40S ribosomal protein SA

Overview
Name40S ribosomal protein SA
Smed IDSMED30012383
Length (bp)866
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 40S ribosomal protein SA (SMED30012383) t-SNE clustered cells

Violin plots show distribution of expression levels for 40S ribosomal protein SA (SMED30012383) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 40S ribosomal protein SA (SMED30012383) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 40S ribosomal protein SA (SMED30012383) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012383

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012383SMESG000071180.1 SmedASXL_003053SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30012383SMESG000071180.1 dd_Smed_v4_171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30012383SMESG000071180.1 dd_Smed_v4_171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012383SMESG000071180.1 dd_Smed_v4_171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012383SMESG000071180.1 dd_Smed_v4_171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012383SMESG000071180.1 dd_Smed_v4_171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012383SMESG000071180.1 dd_Smed_v4_171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012383SMESG000071180.1 dd_Smed_v4_171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012383SMESG000071180.1 dd_Smed_v4_171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012383SMESG000071180.1 dd_Smed_v4_171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012383SMESG000071180.1 dd_Smed_v4_171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012383SMESG000071180.1 dd_Smed_v4_171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012383SMESG000071180.1 dd_Smed_v4_171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012383SMESG000071180.1 SMESG000042239.1 Contig55352uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012383SMESG000071180.1 SMESG000042239.1 Contig55352newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
progenitor cellSMED30012383SMESG000071180.1 dd_Smed_v6_171_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012383SMESG000071180.1 dd_Smed_v6_171_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30012383SMESG000071180.1 dd_Smed_v6_171_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 40S ribosomal protein SA vs. Ensembl Human
Match: RPSA (ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:6502])

HSP 1 Score: 281.182 bits (718), Expect = 4.448e-94
Identity = 127/204 (62.25%), Postives = 154/204 (75.49%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQ 691
             E D L  + AG H+G  N +FQM+QY++ R   G +I+ L +  EKL LAARAIVA+ENP DV VISSR + QR VLKF   TGA PIAGRFTPGTFTNQIQ AFREPRLL+V+DP ADHQ + E+S+VN+P IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK++
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEE 214          
BLAST of 40S ribosomal protein SA vs. Ensembl Human
Match: RPSA (ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:6502])

HSP 1 Score: 279.641 bits (714), Expect = 6.821e-94
Identity = 127/204 (62.25%), Postives = 154/204 (75.49%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQ 691
             E D L  + AG H+G  N +FQM+QY++ R   G +I+ L +  EKL LAARAIVA+ENP DV VISSR + QR VLKF   TGA PIAGRFTPGTFTNQIQ AFREPRLL+V+DP ADHQ + E+S+VN+P IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK++
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEE 214          
BLAST of 40S ribosomal protein SA vs. Ensembl Human
Match: RPSA (ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:6502])

HSP 1 Score: 274.248 bits (700), Expect = 2.519e-91
Identity = 127/209 (60.77%), Postives = 154/209 (73.68%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQ-----RGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQ 691
             E D L  + AG H+G  N +FQM+QY++ R   G +I+ L +  EKL LAARAIVA+ENP DV VISSR + Q     R VLKF   TGA PIAGRFTPGTFTNQIQ AFREPRLL+V+DP ADHQ + E+S+VN+P IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK++
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQVCGTVRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEE 219          
BLAST of 40S ribosomal protein SA vs. Ensembl Human
Match: RPSA (ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:6502])

HSP 1 Score: 138.658 bits (348), Expect = 1.060e-40
Identity = 65/105 (61.90%), Postives = 76/105 (72.38%), Query Frame = 2
Query:   83 ENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAF 397
            E D L  + AG H+G  N +FQM+QY++ R   G +I+ L +  EKL LAARAIVA+ENP DV VISSR + QR VLKF   TGA PIAGRFTPGTFTNQIQ AF
Sbjct:   12 EEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAF 116          
BLAST of 40S ribosomal protein SA vs. Ensembl Celegans
Match: rps-0 (40S ribosomal protein SA [Source:UniProtKB/Swiss-Prot;Acc:P46769])

HSP 1 Score: 223.402 bits (568), Expect = 4.925e-72
Identity = 111/209 (53.11%), Postives = 149/209 (71.29%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDW-----EVKVDLFIVRNVEEDEKQQ 691
             E D + ++    H+G+ N NFQM QYV+ R   G +I+ + K  EKL LAARAI AVENP DV V+S+RP +QR +LKF  +TGA  I GRF+PG  TNQIQK F+EPRLL++SDP  DHQAV E+S+V +PVI+F NT+S +K +DI +PCNNKGE+SIGLMW++LARE+  ++G ISR   +     E+  DL+  R+  E EK++
Sbjct:   11 TEEDVMKLLATQAHLGSTNLNFQMQQYVYKRRFDGPNIINVKKTWEKLLLAARAIAAVENPADVVVVSARPYAQRALLKFAAHTGATAIFGRFSPGCLTNQIQKTFKEPRLLVISDPRIDHQAVTEASYVGVPVISFVNTESPLKLIDIGVPCNNKGERSIGLMWWMLAREILILRGKISRQTGFVLEGKEIMPDLYFYRDPTETEKEE 219          
BLAST of 40S ribosomal protein SA vs. Ensembl Celegans
Match: rps-0 (40S ribosomal protein SA [Source:UniProtKB/Swiss-Prot;Acc:P46769])

HSP 1 Score: 223.402 bits (568), Expect = 4.925e-72
Identity = 111/209 (53.11%), Postives = 149/209 (71.29%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDW-----EVKVDLFIVRNVEEDEKQQ 691
             E D + ++    H+G+ N NFQM QYV+ R   G +I+ + K  EKL LAARAI AVENP DV V+S+RP +QR +LKF  +TGA  I GRF+PG  TNQIQK F+EPRLL++SDP  DHQAV E+S+V +PVI+F NT+S +K +DI +PCNNKGE+SIGLMW++LARE+  ++G ISR   +     E+  DL+  R+  E EK++
Sbjct:   11 TEEDVMKLLATQAHLGSTNLNFQMQQYVYKRRFDGPNIINVKKTWEKLLLAARAIAAVENPADVVVVSARPYAQRALLKFAAHTGATAIFGRFSPGCLTNQIQKTFKEPRLLVISDPRIDHQAVTEASYVGVPVISFVNTESPLKLIDIGVPCNNKGERSIGLMWWMLAREILILRGKISRQTGFVLEGKEIMPDLYFYRDPTETEKEE 219          
BLAST of 40S ribosomal protein SA vs. Ensembl Fly
Match: sta (gene:FBgn0003517 transcript:FBtr0070290)

HSP 1 Score: 275.404 bits (703), Expect = 1.873e-92
Identity = 126/195 (64.62%), Postives = 152/195 (77.95%), Query Frame = 2
Query:   83 ENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRN 667
            E+D   M+ A  H+G+ N NFQM+QYV+ R   G +IL L K  EKLQLAARAIVA++NP D+ VISSRP  QR VLKF +YT   PIAGRFTPG FTNQIQ AFREPRLL+V+DP  DHQ ++E+S+VNIPVIAF NTDS ++Y+DI IPCNNK   SIGLMW+LLAREV R++G ISRS++W V VDLF  R+
Sbjct:   12 EDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDLFFYRD 206          
BLAST of 40S ribosomal protein SA vs. Ensembl Fly
Match: sta (gene:FBgn0003517 transcript:FBtr0070289)

HSP 1 Score: 275.404 bits (703), Expect = 1.873e-92
Identity = 126/195 (64.62%), Postives = 152/195 (77.95%), Query Frame = 2
Query:   83 ENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRN 667
            E+D   M+ A  H+G+ N NFQM+QYV+ R   G +IL L K  EKLQLAARAIVA++NP D+ VISSRP  QR VLKF +YT   PIAGRFTPG FTNQIQ AFREPRLL+V+DP  DHQ ++E+S+VNIPVIAF NTDS ++Y+DI IPCNNK   SIGLMW+LLAREV R++G ISRS++W V VDLF  R+
Sbjct:   12 EDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDLFFYRD 206          
BLAST of 40S ribosomal protein SA vs. Ensembl Fly
Match: sta (gene:FBgn0003517 transcript:FBtr0339594)

HSP 1 Score: 275.404 bits (703), Expect = 1.873e-92
Identity = 126/195 (64.62%), Postives = 152/195 (77.95%), Query Frame = 2
Query:   83 ENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRN 667
            E+D   M+ A  H+G+ N NFQM+QYV+ R   G +IL L K  EKLQLAARAIVA++NP D+ VISSRP  QR VLKF +YT   PIAGRFTPG FTNQIQ AFREPRLL+V+DP  DHQ ++E+S+VNIPVIAF NTDS ++Y+DI IPCNNK   SIGLMW+LLAREV R++G ISRS++W V VDLF  R+
Sbjct:   12 EDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDLFFYRD 206          
BLAST of 40S ribosomal protein SA vs. Ensembl Fly
Match: sta (gene:FBgn0003517 transcript:FBtr0339593)

HSP 1 Score: 275.404 bits (703), Expect = 1.873e-92
Identity = 126/195 (64.62%), Postives = 152/195 (77.95%), Query Frame = 2
Query:   83 ENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRN 667
            E+D   M+ A  H+G+ N NFQM+QYV+ R   G +IL L K  EKLQLAARAIVA++NP D+ VISSRP  QR VLKF +YT   PIAGRFTPG FTNQIQ AFREPRLL+V+DP  DHQ ++E+S+VNIPVIAF NTDS ++Y+DI IPCNNK   SIGLMW+LLAREV R++G ISRS++W V VDLF  R+
Sbjct:   12 EDDITKMLVATTHLGSENVNFQMEQYVYKRRADGVNILNLGKTWEKLQLAARAIVAIDNPSDIFVISSRPIGQRAVLKFAKYTDTTPIAGRFTPGAFTNQIQPAFREPRLLVVTDPNTDHQPIMEASYVNIPVIAFTNTDSPLRYIDIAIPCNNKSAHSIGLMWWLLAREVLRLRGTISRSVEWPVVVDLFFYRD 206          
BLAST of 40S ribosomal protein SA vs. Ensembl Zebrafish
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:394027])

HSP 1 Score: 280.026 bits (715), Expect = 1.479e-93
Identity = 129/203 (63.55%), Postives = 153/203 (75.37%), Query Frame = 2
Query:   83 ENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQ 691
            E D L  + AG H+G  N +FQM+QYV+ R   G +I+ L K  EKL LAARAIVA+ENP DVCVISSR + QR VLKF   TG+   AGRFTPGTFTNQIQ AFREPRLLIV+DP ADHQ + E+S+VNIP IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK++
Sbjct:   12 EEDVLKFLAAGTHLGGTNLDFQMEQYVYKRKSDGVYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASATGSTTFAGRFTPGTFTNQIQAAFREPRLLIVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGPHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEE 214          
BLAST of 40S ribosomal protein SA vs. Ensembl Zebrafish
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:394027])

HSP 1 Score: 280.026 bits (715), Expect = 1.479e-93
Identity = 129/203 (63.55%), Postives = 153/203 (75.37%), Query Frame = 2
Query:   83 ENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQ 691
            E D L  + AG H+G  N +FQM+QYV+ R   G +I+ L K  EKL LAARAIVA+ENP DVCVISSR + QR VLKF   TG+   AGRFTPGTFTNQIQ AFREPRLLIV+DP ADHQ + E+S+VNIP IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK++
Sbjct:   12 EEDVLKFLAAGTHLGGTNLDFQMEQYVYKRKSDGVYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASATGSTTFAGRFTPGTFTNQIQAAFREPRLLIVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGPHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEE 214          
BLAST of 40S ribosomal protein SA vs. Ensembl Zebrafish
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:394027])

HSP 1 Score: 98.9821 bits (245), Expect = 6.616e-26
Identity = 47/79 (59.49%), Postives = 56/79 (70.89%), Query Frame = 2
Query:   83 ENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKF 319
            E D L  + AG H+G  N +FQM+QYV+ R   G +I+ L K  EKL LAARAIVA+ENP DVCVISSR + QR VLKF
Sbjct:   12 EEDVLKFLAAGTHLGGTNLDFQMEQYVYKRKSDGVYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKF 90          
BLAST of 40S ribosomal protein SA vs. Ensembl Xenopus
Match: ociad2 (OCIA domain containing 2 [Source:Xenbase;Acc:XB-GENE-966006])

HSP 1 Score: 284.263 bits (726), Expect = 2.423e-95
Identity = 134/239 (56.07%), Postives = 165/239 (69.04%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEMNVINSGNDETGFGPIGQ-PSQQLDDW 793
             E D L  + AG H+G  N +FQM+QY++ R   G +I+ L +  EKL LAARAIVA+ENP DVCVISSR + QR VLKF   +GA PIAGRFTPGTFTNQIQ AFREPRLL+V+DP ADHQ + E+S+VNIP IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK   +E  + E              P+ + P  ++ DW
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASASGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEK---EEQAAAEKATTKEEYQGEWTAPVAEFPQAEVADW 246          
BLAST of 40S ribosomal protein SA vs. Ensembl Xenopus
Match: ociad2 (OCIA domain containing 2 [Source:Xenbase;Acc:XB-GENE-966006])

HSP 1 Score: 284.263 bits (726), Expect = 5.006e-95
Identity = 134/239 (56.07%), Postives = 165/239 (69.04%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEMNVINSGNDETGFGPIGQ-PSQQLDDW 793
             E D L  + AG H+G  N +FQM+QY++ R   G +I+ L +  EKL LAARAIVA+ENP DVCVISSR + QR VLKF   +GA PIAGRFTPGTFTNQIQ AFREPRLL+V+DP ADHQ + E+S+VNIP IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK   +E  + E              P+ + P  ++ DW
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASASGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEK---EEQAAAEKATTKEEYQGEWTAPVAEFPQAEVADW 246          
BLAST of 40S ribosomal protein SA vs. Ensembl Mouse
Match: Rpsa (ribosomal protein SA [Source:MGI Symbol;Acc:MGI:105381])

HSP 1 Score: 281.182 bits (718), Expect = 2.891e-94
Identity = 127/204 (62.25%), Postives = 154/204 (75.49%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQ 691
             E D L  + AG H+G  N +FQM+QY++ R   G +I+ L +  EKL LAARAIVA+ENP DV VISSR + QR VLKF   TGA PIAGRFTPGTFTNQIQ AFREPRLL+V+DP ADHQ + E+S+VN+P IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK++
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEE 214          
BLAST of 40S ribosomal protein SA vs. Ensembl Mouse
Match: Rpsa (ribosomal protein SA [Source:MGI Symbol;Acc:MGI:105381])

HSP 1 Score: 281.182 bits (718), Expect = 2.891e-94
Identity = 127/204 (62.25%), Postives = 154/204 (75.49%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQ 691
             E D L  + AG H+G  N +FQM+QY++ R   G +I+ L +  EKL LAARAIVA+ENP DV VISSR + QR VLKF   TGA PIAGRFTPGTFTNQIQ AFREPRLL+V+DP ADHQ + E+S+VN+P IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK++
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEE 214          
BLAST of 40S ribosomal protein SA vs. Ensembl Mouse
Match: Rpsa (ribosomal protein SA [Source:MGI Symbol;Acc:MGI:105381])

HSP 1 Score: 143.665 bits (361), Expect = 4.484e-43
Identity = 62/83 (74.70%), Postives = 70/83 (84.34%), Query Frame = 2
Query:  302 RGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKG 550
            R VLKF   TGA PIAGRFTPGTFTNQIQ AFREPRLL+V+DP ADHQ + E+S+VN+P IA CNTDS ++YVDI IPCNNKG
Sbjct:    1 RAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKG 83          
BLAST of 40S ribosomal protein SA vs. Ensembl Mouse
Match: Rpsa (ribosomal protein SA [Source:MGI Symbol;Acc:MGI:105381])

HSP 1 Score: 82.0333 bits (201), Expect = 5.362e-19
Identity = 39/74 (52.70%), Postives = 50/74 (67.57%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQ 301
             E D L  + AG H+G  N +FQM+QY++ R   G +I+ L +  EKL LAARAIVA+ENP DV VISSR + Q
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQ 84          
BLAST of 40S ribosomal protein SA vs. UniProt/SwissProt
Match: sp|B3RPX6|RSSA_TRIAD (40S ribosomal protein SA OS=Trichoplax adhaerens OX=10228 GN=TRIADDRAFT_49917 PE=3 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 1.165e-95
Identity = 133/243 (54.73%), Postives = 173/243 (71.19%), Query Frame = 2
Query:   86 NDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDEN---VSPEMNVINSGNDETGFGPI----GQPSQQLDDW 793
            +D   M+ A  H+G  N ++QM+QYVF R   G HI+ L +  EKL +AAR I ++ENP DVCV+S+RP  QR VLKF ++TGA+PIAGRFTPGTFTNQIQKA+REPRLLIV+DP  DHQ + E+S+VNIPVIAFCNTDS ++Y+D+ IPCNNKG  +IGLMW+LLAREV R++G ISR  DWE   DLF  R+ EE EK++  +N    +PE +   S    +   P+      PS++  +W
Sbjct:   13 DDVSKMLAASAHLGTTNVDYQMEQYVFRRRTDGVHIIDLRQTWEKLLIAARIIASIENPADVCVLSARPYGQRAVLKFAKFTGASPIAGRFTPGTFTNQIQKAYREPRLLIVTDPRVDHQPITEASYVNIPVIAFCNTDSRLRYIDVGIPCNNKGAHAIGLMWWLLAREVLRLRGTISRDTDWEHMPDLFFYRDPEEVEKEEQAQNNKWAAPEQSPALSAAVPSSAAPVEEWSSSPSKETTEW 255          
BLAST of 40S ribosomal protein SA vs. UniProt/SwissProt
Match: sp|Q6P8D1|RSSA_XENTR (40S ribosomal protein SA OS=Xenopus tropicalis OX=8364 GN=rpsa PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 1.527e-94
Identity = 134/239 (56.07%), Postives = 165/239 (69.04%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEMNVINSGNDETGFGPIGQ-PSQQLDDW 793
             E D L  + AG H+G  N +FQM+QY++ R   G +I+ L +  EKL LAARAIVA+ENP DVCVISSR + QR VLKF   +GA PIAGRFTPGTFTNQIQ AFREPRLL+V+DP ADHQ + E+S+VNIP IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK   +E  + E              P+ + P  ++ DW
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASASGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEK---EEQAAAEKATTKEEYQGEWTAPVAEFPQAEVADW 246          
BLAST of 40S ribosomal protein SA vs. UniProt/SwissProt
Match: sp|Q3ZM03|RSSA_XENLA (40S ribosomal protein SA OS=Xenopus laevis OX=8355 GN=rpsa PE=1 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 1.741e-94
Identity = 134/239 (56.07%), Postives = 165/239 (69.04%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEMNVINSGNDETGFGPIGQ-PSQQLDDW 793
             E D L  + AG H+G  N +FQM+QY++ R   G +I+ L +  EKL LAARAIVA+ENP DVCVISSR + QR VLKF   +GA PIAGRFTPGTFTNQIQ AFREPRLL+V+DP ADHQ + E+S+VNIP IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK+   E  + E              P+ + P  ++ DW
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASASGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPITEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKE---EQAAAEKATTKEEFQGEWTAPVAEFPQAEVADW 246          
BLAST of 40S ribosomal protein SA vs. UniProt/SwissProt
Match: sp|P50890|RSSA_CHICK (40S ribosomal protein SA OS=Gallus gallus OX=9031 GN=RPSA PE=3 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 9.330e-94
Identity = 128/204 (62.75%), Postives = 154/204 (75.49%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQ 691
             E D L  + AG H+G  N +FQM+QY++ R   G +I+ L +  EKL LAARAIVA+ENP DV VISSR + QR VLKF   TGA PIAGRFTPGTFTNQIQ AFREPRLL+V+DP ADHQ + E+S+VNIP IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK++
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEE 214          
BLAST of 40S ribosomal protein SA vs. UniProt/SwissProt
Match: sp|B5FXT6|RSSA_TAEGU (40S ribosomal protein SA OS=Taeniopygia guttata OX=59729 GN=RPSA PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 9.960e-94
Identity = 128/204 (62.75%), Postives = 154/204 (75.49%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQ 691
             E D L  + AG H+G  N +FQM+QY++ R   G +I+ L +  EKL LAARAIVA+ENP DV VISSR + QR VLKF   TGA PIAGRFTPGTFTNQIQ AFREPRLL+V+DP ADHQ + E+S+VNIP IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK++
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEE 214          
BLAST of 40S ribosomal protein SA vs. TrEMBL
Match: A0A023FKD0 (Putative 40s ribosomal protein sa p40/laminin receptor 1 (Fragment) OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 5.897e-99
Identity = 139/244 (56.97%), Postives = 172/244 (70.49%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEM---NVINSGNDETGFGPIGQPSQQLDDWQNT 802
             E+D   M+ A  H+G NN +FQM +Y F R   G H++ L K  EKL LAARAIVA+ENP +VC ISSRP  QR VLKF  +TGA PIAGRFTPGTFTNQIQ AFREPRLL+V DP ADHQ V E+S+VN+PVIAFCNTD+ ++YVDI IPCNNK + SIGLMW++L REV RM+G I R I WE+ VDLF  R+ EE EK++  + V+PE     V     ++ G G +   + ++ DW  T
Sbjct:   11 KEDDVRRMLTAKTHLGTNNLDFQMKEYCFKRRPDGIHLINLKKTWEKLLLAARAIVAIENPAEVCAISSRPYGQRAVLKFASFTGATPIAGRFTPGTFTNQIQAAFREPRLLVVCDPRADHQPVTEASYVNLPVIAFCNTDATLRYVDIAIPCNNKSQHSIGLMWWMLTREVLRMRGSILRDIPWEIMVDLFFYRDPEETEKEEQAQQVAPERAVKEVAEYTTEQWGGGDVATATAEVTDWSAT 254          
BLAST of 40S ribosomal protein SA vs. TrEMBL
Match: A0A023FKI5 (40S ribosomal protein SA OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 3.433e-98
Identity = 139/244 (56.97%), Postives = 172/244 (70.49%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEM---NVINSGNDETGFGPIGQPSQQLDDWQNT 802
             E+D   M+ A  H+G NN +FQM +Y F R   G H++ L K  EKL LAARAIVA+ENP +VC ISSRP  QR VLKF  +TGA PIAGRFTPGTFTNQIQ AFREPRLL+V DP ADHQ V E+S+VN+PVIAFCNTD+ ++YVDI IPCNNK + SIGLMW++L REV RM+G I R I WE+ VDLF  R+ EE EK++  + V+PE     V     ++ G G +   + ++ DW  T
Sbjct:   11 KEDDVRRMLTAKTHLGTNNLDFQMKEYCFKRRPDGIHLINLKKTWEKLLLAARAIVAIENPAEVCAISSRPYGQRAVLKFASFTGATPIAGRFTPGTFTNQIQAAFREPRLLVVCDPRADHQPVTEASYVNLPVIAFCNTDATLRYVDIAIPCNNKSQHSIGLMWWMLTREVLRMRGSILRDIPWEIMVDLFFYRDPEETEKEEQAQQVAPERAVKEVAEYTTEQWGGGDVATATAEVTDWSAT 254          
BLAST of 40S ribosomal protein SA vs. TrEMBL
Match: A0A023FLD9 (40S ribosomal protein SA OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 3.870e-98
Identity = 139/244 (56.97%), Postives = 172/244 (70.49%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEM---NVINSGNDETGFGPIGQPSQQLDDWQNT 802
             E+D   M+ A  H+G NN +FQM +Y F R   G H++ L K  EKL LAARAIVA+ENP +VC ISSRP  QR VLKF  +TGA PIAGRFTPGTFTNQIQ AFREPRLL+V DP ADHQ V E+S+VN+PVIAFCNTD+ ++YVDI IPCNNK + SIGLMW++L REV RM+G I R I WE+ VDLF  R+ EE EK++  + V+PE     V     ++ G G +   + ++ DW  T
Sbjct:   11 KEDDVRRMLTAKTHLGTNNLDFQMKEYCFKRRPDGIHLINLKKTWEKLLLAARAIVAIENPAEVCAISSRPYGQRAVLKFASFTGATPIAGRFTPGTFTNQIQAAFREPRLLVVCDPRADHQPVTEASYVNLPVIAFCNTDATLRYVDIAIPCNNKSQHSIGLMWWMLTREVLRMRGSILRDIPWEIMVDLFFYRDPEETEKEEQAQQVAPERAVKEVAEYTTEQWGGGDVATATAEVTDWSAT 254          
BLAST of 40S ribosomal protein SA vs. TrEMBL
Match: A0A023FIQ8 (40S ribosomal protein SA OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 5.426e-98
Identity = 139/244 (56.97%), Postives = 172/244 (70.49%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEM---NVINSGNDETGFGPIGQPSQQLDDWQNT 802
             E+D   M+ A  H+G NN +FQM +Y F R   G H++ L K  EKL LAARAIVA+ENP +VC ISSRP  QR VLKF  +TGA PIAGRFTPGTFTNQIQ AFREPRLL+V DP ADHQ V E+S+VN+PVIAFCNTD+ ++YVDI IPCNNK + SIGLMW++L REV RM+G I R I WE+ VDLF  R+ EE EK++  + V+PE     V     ++ G G +   + ++ DW  T
Sbjct:   11 KEDDVRRMLTAKTHLGTNNLDFQMKEYCFKRRPDGIHLINLKKTWEKLLLAARAIVAIENPAEVCAISSRPYGQRAVLKFASFTGATPIAGRFTPGTFTNQIQAAFREPRLLVVCDPRADHQPVTEASYVNLPVIAFCNTDATLRYVDIAIPCNNKSQHSIGLMWWMLTREVLRMRGSILRDIPWEIMVDLFFYRDPEETEKEEQAQQVAPERAVKEVAEYTTEQWGGGDVTTAAAEVTDWSAT 254          
BLAST of 40S ribosomal protein SA vs. TrEMBL
Match: A0A023GI91 (40S ribosomal protein SA OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 1.044e-97
Identity = 139/243 (57.20%), Postives = 172/243 (70.78%), Query Frame = 2
Query:   83 ENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEM---NVINSGNDETGFGPIGQPSQQLDDWQNT 802
            E+D   M+ A  H+G NN +FQM +Y F R   G H++ L K  EKL LAARAIVA+ENP +VC ISSRP  QR VLKF  +TGA PIAGRFTPGTFTNQIQ AFREPRLL+V DP ADHQ V E+S+VN+PVIAFCNTD+ ++YVDI IPCNNK + SIGLMW++L REV RM+G I R I WE+ VDLF  R+ EE EK++  + V+PE     V     ++ G G +   + ++ DW  T
Sbjct:   12 EDDVRRMLTAKTHLGTNNLDFQMKEYCFKRRPDGIHLINLKKTWEKLLLAARAIVAIENPAEVCAISSRPYGQRAVLKFASFTGATPIAGRFTPGTFTNQIQAAFREPRLLVVCDPRADHQPVTEASYVNLPVIAFCNTDATLRYVDIAIPCNNKSQHSIGLMWWMLTREVLRMRGSILRDIPWEIMVDLFFYRDPEETEKEEQAQQVAPERAVKEVAEYTTEQWGGGDVAAATAEVTDWSAT 254          
BLAST of 40S ribosomal protein SA vs. Ensembl Cavefish
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:103024485])

HSP 1 Score: 275.789 bits (704), Expect = 6.304e-92
Identity = 127/204 (62.25%), Postives = 151/204 (74.02%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQ 691
             E D L  + AG H+G  N ++QM+ Y + R   G +I+ L K  EKL LAARAIVA+ENP DVCVISSR + QR VLKF   TGA   AGRFTPGTFTNQIQ AFREPRLLIV+DP ADHQ + E+S+VNIP IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK++
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDYQMEHYAYKRKSDGIYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASATGATTFAGRFTPGTFTNQIQAAFREPRLLIVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIGIPCNNKGPHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEE 214          
BLAST of 40S ribosomal protein SA vs. Ensembl Cavefish
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:103024485])

HSP 1 Score: 275.789 bits (704), Expect = 6.304e-92
Identity = 127/204 (62.25%), Postives = 151/204 (74.02%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQ 691
             E D L  + AG H+G  N ++QM+ Y + R   G +I+ L K  EKL LAARAIVA+ENP DVCVISSR + QR VLKF   TGA   AGRFTPGTFTNQIQ AFREPRLLIV+DP ADHQ + E+S+VNIP IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK++
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDYQMEHYAYKRKSDGIYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASATGATTFAGRFTPGTFTNQIQAAFREPRLLIVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDIGIPCNNKGPHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEE 214          
BLAST of 40S ribosomal protein SA vs. Ensembl Sea Lamprey
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:394027])

HSP 1 Score: 128.642 bits (322), Expect = 1.188e-35
Identity = 77/195 (39.49%), Postives = 103/195 (52.82%), Query Frame = 2
Query:   83 ENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRN 667
            E D L  + A  H+G  N +FQM+QYV+ R   G  IL L K  EKL LAARAIVA+ENP DVCVISSRP  Q  +     Y+        F+         + F +  L IV  P+    ++  S+   IP    C  D     + + +PC   G  SIGLMW++LAREV R++G I R   W++  DL+  R+
Sbjct:   12 EEDVLKFLAANSHLGTTNCDFQMEQYVYKRKNDGIFILNLKKTWEKLLLAARAIVAIENPADVCVISSRPYGQLRLSIKLIYSWKTVELKSFSIIKTIKSYVRLFCQAELRIVWSPLNCPLSI--STVSCIP----CAPD-----LPLSVPCYCTGAHSIGLMWWMLAREVLRLRGTIGREHPWDIMPDLYFYRD 195          
BLAST of 40S ribosomal protein SA vs. Ensembl Yeast
Match: RPS0B (Protein component of the small (40S) ribosomal subunit; RPS0B has a paralog, RPS0A, that arose from the whole genome duplication; required for maturation of 18S rRNA along with Rps0Ap; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal; homologous to human ribosomal protein SA and bacterial S2 [Source:SGD;Acc:S000004038])

HSP 1 Score: 223.016 bits (567), Expect = 6.365e-73
Identity = 103/194 (53.09%), Postives = 137/194 (70.62%), Query Frame = 2
Query:   89 DQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKG-LISRSIDWEVKVDLFIVRN 667
            D  +++ A  H+GA N     + YVF+    G H++ + K  EKL LAAR I A+ NP+DV  ISSR   QR VLKF  +TGA PIAGRFTPG+FTN I ++F+EPRL+IV+DP  D QA+ E+S+VNIPVIA  + DS  ++VD+ IPCNN+G+ SIGL+WYLLAREV R++G L+ R+  W +  DL+  RN
Sbjct:   13 DAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRLDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDLYFYRN 206          
BLAST of 40S ribosomal protein SA vs. Ensembl Yeast
Match: RPS0A (Ribosomal 40S subunit protein S0A; required for maturation of 18S rRNA along with Rps0Bp; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal; homologous to human ribosomal protein SA and bacterial S2; RPS0A has a paralog, RPS0B, that arose from the whole genome duplication; [Source:SGD;Acc:S000003446])

HSP 1 Score: 221.476 bits (563), Expect = 2.013e-72
Identity = 102/194 (52.58%), Postives = 138/194 (71.13%), Query Frame = 2
Query:   89 DQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKG-LISRSIDWEVKVDLFIVRN 667
            D  +++ A  H+GA N     + YVF+    G H++ + K  EKL LAAR I A+ NP+DV  ISSR   QR VLKF  +TGA PIAGRFTPG+FTN I ++F+EPRL+IV+DP +D QA+ E+S+VNIPVIA  + DS  ++VD+ IPCNN+G+ SIGL+WYLLAREV R++G L+ R+  W +  DL+  R+
Sbjct:   13 DAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDLYFYRD 206          
BLAST of 40S ribosomal protein SA vs. Ensembl Yeast
Match: MRP4 (Mitochondrial ribosomal protein of the small subunit [Source:SGD;Acc:S000000996])

HSP 1 Score: 64.6994 bits (156), Expect = 2.665e-12
Identity = 51/203 (25.12%), Postives = 94/203 (46.31%), Query Frame = 2
Query:  101 MIKAGVHIGANNKNFQ--MDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAV-ENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQ------------------KAFR--------EPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISR 622
            ++ AGVH+G +   ++     Y++   K G HI+ L++    L+ AA+ +  V E+   +  + +R   +RG+ +  + T    ++ R+ PGT TN  +                  +A          +P LL+V +P  +  A++E+    +P IA  +TDS    V   IP N+   +S+  +  +LAR     +GL +R
Sbjct:  188 LMSAGVHLGQSTSLWRSSTQSYIYGEYK-GIHIIDLNQTLSYLKRAAKVVEGVSESGGIILFLGTRQGQKRGLEEAAKKTHGYYVSTRWIPGTLTNSTEISGIWEKQEIDSNDNPTERALSPNETSKQVKPDLLVVLNPTENRNALLEAIKSRVPTIAIIDTDSEPSLVTYPIPGNDDSLRSVNFLLGVLAR--AGQRGLQNR 387          
BLAST of 40S ribosomal protein SA vs. Ensembl Nematostella
Match: EDO48040 (40S ribosomal protein SA [Source:UniProtKB/Swiss-Prot;Acc:A7RKS5])

HSP 1 Score: 270.011 bits (689), Expect = 4.144e-90
Identity = 124/195 (63.59%), Postives = 152/195 (77.95%), Query Frame = 2
Query:   83 ENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRN 667
            E D +  + AGVH+GANN +FQM+ YV+ R   G +I+ + K  EKL LAAR IV +ENP DVCVIS+RP  QR +LK+  +TGA PIAGRFTPGTFTNQIQ AFREPRLLIV DP  DHQ V E+S+VNIPVIAFCNTDS +++VD+ IPCNNKG  SIGLM++LLAREV RM+G ISR++ WE+  DL+  R+
Sbjct:   12 EEDVVKFLAAGVHLGANNCDFQMEDYVYKRKSDGVNIINVKKTWEKLLLAARIIVTIENPADVCVISARPYGQRAILKYASHTGATPIAGRFTPGTFTNQIQAAFREPRLLIVCDPRIDHQPVTEASYVNIPVIAFCNTDSPLRHVDVAIPCNNKGIHSIGLMFWLLAREVLRMRGSISRALPWEIMPDLYFYRD 206          
BLAST of 40S ribosomal protein SA vs. Ensembl Medaka
Match: rpsa (ribosomal protein SA [Source:NCBI gene;Acc:101165063])

HSP 1 Score: 278.87 bits (712), Expect = 2.037e-93
Identity = 136/239 (56.90%), Postives = 164/239 (68.62%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEMNVINSGNDETGFGPIGQPSQ-QLDDW 793
             E D L  + AG H+G  N +FQM+QYV+ R   G +I+ L K  EKL LAARAIVA+ENP DVCVISSR + QR VLKF   TGA    GRFTPGTFTNQIQ AFREPRLLIV+DP ADHQ + E+S+VNIP IA CNTDS ++YVDI IPCNNKG  S+GLMW++LAREV RM+G ISR   WEV  DL+  R+ EE EK+   E  + E  V+          P  + +Q ++ DW
Sbjct:   11 KEEDVLKFLAAGTHLGGTNLDFQMEQYVYKRKSDGVYIINLKKTWEKLLLAARAIVAIENPADVCVISSRNTGQRAVLKFASATGATTFHGRFTPGTFTNQIQAAFREPRLLIVTDPRADHQPLTEASYVNIPTIALCNTDSPLRYVDISIPCNNKGHHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKE---EQAAAEKAVVKEEFQGEWTAPAAEFTQPEVADW 246          
BLAST of 40S ribosomal protein SA vs. Planmine SMEST
Match: SMESG000071180.1 (SMESG000071180.1)

HSP 1 Score: 506.908 bits (1304), Expect = 0.000e+0
Identity = 245/245 (100.00%), Postives = 245/245 (100.00%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEMNVINSGNDETGFGPIGQPSQQLDDWQNTDNWA 814
            NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEMNVINSGNDETGFGPIGQPSQQLDDWQNTDNWA
Sbjct:    6 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEMNVINSGNDETGFGPIGQPSQQLDDWQNTDNWA 250          
BLAST of 40S ribosomal protein SA vs. Planmine SMEST
Match: SMESG000016079.1 (SMESG000016079.1)

HSP 1 Score: 359.377 bits (921), Expect = 5.144e-126
Identity = 172/246 (69.92%), Postives = 204/246 (82.93%), Query Frame = 2
Query:   80 NENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVRNVEEDEKQQDDENVSPEMNVINSGNDETGFGPIGQP-SQQLDDWQNTDNWA 814
            N+ND  M +KA VH G+ NKNFQM+QYV DRN +GNH++++DKI EK+ LAA AIVAVENPKD+CV+SS+ SSQR VLKF RYTGA  +AGRFTPGTFTNQIQKAFR+PRLLIVSDPIADHQAV+ESSFVN+PVIAFCNTDSIIK VDIVIPCNN+GE SIG MWYLLAREV R++G ISRSI+W+VKVDLFI R+ EE+ + ++DE +      +N   +E   G + QP +QQLDDWQ TDNWA
Sbjct:    6 NDNDVAMALKASVHEGSANKNFQMEQYVHDRNVSGNHVIRIDKIFEKIYLAASAIVAVENPKDICVVSSKASSQRAVLKFARYTGAFAVAGRFTPGTFTNQIQKAFRQPRLLIVSDPIADHQAVLESSFVNLPVIAFCNTDSIIKNVDIVIPCNNRGELSIGFMWYLLAREVNRIRGSISRSIEWDVKVDLFIARSAEEELQNKEDEVIQ-----MNEHVEEISHGVVAQPIAQQLDDWQATDNWA 246          
BLAST of 40S ribosomal protein SA vs. Planmine SMEST
Match: SMESG000008583.1 (SMESG000008583.1)

HSP 1 Score: 186.808 bits (473), Expect = 1.891e-56
Identity = 91/118 (77.12%), Postives = 97/118 (82.20%), Query Frame = 2
Query:  242 IVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIKYVDIVIPCNNKGEQSIGLMWYLLAREV 595
            +VAVENPKDVCV+SS P SQR VLKFGRYT  N    +F   TFTNQ+Q  FREPRLLIVSD I DHQAV+ESSFVNIPVIAFCNTD +IKY DIVIPCNNKGEQ IGL WYLL REV
Sbjct:    1 MVAVENPKDVCVMSSYPPSQRVVLKFGRYTEDN---NKFCSETFTNQMQNGFREPRLLIVSDLITDHQAVIESSFVNIPVIAFCNTDGVIKYFDIVIPCNNKGEQLIGLTWYLLDREV 115          
BLAST of 40S ribosomal protein SA vs. Planmine SMEST
Match: SMESG000025584.1 (SMESG000025584.1)

HSP 1 Score: 177.178 bits (448), Expect = 9.267e-56
Identity = 99/152 (65.13%), Postives = 116/152 (76.32%), Query Frame = 2
Query:   98 MMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSDPIADH-QAVVESSFVNIPV-IAFCNTDSIIKYVDIVIPCNNK 547
            MMIK  +HIGANNKNFQM+QYVFDRNKA NHILK  KIC+KLQLAA+AI+AVENP DVCV+SSR SSQRG+LKFGRYTGANPIA R T  TFTN IQK FREP LLIVSD I DH +A+     ++  + IA  NT  ++    ++   NN+
Sbjct:    1 MMIKTFIHIGANNKNFQMNQYVFDRNKARNHILKFYKICDKLQLAAKAIIAVENPDDVCVVSSRSSSQRGILKFGRYTGANPIASRSTTRTFTNHIQKTFREPGLLIVSDQITDHSEALSILQLLHFAIQIALLNTSILL--FRVITSVNNQ 150          

HSP 2 Score: 53.1434 bits (126), Expect = 1.363e-8
Identity = 28/33 (84.85%), Postives = 28/33 (84.85%), Query Frame = 3
Query:  462 VLLIFQLLHFAIQIVLLNTSILLFRVITKVNNQ 560
             L I QLLHFAIQI LLNTSILLFRVIT VNNQ
Sbjct:  118 ALSILQLLHFAIQIALLNTSILLFRVITSVNNQ 150          
BLAST of 40S ribosomal protein SA vs. Planmine SMEST
Match: SMESG000061981.1 (SMESG000061981.1)

HSP 1 Score: 162.155 bits (409), Expect = 4.547e-50
Identity = 80/110 (72.73%), Postives = 86/110 (78.18%), Query Frame = 2
Query:   98 MMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKICEKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTPGTFTNQIQKAFREPRLLIVSD 427
            MMI+AGVH+  NN   QMDQ+VFDRNKA NHILKLD+ICE LQ+AARAIV VENPKDVCV SS P SQRGVLKFGRYT AN   GRF   TFTNQIQ  FRE RL  V+ 
Sbjct:    1 MMIRAGVHMSVNNNYLQMDQFVFDRNKARNHILKLDEICEILQIAARAIVVVENPKDVCVTSSYPPSQRGVLKFGRYTRAN---GRFCLKTFTNQIQNEFRESRLFSVTQ 107          
The following BLAST results are available for this feature:
BLAST of 40S ribosomal protein SA vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RPSA4.448e-9462.25ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:... [more]
RPSA6.821e-9462.25ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:... [more]
RPSA2.519e-9160.77ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:... [more]
RPSA1.060e-4061.90ribosomal protein SA [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps-04.925e-7253.1140S ribosomal protein SA [Source:UniProtKB/Swiss-... [more]
rps-04.925e-7253.1140S ribosomal protein SA [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sta1.873e-9264.62gene:FBgn0003517 transcript:FBtr0070290[more]
sta1.873e-9264.62gene:FBgn0003517 transcript:FBtr0070289[more]
sta1.873e-9264.62gene:FBgn0003517 transcript:FBtr0339594[more]
sta1.873e-9264.62gene:FBgn0003517 transcript:FBtr0339593[more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpsa1.479e-9363.55ribosomal protein SA [Source:NCBI gene;Acc:394027][more]
rpsa1.479e-9363.55ribosomal protein SA [Source:NCBI gene;Acc:394027][more]
rpsa6.616e-2659.49ribosomal protein SA [Source:NCBI gene;Acc:394027][more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ociad22.423e-9556.07OCIA domain containing 2 [Source:Xenbase;Acc:XB-GE... [more]
ociad25.006e-9556.07OCIA domain containing 2 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rpsa2.891e-9462.25ribosomal protein SA [Source:MGI Symbol;Acc:MGI:10... [more]
Rpsa2.891e-9462.25ribosomal protein SA [Source:MGI Symbol;Acc:MGI:10... [more]
Rpsa4.484e-4374.70ribosomal protein SA [Source:MGI Symbol;Acc:MGI:10... [more]
Rpsa5.362e-1952.70ribosomal protein SA [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of 40S ribosomal protein SA vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B3RPX6|RSSA_TRIAD1.165e-9554.7340S ribosomal protein SA OS=Trichoplax adhaerens O... [more]
sp|Q6P8D1|RSSA_XENTR1.527e-9456.0740S ribosomal protein SA OS=Xenopus tropicalis OX=... [more]
sp|Q3ZM03|RSSA_XENLA1.741e-9456.0740S ribosomal protein SA OS=Xenopus laevis OX=8355... [more]
sp|P50890|RSSA_CHICK9.330e-9462.7540S ribosomal protein SA OS=Gallus gallus OX=9031 ... [more]
sp|B5FXT6|RSSA_TAEGU9.960e-9462.7540S ribosomal protein SA OS=Taeniopygia guttata OX... [more]
back to top
BLAST of 40S ribosomal protein SA vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023FKD05.897e-9956.97Putative 40s ribosomal protein sa p40/laminin rece... [more]
A0A023FKI53.433e-9856.9740S ribosomal protein SA OS=Amblyomma cajennense O... [more]
A0A023FLD93.870e-9856.9740S ribosomal protein SA OS=Amblyomma cajennense O... [more]
A0A023FIQ85.426e-9856.9740S ribosomal protein SA OS=Amblyomma cajennense O... [more]
A0A023GI911.044e-9757.2040S ribosomal protein SA OS=Amblyomma triste OX=25... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpsa6.304e-9262.25ribosomal protein SA [Source:NCBI gene;Acc:1030244... [more]
rpsa6.304e-9262.25ribosomal protein SA [Source:NCBI gene;Acc:1030244... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpsa1.188e-3539.49ribosomal protein SA [Source:NCBI gene;Acc:394027][more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RPS0B6.365e-7353.09Protein component of the small (40S) ribosomal sub... [more]
RPS0A2.013e-7252.58Ribosomal 40S subunit protein S0A; required for ma... [more]
MRP42.665e-1225.12Mitochondrial ribosomal protein of the small subun... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO480404.144e-9063.5940S ribosomal protein SA [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpsa2.037e-9356.90ribosomal protein SA [Source:NCBI gene;Acc:1011650... [more]
back to top
BLAST of 40S ribosomal protein SA vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071180.10.000e+0100.00SMESG000071180.1[more]
SMESG000016079.15.144e-12669.92SMESG000016079.1[more]
SMESG000008583.11.891e-5677.12SMESG000008583.1[more]
SMESG000025584.19.267e-5665.13SMESG000025584.1[more]
SMESG000061981.14.547e-5072.73SMESG000061981.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012383 ID=SMED30012383|Name=40S ribosomal protein SA|organism=Schmidtea mediterranea sexual|type=transcript|length=866bp
TTTGTCAGAATGTTTTAATTATTTGATATAAACTAAAATATTAAAATTCA
AAAAAGTGGTTAAAATGATGAGTTTTTTTAATGAAAATGATCAATTAATG
ATGATCAAAGCTGGTGTTCATATTGGTGCGAACAACAAAAATTTTCAAAT
GGATCAATATGTCTTCGATAGAAATAAAGCAGGGAATCATATTTTAAAAT
TGGATAAAATATGTGAAAAACTACAATTAGCTGCTAGAGCTATCGTTGCA
GTAGAAAATCCTAAAGATGTTTGTGTTATATCTTCAAGGCCTTCTTCTCA
AAGAGGAGTTTTAAAATTCGGAAGATATACCGGAGCTAATCCTATTGCTG
GTAGATTCACTCCAGGAACATTCACCAATCAAATTCAAAAAGCATTCAGG
GAACCCAGACTTTTGATTGTCAGTGACCCAATAGCAGATCATCAGGCTGT
CGTGGAAAGCAGTTTTGTTAATATTCCAGTTATTGCATTTTGCAATACAG
ATAGTATTATTAAATACGTCGATATTGTTATTCCGTGTAATAACAAAGGT
GAACAATCAATCGGCTTGATGTGGTATTTATTGGCCCGTGAAGTTTGTAG
AATGAAAGGATTGATCAGTAGATCAATTGATTGGGAAGTAAAAGTCGATC
TTTTCATAGTTAGAAATGTTGAGGAAGATGAAAAGCAGCAAGATGATGAA
AATGTATCACCAGAAATGAATGTAATTAATAGTGGTAATGACGAAACTGG
TTTTGGTCCAATTGGTCAACCGTCTCAACAATTAGATGATTGGCAAAACA
CAGATAATTGGGCCTAAGTGTGAAATATATTGATTTGGATGTCATAAAAA
AAAAAGATCGGAAGAG
back to top

protein sequence of SMED30012383-orf-1

>SMED30012383-orf-1 ID=SMED30012383-orf-1|Name=SMED30012383-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=251bp
MMSFFNENDQLMMIKAGVHIGANNKNFQMDQYVFDRNKAGNHILKLDKIC
EKLQLAARAIVAVENPKDVCVISSRPSSQRGVLKFGRYTGANPIAGRFTP
GTFTNQIQKAFREPRLLIVSDPIADHQAVVESSFVNIPVIAFCNTDSIIK
YVDIVIPCNNKGEQSIGLMWYLLAREVCRMKGLISRSIDWEVKVDLFIVR
NVEEDEKQQDDENVSPEMNVINSGNDETGFGPIGQPSQQLDDWQNTDNWA
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000028ribosomal small subunit assembly
GO:0006412translation
Vocabulary: cellular component
TermDefinition
GO:0022627cytosolic small ribosomal subunit
GO:0005622intracellular
GO:0005840ribosome
GO:0005737cytoplasm
GO:0015935small ribosomal subunit
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000120progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR005707Ribosomal_S2_euk/arc
IPR001865Ribosomal_S2
IPR018130Ribosomal_S2_CS
IPR023591Ribosomal_S2_flav_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001865Ribosomal protein S2PRINTSPR00395RIBOSOMALS2coord: 40..49
score: 38.0
coord: 10..28
score: 31.09
coord: 89..106
score: 47.44
coord: 131..142
score: 47.82
coord: 114..131
score: 44.1
coord: 152..166
score: 50.46
IPR001865Ribosomal protein S2PFAMPF00318Ribosomal_S2coord: 106..177
e-value: 1.2E-12
score: 47.5
IPR001865Ribosomal protein S2CDDcd01425RPS2coord: 13..179
e-value: 9.49826E-60
score: 185.478
IPR005707Ribosomal protein S2, eukaryotic/archaealTIGRFAMTIGR01012TIGR01012coord: 7..200
e-value: 6.6E-80
score: 265.2
IPR005707Ribosomal protein S2, eukaryotic/archaealPANTHERPTHR1148940S RIBOSOMAL PROTEIN SAcoord: 7..244
NoneNo IPR availableGENE3DG3DSA:3.40.50.10490coord: 9..214
e-value: 3.5E-86
score: 289.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 214..250
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 207..250
IPR018130Ribosomal protein S2, conserved sitePROSITEPS00963RIBOSOMAL_S2_2coord: 114..138
IPR023591Ribosomal protein S2, flavodoxin-like domain superfamilySUPERFAMILYSSF52313Ribosomal protein S2coord: 8..195