TrEMBL
Match: A0A068XUQ5 (Mitochondrial tRNA specific 2 thiouridylase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001192300 PE=4 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 1.553e-121
Identity = 194/407 (47.67%), Postives = 262/407 (64.37%), Query Frame = 1
Query:  121 LLNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARF-------CLEKLEVDAFATGHYARSSFGNFLE-KANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKT-GLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKVQFQNKFCSIPCSV-NVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILSSISAWQEGHSEQL-KWDSGKLENKYLH 1305
            L   IR VAC ISGGVDSAVSA+LLK K F+V+G+FM NWD +DE  KCS DVDR D+ +VC  L I FVE+NFVKEYWN+VF +T+ SY +G TPNPD+LCN+++KF             C   +  DA ATGHYA++S+GNFLE +A     P L+R VD VKDQ+FWLC I+ ++L  C+FP+ +L K  VK+IA  +GL +   RKESMG+CFIGKR F +FID YIEP+ G    LE G V G+H G+HH+T+GQK  G++ G+   Y A +D K QE+ +V  + HP+LFM+   T+   W+  +   L S   + Q+QNK+  +PC + N  ND   L I++ +  RCI  GQYA  Y  +  +C+G + I S+ S ++ G+ E    W     E K +H
Sbjct:    4 LSGPIRRVACAISGGVDSAVSAYLLKHKGFDVVGMFMTNWDQQDEAIKCSTDVDREDAWFVCRKLGIEFVELNFVKEYWNDVFVKTIDSYAEGKTPNPDILCNRYVKFQKLTECALRWSPKCHPAVHADAVATGHYAQNSYGNFLEDRAILSSPPKLLRSVDPVKDQTFWLCNISWRHLQHCMFPVGNLMKSKVKEIAASVGLERIAKRKESMGICFIGKRNFCDFIDKYIEPRRGLIIGLETGLVFGEHSGVHHFTIGQKVPGVTWGKEPFYIAKLDSKAQEVFIVQGTYHPSLFMRECWTEPAVWIAERSPPLPSTDYEFQWQNKWRPVPCFIQNTQNDRSGLYIKLQKPMRCIAAGQYAAFYKGN--VCLGGAMINSTRSLFEIGNIEPYHNWRLSDFEGKSVH 408          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Cavefish
Match: trmu (tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [Source:NCBI gene;Acc:103028805])

HSP 1 Score: 304.679 bits (779), Expect = 7.408e-98
Identity = 163/387 (42.12%), Postives = 229/387 (59.17%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGN---------------FLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCN----QYKNLTSFRSKVQFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQIL 1224
            ++ +R V C +SGGVDS+V+A LLK++ + V GVFMKNWD  DEKG C+ + D  D+  VC  L IPF +V++VKEYW+ VF   L  Y++G TPNPD++CNK IKF  F ++ +  L  DA ATGHYAR+S  +               F ++   +    L +  D +KDQ+F+L QI+   L + IFPLA LTK  VKKIA E G    L +KESMG+CFIG+R F +FI  Y+EPK G+F  +E+G+++G HKG   +TLGQ+  +   ++  +    D  T EI +  ++NHPAL   +L TD  HW+      Q           +F ++    PC+V +  DG  L I I    R I  GQ+AVLY  D+  C+GS +I+
Sbjct:    1 MSAVRHVVCAMSGGVDSSVAALLLKRRGYQVTGVFMKNWDSLDEKGVCTSEKDCDDAYKVCRALDIPFHQVSYVKEYWHEVFSNLLREYQRGRTPNPDIICNKLIKFKHFHQYAVSNLGADAMATGHYARTSLEDDEVFMQTQTPAPRTLFRDRLEIRNPVRLYQGADLLKDQTFFLSQISQDALRQTIFPLAGLTKDFVKKIAAEAGFHHVLKKKESMGICFIGERNFEDFILEYLEPKPGHFVSIEDGKIMGTHKGWFTFTLGQRARIGGQKDPWFVVDKDITTGEIFVGPTTNHPALLRDTLQTDRFHWIAEEPPAQLVQTQMMDCHFRFLHQMPLTPCTVTLNLDG-TLWITIKMPLRAITTGQFAVLYKGDE--CLGSGKII 384          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Cavefish
Match: trmu (tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [Source:NCBI gene;Acc:103028805])

HSP 1 Score: 248.054 bits (632), Expect = 1.952e-76
Identity = 147/387 (37.98%), Postives = 207/387 (53.49%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGN---------------FLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCN----QYKNLTSFRSKVQFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQIL 1224
            ++ +R V C +SGGVDS+V+A LLK++ + V GVFMKNWD  DEKG C+ + D  D+  VC  L IPF +V++VKEYW+ VF   L  Y++G TPNPD++CNK IKF  F ++ +  L  DA ATGHYAR+S  +               F ++   +    L +  D +KDQ+F+L QI+   L + IFPLA LTK  VKKIA E G    L +KES     + K +F                      ++G HKG   +TLGQ+  +   ++  +    D  T EI +  ++NHPAL   +L TD  HW+      Q           +F ++    PC+V +  DG  L I I    R I  GQ+AVLY  D+  C+GS +I+
Sbjct:    1 MSAVRHVVCAMSGGVDSSVAALLLKRRGYQVTGVFMKNWDSLDEKGVCTSEKDCDDAYKVCRALDIPFHQVSYVKEYWHEVFSNLLREYQRGRTPNPDIICNKLIKFKHFHQYAVSNLGADAMATGHYARTSLEDDEVFMQTQTPAPRTLFRDRLEIRNPVRLYQGADLLKDQTFFLSQISQDALRQTIFPLAGLTKDFVKKIAAEAGFHHVLKKKES-----VFKAEF---------------------SIMGTHKGWFTFTLGQRARIGGQKDPWFVVDKDITTGEIFVGPTTNHPALLRDTLQTDRFHWIAEEPPAQLVQTQMMDCHFRFLHQMPLTPCTVTLNLDG-TLWITIKMPLRAITTGQFAVLYKGDE--CLGSGKII 358          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Yeast
Match: SLM3 (tRNA-specific 2-thiouridylase; responsible for 2-thiolation of the wobble base of mitochondrial tRNAs; human homolog TRMU is implicated in myoclonus epilepsy associated with ragged red fibers (MERRF), and can complement yeast null mutant [Source:SGD;Acc:S000002191])

HSP 1 Score: 181.8 bits (460), Expect = 5.229e-52
Identity = 124/387 (32.04%), Postives = 194/387 (50.13%), Query Frame = 1
Query:  142 VACGISGGVDSAVSAFLLKKKF-NVIGVFMKNWDDK---DEKGKCS-VDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAF--ATGHYARSSFGNFLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKR---KFRNFIDAYIEPKIGNFTLLENGEVV----GKHKGIHHYTLGQKTGLSLG------QNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKVQFQNKFCSI-------PCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQI 1221
            V   +S GVDS+V+A L   +F N  GV+M+NW +    D+ GK    + D  D   V ++L I   +VNF ++YW +VFE  L  Y +G TPNPD+ CNK +KF     +  EK     +   TGHYAR      +++ N K    L+R + R KDQS++L QIN   LS  + P+  LTK  V+ +A+  GL  T  + +S G+CF+      KF+NF+  Y+    G+   ++         G+H G+  YT+GQK G+S+       Q   + +     T EI +V   ++PAL+  ++  +    L  +   + +F++      +F S+        C +N + D  ++ I +    R I PGQ   LY   D+  +GS  I
Sbjct:   29 VIVAMSSGVDSSVAAALFAGEFPNTRGVYMQNWSESQSLDDPGKEPCYERDWRDVNRVAKHLNIRVDKVNFEQDYWIDVFEPMLRGYSEGSTPNPDIGCNKFVKFGKLREWLDEKYGTGNYWLVTGHYAR-----VMQEMNGKGLFHLLRSIYRPKDQSYYLSQINSTVLSSLLLPIGHLTKPEVRDLAKYAGL-PTAEKPDSQGICFVNNSQHGKFKNFLKHYLPSSPGDIITVDPQSGAKTTWGRHDGLWSYTIGQKVGISMPQADPNYQGTWFVSEKLRDTNEILIVRGRDNPALYSDTMRIENFSSLGPREDTINAFQNTGALTLQFRSLQVPVQIKSCKLNRSADNLDITIHLASKQRAITPGQSCCLYI--DDRVLGSGPI 407          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Medaka
Match: trmu (tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [Source:NCBI gene;Acc:101157506])

HSP 1 Score: 303.908 bits (777), Expect = 1.558e-97
Identity = 164/388 (42.27%), Postives = 233/388 (60.05%), Query Frame = 1
Query:  124 LNMIRTVACGISGGVDSAVSAFLLKKK-FNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGN---------------FLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKV-----QFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQIL 1224
            + +IR V C +SGGVDS+V+A LLK++ +NV GVFM+NWD  DE G CS   D  D+  VC  L IPF +V +VKE+W+ VF   L  YE+G TPNPD+LCNK IKFN F ++ +  L  DA ATGHYAR+S  +               F ++        L    D+ KDQ+F+L QI+   L + +FPLA LTK  VKK+A E GL   L +KESMG+CFIG+R F+NFI  Y+EPK GN   +E+G V+G H+G    TLGQ+  +   +   +    D +T ++ +  ++NHPALF  +L T+  HW+        + RS++     +F ++   +PCSV +  DG ++ I +    R + PGQ+AVLY  D+  C+GS +I+
Sbjct:    1 MGLIRHVVCAMSGGVDSSVAALLLKRRGYNVTGVFMRNWDSLDEGGLCSSQRDCEDALRVCHILDIPFHQVCYVKEFWHEVFSYLLKEYERGRTPNPDILCNKRIKFNYFHKYAIHTLGADAMATGHYARTSQEDDEVFQQSHVAPPTSLFRDRFQIPNPVRLHTAADQSKDQTFFLSQISQDALRQTLFPLAGLTKEFVKKMAAEAGLHHVLKKKESMGICFIGERNFQNFILEYLEPKPGNLVSVEDGAVMGSHQGWFTLTLGQRARIGGLKEPWFVVDKDVETGDVFVAPTTNHPALFRDTLRTNRFHWVTRDPPPDLA-RSQMLECHFRFIHQMALVPCSVTLNLDG-SVWISLSRPVRALTPGQFAVLYKGDE--CLGSGKIV 384          
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Planmine SMEST
Match: SMESG000018923.1 (SMESG000018923.1)

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 398/401 (99.25%), Postives = 399/401 (99.50%), Query Frame = 1
Query:  130 MIRTVACGISGGVDSAVSAFLLKKKFNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGNFLEKANFKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTSFRSKVQFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILSSISAWQEGHSEQLKWDSGKLENKYLHNTTDIAEIN 1332
            MIRTVACGISGGVDSAVSAFLLKKKFNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGNFLEKAN KETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLT+FRSKVQFQNKFCSIPCSVNV NDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILSSISAWQEGHSEQLKWDSGKLENKYLHNTTDIAEIN
Sbjct:    1 MIRTVACGISGGVDSAVSAFLLKKKFNVIGVFMKNWDDKDEKGKCSVDVDRADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNKHIKFNSFARFCLEKLEVDAFATGHYARSSFGNFLEKANSKETPLLMRPVDRVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKESMGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKTGLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYKNLTNFRSKVQFQNKFCSIPCSVNVINDGRNLQIRIDEWFRCIVPGQYAVLYSPDDEICIGSSQILSSISAWQEGHSEQLKWDSGKLENKYLHNTTDIAEIN 401          
The following BLAST results are available for this feature:
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRMU2.852e-9640.72tRNA 5-methylaminomethyl-2-thiouridylate methyltra... [more]
TRMU1.139e-8743.99tRNA 5-methylaminomethyl-2-thiouridylate methyltra... [more]
TRMU1.192e-7640.51tRNA 5-methylaminomethyl-2-thiouridylate methyltra... [more]
TRMU1.973e-7343.06tRNA 5-methylaminomethyl-2-thiouridylate methyltra... [more]
TRMU2.846e-4942.72tRNA 5-methylaminomethyl-2-thiouridylate methyltra... [more]
back to top
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mttu-11.391e-8239.62Probable mitochondrial tRNA-specific 2-thiouridyla... [more]
back to top
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG30213.126e-10243.82gene:FBgn0040337 transcript:FBtr0070173[more]
back to top
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trmu1.261e-10044.19tRNA 5-methylaminomethyl-2-thiouridylate methyltra... [more]
back to top
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ahctf12.043e-10241.13AT-hook containing transcription factor 1 [Source:... [more]
ahctf12.033e-10140.93AT-hook containing transcription factor 1 [Source:... [more]
ahctf12.207e-10141.25AT-hook containing transcription factor 1 [Source:... [more]
ahctf18.979e-10040.72AT-hook containing transcription factor 1 [Source:... [more]
ahctf15.163e-9940.24AT-hook containing transcription factor 1 [Source:... [more]
back to top
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Trmu1.085e-9338.48tRNA 5-methylaminomethyl-2-thiouridylate methyltra... [more]
Trmu3.658e-2654.88tRNA 5-methylaminomethyl-2-thiouridylate methyltra... [more]
back to top
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZKW0|MTU1_CHICK2.036e-10142.13Mitochondrial tRNA-specific 2-thiouridylase 1 OS=G... [more]
sp|Q9W5B6|MTU1_DROME3.133e-10143.82Mitochondrial tRNA-specific 2-thiouridylase 1 OS=D... [more]
sp|Q503J2|MTU1_DANRE6.793e-9943.93Mitochondrial tRNA-specific 2-thiouridylase 1 OS=D... [more]
sp|O75648|MTU1_HUMAN1.370e-9540.72Mitochondrial tRNA-specific 2-thiouridylase 1 OS=H... [more]
sp|Q5RB73|MTU1_PONAB7.435e-9340.36Mitochondrial tRNA-specific 2-thiouridylase 1 OS=P... [more]
back to top
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P4W78.594e-12548.23Mitochondrial tRNA-specific 2-thiouridylase 1 OS=S... [more]
A0A564YIX19.009e-12449.63Uncharacterized protein (Fragment) OS=Hymenolepis ... [more]
A0A068WSH12.811e-12247.67Mitochondrial tRNA specific 2 thiouridylase OS=Ech... [more]
A0A0R3SQ774.456e-12249.26Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A068XUQ51.553e-12147.67Mitochondrial tRNA specific 2 thiouridylase OS=Ech... [more]
back to top
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trmu7.408e-9842.12tRNA 5-methylaminomethyl-2-thiouridylate methyltra... [more]
trmu1.952e-7637.98tRNA 5-methylaminomethyl-2-thiouridylate methyltra... [more]
back to top
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SLM35.229e-5232.04tRNA-specific 2-thiouridylase; responsible for 2-t... [more]
back to top
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trmu1.558e-9742.27tRNA 5-methylaminomethyl-2-thiouridylate methyltra... [more]
back to top
BLAST of Mitochondrial tRNA specific 2 thiouridylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000018923.10.000e+099.25SMESG000018923.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012399 ID=SMED30012399|Name=Mitochondrial tRNA specific 2 thiouridylase|organism=Schmidtea mediterranea sexual|type=transcript|length=1724bp
TCAAGATTGTTAAATATTTGAATAATATTTTAATGAATATATTCAGTTTT
TCTAATTTTAATTAATTTAGAATTCAAAAAATTGATATTTTATATTAATA
CTCTATTTTCCAATTTCAATTTATTAAATATGATAAGAACTGTTGCATGC
GGAATTTCTGGTGGGGTTGATAGCGCCGTTTCAGCTTTTTTATTGAAAAA
AAAATTCAATGTTATTGGAGTATTTATGAAAAATTGGGACGATAAAGATG
AAAAAGGGAAATGTTCAGTTGATGTTGATAGAGCTGATTCTAAATACGTT
TGTGAATATTTAAAAATTCCATTTGTTGAAGTGAATTTTGTAAAAGAATA
TTGGAATAATGTATTTGAAGAAACATTAAGTAGTTACGAAAAAGGATTTA
CTCCGAATCCAGATGTATTATGCAATAAACACATAAAATTCAATAGTTTC
GCTCGGTTTTGCCTGGAGAAACTTGAGGTAGATGCATTTGCAACTGGTCA
TTATGCTCGATCATCATTTGGAAATTTCCTTGAGAAAGCAAACTTCAAAG
AAACCCCATTACTAATGAGACCAGTAGATCGAGTCAAAGATCAAAGTTTT
TGGCTTTGCCAAATCAATCCGAAATATCTTTCAAAATGCATATTTCCATT
AGCTGATCTCACAAAAATTACTGTTAAAAAGATTGCACAAGAAATCGGTT
TAACAAAAACTTTATCTAGGAAAGAGAGCATGGGCATGTGTTTCATTGGC
AAACGGAAATTTCGCAATTTTATCGATGCTTATATAGAACCTAAAATAGG
TAATTTTACACTGTTGGAAAATGGAGAAGTTGTTGGAAAGCATAAAGGTA
TCCATCATTATACACTTGGTCAAAAAACAGGTTTATCATTGGGACAAAAT
GCTTGTTATAGTGCACACATGGATCACAAAACTCAAGAAATAAAATTGGT
GTTTAGCTCCAATCATCCGGCATTATTTATGAAGTCATTGACCACCGACG
CTCCTCATTGGTTATGCAATCAATATAAAAATCTTACTAGCTTTCGATCC
AAAGTTCAGTTTCAAAATAAATTTTGTAGCATTCCGTGTTCTGTGAATGT
TACTAATGATGGGAGAAATTTGCAAATAAGAATCGATGAATGGTTTCGAT
GTATTGTTCCCGGGCAGTACGCTGTGCTCTATTCGCCAGACGATGAAATC
TGTATTGGGAGTTCTCAGATATTGTCATCGATCTCTGCATGGCAAGAGGG
CCATTCTGAGCAACTGAAATGGGATTCAGGAAAGCTGGAAAACAAATATC
TACACAACACAACTGATATAGCCGAAATAAATTAGCTAATAAATAATGTG
TTTAGATTTTCCGGCTTTATTAAATATTATCGTGTAGTGTTTTGTTTATC
GGATTTTCCATGTGAGGAATTCGTTGGCTTGAAATGGCTGTGACTGGGCG
TTGGAAGAGATTTTTGAATATATTCCCTGATTGGTATATGTATATTCAGC
CATGTTTTAGAAAAACAATGATCTGACGTTCCAACATCACAACTTGACCA
AAAATATTATCAAACCAAATCTTATTTTTGAGAGTTTGTTTAAATGTTGT
AAAGATATTTTAAACATGTTGAAATTAAATTTAAGAATTTGGTTTAAATG
AAGTGGAATTTGTACATTTTTAATAATGCATTAAATGATTTTTAAATTAA
AATTTTTGTTTTAGTGAAGTGGTT
back to top

protein sequence of SMED30012399-orf-1

>SMED30012399-orf-1 ID=SMED30012399-orf-1|Name=SMED30012399-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=402bp
MIRTVACGISGGVDSAVSAFLLKKKFNVIGVFMKNWDDKDEKGKCSVDVD
RADSKYVCEYLKIPFVEVNFVKEYWNNVFEETLSSYEKGFTPNPDVLCNK
HIKFNSFARFCLEKLEVDAFATGHYARSSFGNFLEKANFKETPLLMRPVD
RVKDQSFWLCQINPKYLSKCIFPLADLTKITVKKIAQEIGLTKTLSRKES
MGMCFIGKRKFRNFIDAYIEPKIGNFTLLENGEVVGKHKGIHHYTLGQKT
GLSLGQNACYSAHMDHKTQEIKLVFSSNHPALFMKSLTTDAPHWLCNQYK
NLTSFRSKVQFQNKFCSIPCSVNVTNDGRNLQIRIDEWFRCIVPGQYAVL
YSPDDEICIGSSQILSSISAWQEGHSEQLKWDSGKLENKYLHNTTDIAEI
N*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004506tRNA-specific_2-thiouridylase
IPR014729Rossmann-like_a/b/a_fold
IPR023382Adenine_a_hdrlase_dom
Vocabulary: molecular function
TermDefinition
GO:0016783sulfurtransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0008033tRNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.40.30.10coord: 282..369
e-value: 4.9E-10
score: 41.2
NoneNo IPR availablePFAMPF03054tRNA_Me_transcoord: 4..364
e-value: 2.5E-112
score: 375.2
NoneNo IPR availablePANTHERPTHR11933TRNA 5-METHYLAMINOMETHYL-2-THIOURIDYLATE -METHYLTRANSFERASEcoord: 3..367
NoneNo IPR availablePANTHERPTHR11933:SF5MITOCHONDRIAL TRNA-SPECIFIC 2-THIOURIDYLASE 1coord: 3..367
NoneNo IPR availableSUPERFAMILYSSF52402Adenine nucleotide alpha hydrolases-likecoord: 4..249
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 2..217
e-value: 5.0E-77
score: 260.3
IPR023382Adenine nucleotide alpha hydrolase-like domainsGENE3DG3DSA:2.30.30.280coord: 218..281
e-value: 1.8E-10
score: 42.0
IPR004506tRNA-specific 2-thiouridylaseTIGRFAMTIGR00420TIGR00420coord: 4..364
e-value: 2.5E-104
score: 346.9
IPR004506tRNA-specific 2-thiouridylaseCDDcd01998tRNA_Me_transcoord: 4..361
e-value: 9.79309E-141
score: 403.056