Reticulocalbin-1

Overview
NameReticulocalbin-1
Smed IDSMED30012371
Length (bp)1178
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Reticulocalbin-1 (SMED30012371) t-SNE clustered cells

Violin plots show distribution of expression levels for Reticulocalbin-1 (SMED30012371) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Reticulocalbin-1 (SMED30012371) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Reticulocalbin-1 (SMED30012371) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012371

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30012371h1SMcG0004342 Contig54697uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012371h1SMcG0004342 Contig54697newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012371h1SMcG0004342 Contig40027newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012371h1SMcG0004342 Contig40027uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30012371h1SMcG0004342 dd_Smed_v4_801_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30012371h1SMcG0004342 dd_Smed_v4_801_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012371h1SMcG0004342 dd_Smed_v4_801_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012371h1SMcG0004342 dd_Smed_v4_801_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012371h1SMcG0004342 OX_Smed_1.0.20588ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
secretory systemSMED30012371h1SMcG0004342 dd_Smed_v6_801_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 177.948 bits (450), Expect = 3.936e-52
Identity = 111/326 (34.05%), Postives = 181/326 (55.52%), Query Frame = 1
Query:   94 FLIMIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD-EKMDKETEEH-----EKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
             +IM ++  + C+SL         S  TE+ +   HH    +   H D        +DHDA  G+  E++ F  L PEE+K RLG++VDKID + D +V + EL  WI  + +    ++   + Q+ D N D +++W EY + TYG    + D        D   + + ++ D+++F++AD++ D +    EF  F HP  Y  M    +++T+ED DKN DG +DL+E++GD    D  T+E      E++ F E+ DK+++G +   E  DW++P     A +E  HL  E+D NKD  L+KEEI+++++L+VGS ATD+G+ L
Sbjct:    6 LIIMDLRQFLMCLSLCTAFAL---SKPTEKKDRV-HHEPQLSDKVHNDAQSF---DYDHDAFLGAE-EAKTFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYLDDPD------PDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEAL 317          
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 175.252 bits (443), Expect = 4.421e-51
Identity = 110/323 (34.06%), Postives = 179/323 (55.42%), Query Frame = 1
Query:  103 MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD-EKMDKETEEH-----EKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            M ++  + C+SL         S  TE+ +   HH    +   H D        +DHDA  G+  E++ F  L PEE+K RLG++VDKID + D +V + EL  WI  + +    ++   + Q+ D N D +++W EY + TYG    + D        D   + + ++ D+++F++AD++ D +    EF  F HP  Y  M    +++T+ED DKN DG +DL+E++GD    D  T+E      E++ F E+ DK+++G +   E  DW++P     A +E  HL  E+D NKD  L+KEEI+++++L+VGS ATD+G+ L
Sbjct:    1 MDLRQFLMCLSLCTAFAL---SKPTEKKDRV-HHEPQLSDKVHNDAQSF---DYDHDAFLGAE-EAKTFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYLDDPD------PDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEAL 309          
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 170.629 bits (431), Expect = 2.629e-49
Identity = 111/326 (34.05%), Postives = 178/326 (54.60%), Query Frame = 1
Query:   94 FLIMIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD-EKMDKETEEHE-----KKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
             +IM ++  + C+SL         S  TE+ +   HH    +   H D        +DHDA  G+  E++ F  L PEE+K RLG +V KID + D +V   EL  WI  + +    ED   + +  D N D +++W EY + TYG+   + D        D   + + ++ D+++F++AD++ D +    EF  F HP  Y  M    +++T+ED DKN DG +DL+E++GD    D  T+E E     ++ F E+ DK+++G +   E  DW++P     A +E  HL  E+D NKD  L+KEEI+++++L+VGS ATD+G+ L
Sbjct:    6 LIIMDLRQFLMCLSLCTAFAL---SKPTEKKDRV-HHEPQLSDKVHNDAQSF---DYDHDAFLGAE-EAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPD------PDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEAL 317          
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 167.933 bits (424), Expect = 2.677e-48
Identity = 110/323 (34.06%), Postives = 176/323 (54.49%), Query Frame = 1
Query:  103 MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD-EKMDKETEEHE-----KKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            M ++  + C+SL         S  TE+ +   HH    +   H D        +DHDA  G+  E++ F  L PEE+K RLG +V KID + D +V   EL  WI  + +    ED   + +  D N D +++W EY + TYG+   + D        D   + + ++ D+++F++AD++ D +    EF  F HP  Y  M    +++T+ED DKN DG +DL+E++GD    D  T+E E     ++ F E+ DK+++G +   E  DW++P     A +E  HL  E+D NKD  L+KEEI+++++L+VGS ATD+G+ L
Sbjct:    1 MDLRQFLMCLSLCTAFAL---SKPTEKKDRV-HHEPQLSDKVHNDAQSF---DYDHDAFLGAE-EAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPD------PDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEAL 309          
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: RCN2 (reticulocalbin 2 [Source:HGNC Symbol;Acc:HGNC:9935])

HSP 1 Score: 160.229 bits (404), Expect = 2.434e-45
Identity = 100/285 (35.09%), Postives = 159/285 (55.79%), Query Frame = 1
Query:  244 GHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEH------EKKSFA-EYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL-DDMKPHEE 1074
            G     +D +A+ G   + +E+  L  EE ++RL  ++ KID + D ++ ++EL  WI  SF++  +++A  +  + D+N+D  +TW EY  + Y     + DE       + + F +  L DKK+F+ A++++   L + EF  F HP     M+ F +++ LE+ DKN DG V L+EF+GD + D    E       EK  F  +YDKD +G L   E+  WV+P  +  A  E  HL +E D+N DK LS+EEI+   +L++ S ATDYG+ L DD   H+E
Sbjct:   33 GERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWDEYNIQMYDRV-IDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGDYRWDPTANEDPEWILVEKDRFVNDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILENPDLFLTSEATDYGRQLHDDYFYHDE 316          
BLAST of Reticulocalbin-1 vs. Ensembl Celegans
Match: calu-1 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:H2L0I1])

HSP 1 Score: 142.51 bits (358), Expect = 4.453e-39
Identity = 104/328 (31.71%), Postives = 173/328 (52.74%), Query Frame = 1
Query:  136 LTIILLFGI-SSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTEL---FKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD--------EKMDKETE--EHEKKSFAEY-DKDKNGLLQGSEITDWVMP-GFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDMKPHE 1071
            + ++L  G+ +++    H    H +D S   EH+ K   HD+ +DH+   G    + EF +L PE++K +L  LV K+D + D ++ + EL     ++ + + N D+ D T K    ++  D  + W +Y    YG ++    E+          + + +  D+K++ +AD +++  LD  E+  F HP +   M    + +T++D DKNKDG VDL E++GD        E   KE +  + E++ F E+ DKD +G L   E+ DW+MP GF+  A +E  HL    D NKD  L+ +EI+  ++ +VGS ATDYG+ L    P E
Sbjct:    1 MKVLLFVGLLAATALASH----HSSDPSKDGEHF-KGKEHDKKYDHEQFLGKD-TAAEFDELTPEKSKEKLAKLVPKMDADSDGFIEENELKDHINFMQKRYVNNDV-DRTWKNYKAEKIVDGKIKWEDYREMVYGSADGAGQELSPE-------YAKMIARDEKRWAVADYDSNGALDRTEYGCFMHPEDCDHMRDVVVAETVDDIDKNKDGSVDLDEYIGDMYRPDDYPELNGKEPDWVQSEREMFKEHRDKDGDGKLNQEEMRDWIMPVGFDH-AEAEARHLVGIADDNKDGKLNLDEIVAHYDTFVGSQATDYGEQLQKHDPAE 313          
BLAST of Reticulocalbin-1 vs. Ensembl Celegans
Match: calu-1 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:H2L0I1])

HSP 1 Score: 142.51 bits (358), Expect = 4.453e-39
Identity = 104/328 (31.71%), Postives = 173/328 (52.74%), Query Frame = 1
Query:  136 LTIILLFGI-SSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTEL---FKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD--------EKMDKETE--EHEKKSFAEY-DKDKNGLLQGSEITDWVMP-GFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDMKPHE 1071
            + ++L  G+ +++    H    H +D S   EH+ K   HD+ +DH+   G    + EF +L PE++K +L  LV K+D + D ++ + EL     ++ + + N D+ D T K    ++  D  + W +Y    YG ++    E+          + + +  D+K++ +AD +++  LD  E+  F HP +   M    + +T++D DKNKDG VDL E++GD        E   KE +  + E++ F E+ DKD +G L   E+ DW+MP GF+  A +E  HL    D NKD  L+ +EI+  ++ +VGS ATDYG+ L    P E
Sbjct:    1 MKVLLFVGLLAATALASH----HSSDPSKDGEHF-KGKEHDKKYDHEQFLGKD-TAAEFDELTPEKSKEKLAKLVPKMDADSDGFIEENELKDHINFMQKRYVNNDV-DRTWKNYKAEKIVDGKIKWEDYREMVYGSADGAGQELSPE-------YAKMIARDEKRWAVADYDSNGALDRTEYGCFMHPEDCDHMRDVVVAETVDDIDKNKDGSVDLDEYIGDMYRPDDYPELNGKEPDWVQSEREMFKEHRDKDGDGKLNQEEMRDWIMPVGFDH-AEAEARHLVGIADDNKDGKLNLDEIVAHYDTFVGSQATDYGEQLQKHDPAE 313          
BLAST of Reticulocalbin-1 vs. Ensembl Celegans
Match: calu-2 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9TYS8])

HSP 1 Score: 121.709 bits (304), Expect = 1.254e-31
Identity = 78/243 (32.10%), Postives = 129/243 (53.09%), Query Frame = 1
Query:  364 IDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSE---KEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVG--DEKMDKETEEHEKKSFAE-YDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDMKPHEE 1074
            +DTN+D +V+++E+  W+ +S++     +A  ++ ++DEN D  ++W EY++ ++   E   KE + +I                DK  F+ AD +ND  L++ E A F +P ++P M    +  TL + D+N DG ++ KEF+G  DE+   E  + E + F   YDK+K+G L G E+TDW++         E E L   +D +KD  LS EEI+  H L+  + A     HL     H+E
Sbjct:   57 LDTNNDGFVDKSEILAWVSESYQKTVDREAVERISELDENADGFVSWEEYLADSFPDEELHNKEEESLIA--------------QDKMYFKQADEDNDGKLNLEELASFLNPEHHPHMHPVLIAVTLLEKDQNGDGAIEEKEFLGELDEQRGSEWYKVEVERFRTVYDKNKDGKLAGDELTDWLLVDGTTAGSYEAESLLTNSDDDKDGQLSYEEIVKHHALFAKTEAAQEADHLHPYYSHDE 285          
BLAST of Reticulocalbin-1 vs. Ensembl Celegans
Match: cmd-1 (Calmodulin [Source:UniProtKB/Swiss-Prot;Acc:O16305])

HSP 1 Score: 46.9802 bits (110), Expect = 3.155e-6
Identity = 37/134 (27.61%), Postives = 65/134 (48.51%), Query Frame = 1
Query:  613 KKKFQLADRNNDSMLDVPEFAKF--SHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVG--DEKM-DKETEEHEKKSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIIN 999
            K+ F L D++ D  +   E      S   N  E    EL+  + + D + +G +D  EF+     KM D ++EE  +++F  +DKD NG +  +E+   +    EK    EV+ +  E D++ D  ++ EE + 
Sbjct:   14 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEA---ELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVT 144          
BLAST of Reticulocalbin-1 vs. Ensembl Celegans
Match: K03A1.4 (pep chromosome:WBcel235:X:7296098:7298741:-1 gene:WBGene00019352.1 transcript:K03A1.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K03A1.4)

HSP 1 Score: 46.595 bits (109), Expect = 7.773e-6
Identity = 37/137 (27.01%), Postives = 63/137 (45.99%), Query Frame = 1
Query:  613 KKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFV----GDEKMDKETEEHEKKSFAEYDKDKNGLLQGSEITDWV-----MPGFEKTAVSEVEHLFNETDVNKDKNLSKEEII 996
            K+ F   D NND  + + E  K +      + +  EL   +   D +++G +   EF     G   M++ T +  ++ F  +DKDK+G ++  E+   V        F +     VE LFNE D++ D  +S EE +
Sbjct:   48 KRAFNFFDANNDGRITIDELEK-AMQKCGQKPTKLELRLIMYHGDNDQNGVITFDEFAHLMNGTASMNQYTYDQLREQFDMFDKDKDGFIEKMEMLSIVRELSLQASFPRQV---VEQLFNEADIDGDGKISFEEFV 180          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0301907)

HSP 1 Score: 189.504 bits (480), Expect = 1.452e-56
Identity = 106/283 (37.46%), Postives = 169/283 (59.72%), Query Frame = 1
Query:  229 HYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGF---IEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKM--DKETEEHEKKSF-AEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDM 1059
            H+ + G H+  FDH+A+ G+  E++EF  L P+E+KRRL +L+  +D N D ++++ EL  WI++SF+ L  E+A  + +++D++ D+ +TW EY+  TY       DE  K  + D   +    + +  DK+ F  AD N D +L + EF  F +P  +P+M    LE T++D D + DG ++ +EFVGD     DKE    EK+ F  ++D + +G+L G E+  W++P     A  EV+HLF  TD + D  LS  EI+N ++ +VGS ATDYG HL ++
Sbjct:   57 HHGEDGEHNVEFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAME----DEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHHDKEWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHLQNI 335          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0301905)

HSP 1 Score: 189.504 bits (480), Expect = 1.452e-56
Identity = 106/283 (37.46%), Postives = 169/283 (59.72%), Query Frame = 1
Query:  229 HYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGF---IEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKM--DKETEEHEKKSF-AEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDM 1059
            H+ + G H+  FDH+A+ G+  E++EF  L P+E+KRRL +L+  +D N D ++++ EL  WI++SF+ L  E+A  + +++D++ D+ +TW EY+  TY       DE  K  + D   +    + +  DK+ F  AD N D +L + EF  F +P  +P+M    LE T++D D + DG ++ +EFVGD     DKE    EK+ F  ++D + +G+L G E+  W++P     A  EV+HLF  TD + D  LS  EI+N ++ +VGS ATDYG HL ++
Sbjct:   57 HHGEDGEHNVEFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAME----DEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHHDKEWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHLQNI 335          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0079033)

HSP 1 Score: 189.504 bits (480), Expect = 1.452e-56
Identity = 106/283 (37.46%), Postives = 169/283 (59.72%), Query Frame = 1
Query:  229 HYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGF---IEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKM--DKETEEHEKKSF-AEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDM 1059
            H+ + G H+  FDH+A+ G+  E++EF  L P+E+KRRL +L+  +D N D ++++ EL  WI++SF+ L  E+A  + +++D++ D+ +TW EY+  TY       DE  K  + D   +    + +  DK+ F  AD N D +L + EF  F +P  +P+M    LE T++D D + DG ++ +EFVGD     DKE    EK+ F  ++D + +G+L G E+  W++P     A  EV+HLF  TD + D  LS  EI+N ++ +VGS ATDYG HL ++
Sbjct:   57 HHGEDGEHNVEFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAME----DEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHHDKEWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHLQNI 335          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0079034)

HSP 1 Score: 189.504 bits (480), Expect = 1.452e-56
Identity = 106/283 (37.46%), Postives = 169/283 (59.72%), Query Frame = 1
Query:  229 HYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGF---IEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKM--DKETEEHEKKSF-AEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDM 1059
            H+ + G H+  FDH+A+ G+  E++EF  L P+E+KRRL +L+  +D N D ++++ EL  WI++SF+ L  E+A  + +++D++ D+ +TW EY+  TY       DE  K  + D   +    + +  DK+ F  AD N D +L + EF  F +P  +P+M    LE T++D D + DG ++ +EFVGD     DKE    EK+ F  ++D + +G+L G E+  W++P     A  EV+HLF  TD + D  LS  EI+N ++ +VGS ATDYG HL ++
Sbjct:   57 HHGEDGEHNVEFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAME----DEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHHDKEWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHLQNI 335          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0301906)

HSP 1 Score: 189.504 bits (480), Expect = 1.452e-56
Identity = 106/283 (37.46%), Postives = 169/283 (59.72%), Query Frame = 1
Query:  229 HYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGF---IEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKM--DKETEEHEKKSF-AEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDM 1059
            H+ + G H+  FDH+A+ G+  E++EF  L P+E+KRRL +L+  +D N D ++++ EL  WI++SF+ L  E+A  + +++D++ D+ +TW EY+  TY       DE  K  + D   +    + +  DK+ F  AD N D +L + EF  F +P  +P+M    LE T++D D + DG ++ +EFVGD     DKE    EK+ F  ++D + +G+L G E+  W++P     A  EV+HLF  TD + D  LS  EI+N ++ +VGS ATDYG HL ++
Sbjct:   57 HHGEDGEHNVEFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAME----DEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHHDKEWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHLQNI 335          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: calua (calumenin a [Source:NCBI gene;Acc:415241])

HSP 1 Score: 189.119 bits (479), Expect = 1.484e-56
Identity = 114/323 (35.29%), Postives = 186/323 (57.59%), Query Frame = 1
Query:  103 MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD-----EKMDK-ETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            M I+  + C +L ++     ++S+  + +   HH    +  EH D +      +DHDA  G   E++ F DL PEE+K RLG +V+KID + D +V + EL  WI ++ +    ++   + +D D NND+M++W EY + TYG        +      D   + + +  D+++F++AD N D + D  EF  F HP  Y  M    + +T+ED DKN DG +DL+E++GD     ++MD+ E    E++ F+E+ DK+K+G +   E  DW++P     A +E +HL  E+D NKD  L+KEEI+N+++L+VGS ATD+G+ L
Sbjct:    3 MEIRPLLMCFALCVVY----ATSKPTEKKDRVHHDAPLSSKEHDDGTNFE---YDHDAFLGEE-EAKTFDDLTPEESKNRLGKIVEKIDADEDGFVTEAELKAWIKKAQKKYIYDNVERQWKDFDLNNDRMISWEEYKNVTYGTY------LDDPEPDDGYNYKQMMARDERRFKMADGNGDHIADKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVATEREQFSEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQATDFGEAL 311          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: calua (calumenin a [Source:NCBI gene;Acc:415241])

HSP 1 Score: 189.119 bits (479), Expect = 1.484e-56
Identity = 114/323 (35.29%), Postives = 186/323 (57.59%), Query Frame = 1
Query:  103 MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD-----EKMDK-ETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            M I+  + C +L ++     ++S+  + +   HH    +  EH D +      +DHDA  G   E++ F DL PEE+K RLG +V+KID + D +V + EL  WI ++ +    ++   + +D D NND+M++W EY + TYG        +      D   + + +  D+++F++AD N D + D  EF  F HP  Y  M    + +T+ED DKN DG +DL+E++GD     ++MD+ E    E++ F+E+ DK+K+G +   E  DW++P     A +E +HL  E+D NKD  L+KEEI+N+++L+VGS ATD+G+ L
Sbjct:    3 MEIRPLLMCFALCVVY----ATSKPTEKKDRVHHDAPLSSKEHDDGTNFE---YDHDAFLGEE-EAKTFDDLTPEESKNRLGKIVEKIDADEDGFVTEAELKAWIKKAQKKYIYDNVERQWKDFDLNNDRMISWEEYKNVTYGTY------LDDPEPDDGYNYKQMMARDERRFKMADGNGDHIADKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVATEREQFSEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQATDFGEAL 311          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: rcn3 (reticulocalbin 3, EF-hand calcium binding domain [Source:ZFIN;Acc:ZDB-GENE-040625-175])

HSP 1 Score: 171.785 bits (434), Expect = 5.856e-50
Identity = 118/327 (36.09%), Postives = 176/327 (53.82%), Query Frame = 1
Query:  121 ITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHS-EKEIDEMIKTGSTDMKGFIEGVL-MDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD--EKMDKETEE----HEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDMKPHEE 1074
            +  + L  + LF   S      E   HH    + H H D  G     FDH+A  G   ES+ F  L PEE+K RLG +VDKIDT+ D +V+  EL  WI    R    E+      + D+N D  + W EY + TYG+  + E D++      D K   + +L  D+++F+ ADR+ D +    EF  F HP  +  M    +++T+ED DKN DG +DL+E++GD     D ETE      EKK F+E+ D +K+G L  +E++ W++P     A +E  HL +ETD + D  ++K+EI+    ++VGS AT+YG+ L   K H+E
Sbjct:    1 MQLLFLGTLALFAGLSVAVPAQEKRIHHKLDLSDHPHDDAHGFQ---FDHEAFLGKE-ESKTFDQLSPEESKDRLGKIVDKIDTDKDGFVSHAELHHWIKHRQRRYIEENVDKHWNEYDQNKDGKIGWIEYKNTTYGYYIDTEFDDV------DDKATYKSMLNRDERRFKSADRDGDGVATREEFTAFLHPEEFDFMRDIVIQETIEDIDKNGDGKIDLQEYIGDMYNPEDGETEPDWVTTEKKQFSEFRDMNKDGFLDATEVSHWILPTEVDHADNEARHLIHETDKDNDDKITKKEILENWNMFVGSQATNYGEDL--TKRHDE 315          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: rcn3 (reticulocalbin 3, EF-hand calcium binding domain [Source:ZFIN;Acc:ZDB-GENE-040625-175])

HSP 1 Score: 171.785 bits (434), Expect = 5.856e-50
Identity = 118/327 (36.09%), Postives = 176/327 (53.82%), Query Frame = 1
Query:  121 ITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHS-EKEIDEMIKTGSTDMKGFIEGVL-MDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD--EKMDKETEE----HEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDMKPHEE 1074
            +  + L  + LF   S      E   HH    + H H D  G     FDH+A  G   ES+ F  L PEE+K RLG +VDKIDT+ D +V+  EL  WI    R    E+      + D+N D  + W EY + TYG+  + E D++      D K   + +L  D+++F+ ADR+ D +    EF  F HP  +  M    +++T+ED DKN DG +DL+E++GD     D ETE      EKK F+E+ D +K+G L  +E++ W++P     A +E  HL +ETD + D  ++K+EI+    ++VGS AT+YG+ L   K H+E
Sbjct:    1 MQLLFLGTLALFAGLSVAVPAQEKRIHHKLDLSDHPHDDAHGFQ---FDHEAFLGKE-ESKTFDQLSPEESKDRLGKIVDKIDTDKDGFVSHAELHHWIKHRQRRYIEENVDKHWNEYDQNKDGKIGWIEYKNTTYGYYIDTEFDDV------DDKATYKSMLNRDERRFKSADRDGDGVATREEFTAFLHPEEFDFMRDIVIQETIEDIDKNGDGKIDLQEYIGDMYNPEDGETEPDWVTTEKKQFSEFRDMNKDGFLDATEVSHWILPTEVDHADNEARHLIHETDKDNDDKITKKEILENWNMFVGSQATNYGEDL--TKRHDE 315          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: calub (calumenin b [Source:NCBI gene;Acc:394057])

HSP 1 Score: 171.014 bits (432), Expect = 9.583e-50
Identity = 106/312 (33.97%), Postives = 173/312 (55.45%), Query Frame = 1
Query:  136 LTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD------EKMDKETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            L  + L  + SS     + D  H D    ++ +D   + D  +DH+A  G   E++ F  L PEE+K RLG +V+KID +HD +V   E+ +WI  + R    ED   + Q  D N+D  ++W EY + TYG+   E D        D   + + +  D+++F++AD++ D   +  EF  F HP  +  M    + +T+ED DKN DG +DL E++GD      +  + E  + E++ F E+ DK+K+G +   E  DW++P     A +E +HL  E+D +KD  L+K+EI+++++L+VGS ATD+G  L
Sbjct:    7 LFFVALCILQSSSKPMEKKDRVHHDVPLSNKDHDDEENFD--YDHEAFLG-QEEAKTFDQLTPEESKERLGKIVEKIDEDHDGFVTADEMKRWIKHAQRRWIYEDVDRQWQAHDLNSDSFVSWEEYKNATYGYILDEAD------PEDGFNYRQMMTRDERRFKMADQDGDLRANKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLNEYIGDMYSQNGDSSEPEWVKTEREQFTEFRDKNKDGRMDKDETRDWILPADYDHAEAEAKHLLYESDADKDGRLTKQEIVDKYDLFVGSQATDFGDAL 309          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:395023])

HSP 1 Score: 178.333 bits (451), Expect = 3.278e-52
Identity = 103/315 (32.70%), Postives = 175/315 (55.56%), Query Frame = 1
Query:  127 CISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETE------EHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
             ++L +  + G+ + E +      HH+   + HEH D+ G     +DH+A  G   E+  F  L PEE++ RLG ++D++D ++D Y+   ELF WI    R  +LED+  + +  D N D M++W EY    YGH   + +E       D + + + ++ D+++F++AD++ D +    EF  F HP  Y  M    + +T+ED DKN DG VD+ E++ D     E E      + E++ F ++ D +K+G +  +EI+ W++P     A  E +HL  E+D +KD  L+K+EI++   ++VGS AT+YG+ L
Sbjct:    9 LVTLCVSWVMGVPTKEKKDRV---HHSKDLSDHEHDDQKGFQ---YDHEAFLGKE-EARTFDQLTPEESQHRLGKIIDQMDKDNDKYITSGELFAWIKHVSRRWNLEDSEKQGKKYDTNKDGMISWDEYAKGVYGHLLGKGEEFYDVADKDKERYRKMMMRDERRFKVADKDGDLIATREEFTAFLHPEEYGYMQDIVITETIEDIDKNDDGIVDVHEYIADMYTPNEDEPEPDWVKTERQQFTDFRDINKDGKMDRTEISQWILPHDYDHADLEAKHLVYESDKDKDGKLTKKEILDNWNMFVGSQATNYGEDL 316          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:395023])

HSP 1 Score: 168.703 bits (426), Expect = 1.178e-48
Identity = 104/315 (33.02%), Postives = 172/315 (54.60%), Query Frame = 1
Query:  127 CISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETE------EHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
             ++L +  + G+ + E +      HH+   + HEH D+ G     +DH+A  G   E+  F  L PEE++ RLG +VDKID + D +V   EL +W+  S      E+      D D+N D M++W EY + TYG+   E  E       D + + + ++ D+++F++AD++ D +    EF  F HP  Y  M    + +T+ED DKN DG VD+ E++ D     E E      + E++ F ++ D +K+G +  +EI+ W++P     A  E +HL  E+D +KD  L+K+EI++   ++VGS AT+YG+ L
Sbjct:    9 LVTLCVSWVMGVPTKEKKDRV---HHSKDLSDHEHDDQKGFQ---YDHEAFLGKE-EARTFDQLTPEESQHRLGKIVDKIDKDKDGFVTDIELKEWMKHSQNRYIYENVNKHWADYDKNKDDMISWEEYKNTTYGYLPGE--EFYDVADKDKERYRKMMMRDERRFKVADKDGDLIATREEFTAFLHPEEYGYMQDIVITETIEDIDKNDDGIVDVHEYIADMYTPNEDEPEPDWVKTERQQFTDFRDINKDGKMDRTEISQWILPHDYDHADLEAKHLVYESDKDKDGKLTKKEILDNWNMFVGSQATNYGEDL 314          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: calu (calumenin [Source:NCBI gene;Acc:407965])

HSP 1 Score: 164.466 bits (415), Expect = 4.720e-47
Identity = 96/270 (35.56%), Postives = 161/270 (59.63%), Query Frame = 1
Query:  262 FDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD------EKMDKETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            +DHDA  G+  E++ F  L PEE+K RLG++V KID ++D YV + EL  WI ++ +    ++   + Q+ D N D +++W EY + TYG     +D+     S + K  +   + D+++F++AD++ D +    EF  F HP  +  M    + +T+ED DKN DG +DL+E++GD      +  + E  + E++ F E+ DK+ +G +   E  DW++P     A +E  HL  E+D NKD  L++EEI+++++L+VGS ATD+G+ L
Sbjct:   47 YDHDAFLGAE-EAKTFDQLTPEESKERLGMIVSKIDLDNDGYVTEGELTAWIKKAQKKYVYDNVERQWQEFDLNQDGLVSWDEYRNVTYGTY---LDDPDPDNSFNYKQMM---VRDERRFKMADQDGDLIATKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLEEYIGDMYNHDGDANEPEWVKTEREQFVEFRDKNHDGKMDKEETKDWILPSDYDHAEAESRHLVYESDQNKDSKLTREEIVDKYDLFVGSQATDFGEAL 309          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: calu (calumenin [Source:NCBI gene;Acc:407965])

HSP 1 Score: 164.081 bits (414), Expect = 7.352e-47
Identity = 98/270 (36.30%), Postives = 158/270 (58.52%), Query Frame = 1
Query:  262 FDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD------EKMDKETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            +DHDA  G+  E++ F  L PEE+K RLG +V KID + D YV   EL  WI+ + +    ED   + +  D N D M++W EY + TYG+    +D+     S + K  +   + D+++F++AD++ D +    EF  F HP  +  M    + +T+ED DKN DG +DL+E++GD      +  + E  + E++ F E+ DK+ +G +   E  DW++P     A +E  HL  E+D NKD  L++EEI+++++L+VGS ATD+G+ L
Sbjct:   47 YDHDAFLGAE-EAKTFDQLTPEESKERLGRIVGKIDADKDGYVTVNELRDWIIFAQKRWIYEDVERQWKGHDLNGDSMVSWEEYKNATYGYI---LDDPDPDNSFNYKQMM---VRDERRFKMADQDGDLIATKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLEEYIGDMYNHDGDANEPEWVKTEREQFVEFRDKNHDGKMDKEETKDWILPSDYDHAEAESRHLVYESDQNKDSKLTREEIVDKYDLFVGSQATDFGEAL 309          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: rcn2 (reticulocalbin 2 [Source:NCBI gene;Acc:733807])

HSP 1 Score: 156.377 bits (394), Expect = 4.841e-44
Identity = 113/319 (35.42%), Postives = 168/319 (52.66%), Query Frame = 1
Query:  121 ITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEH------EKKSFA-EYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDD 1056
            I C   T+ L F ++     QHE            EHY+ +G H+  FD     G   E+EEF +L PE+  +RL  ++ KIDT+ D Y+ + EL  WI +SF++  LED      ++D++ D ++TW EY    Y     + DE       + + F +  L DK++F  ADR++   L++ EF  F HP     MS F +E  LE+ DK+ DG V L+E++GD   D  T E       EK  F  +YDKD +G L   E+  W++P     +  E  HL  E D N+D+ LS+EEI+   ++++ S ATDYG+ L D
Sbjct:    9 IWCF-FTVCLAFSLAH----QHE------------EHYE-NGEHNAEFDKKMFLGGEEEAEEFTELSPEDQLKRLKSIIRKIDTDSDGYLTEEELSFWIQKSFKHYILEDTKEHFAEIDKDGDGIVTWDEYNMHMYDRI-IDYDENTVLEDEEEESFRQIHLRDKRRFDHADRDDIPGLNLTEFTDFEHPEETDHMSEFVIEGALEEHDKDGDGFVSLEEYLGDYTQDPGTVEDPHWLIVEKDRFMNDYDKDGDGRLNPVELLSWIVPNNLGISQEEASHLMEEMDKNEDQRLSEEEILQNKDIFLTSEATDYGRQLQD 308          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Calu (calumenin [Source:MGI Symbol;Acc:MGI:1097158])

HSP 1 Score: 174.481 bits (441), Expect = 5.439e-51
Identity = 108/323 (33.44%), Postives = 178/323 (55.11%), Query Frame = 1
Query:  103 MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD------EKMDKETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            M ++  + C+SL         S  TE+ +   HH    +   H D        +DHDA  G+  E++ F  L PEE+K RLG++VDKID + D +V + EL  WI  + +    ++   + Q+ D N D +++W EY + TYG    + D        D   + + ++ D+++F++AD++ D +    EF  F HP  Y  M    +++T+ED DKN DG +DL+E++GD         + E  + E++ F E+ DK+++G +   E  DW++P     A +E  HL  E+D NKD  L+KEEI+++++L+VGS ATD+G+ L
Sbjct:    1 MDLRQFLMCLSLCTAFAL---SKPTEKKDRV-HHEPQLSDKVHNDAQNF---DYDHDAFLGAE-EAKSFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYLDDPD------PDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEAL 309          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Rcn2 (reticulocalbin 2 [Source:MGI Symbol;Acc:MGI:1349765])

HSP 1 Score: 169.088 bits (427), Expect = 6.747e-49
Identity = 105/290 (36.21%), Postives = 163/290 (56.21%), Query Frame = 1
Query:  229 HYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEH------EKKSFA-EYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL-DDMKPHEE 1074
            HY   G H   +D +A+ G   + +E+  L  EE +RRL  ++ KID++ D ++ + EL +WI  SF++  +++A  +  + D+N+D  +TW EY  + Y     + DE      T+   F +  L DKK+F+ A++++   L + EF  F HP     M+ F +++ LE+ DKN DG V L+EF+GD + D    E       EK  F  +YDKD +G L   E+  WV+P  +  A  E  HL +E D+N DK LS+EEI+   +L++ S ATDYG+ L DD   H+E
Sbjct:   32 HY-PQGEHRADYDREALLGVQEDVDEYVKLGHEEQQRRLQSIIKKIDSDSDGFLTENELSQWIQMSFKHYAMQEAKQQFVEYDKNSDGAVTWDEYNIQMYDRV-IDFDENTALDDTEEGSFRQLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGDYRRDPTANEDPEWILVEKDRFVNDYDKDNDGRLDPQELLSWVVPNNQGIAQEEALHLIDEMDLNSDKKLSEEEILENQDLFLTSEATDYGRQLHDDYFYHDE 319          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Calu (calumenin [Source:MGI Symbol;Acc:MGI:1097158])

HSP 1 Score: 165.622 bits (418), Expect = 1.119e-47
Identity = 108/323 (33.44%), Postives = 175/323 (54.18%), Query Frame = 1
Query:  103 MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD------EKMDKETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            M ++  + C+SL         S  TE+ +   HH    +   H D        +DHDA  G+  E++ F  L PEE+K RLG +V KID + D +V   EL  WI  + +    ED   + +  D N D +++W EY + TYG+   + D        D   + + ++ D+++F++AD++ D +    EF  F HP  Y  M    +++T+ED DKN DG +DL+E++GD         + E  + E++ F E+ DK+++G +   E  DW++P     A +E  HL  E+D NKD  L+KEEI+++++L+VGS ATD+G+ L
Sbjct:    1 MDLRQFLMCLSLCTAFAL---SKPTEKKDRV-HHEPQLSDKVHNDAQNF---DYDHDAFLGAE-EAKSFDQLTPEESKERLGKIVSKIDDDKDGFVTVDELKGWIKFAQKRWIHEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPD------PDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEAL 309          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Rcn3 (reticulocalbin 3, EF-hand calcium binding domain [Source:MGI Symbol;Acc:MGI:1277122])

HSP 1 Score: 155.606 bits (392), Expect = 1.002e-43
Identity = 105/313 (33.55%), Postives = 167/313 (53.35%), Query Frame = 1
Query:  154 FGISSSETEQHESDD-HHAD--SSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDS--YVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSE--KEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEH------EKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
             G  S +   H  D  HH    S  PH+      H +  +DH+A  G    ++EF  L PEE++ RLG +VD++D   DS  +V+  EL  WI  + +    +  +      D + D  + W E  + TYGH E  +E  ++      D + + + +  D+++F++AD++ DSM    E   F HP  +P M    + +TLED DKNKDG V ++E++ D   ++  EE       E++ F E+ D +K+G L GSE+  WV+P  +   + E  HL +E+D +KD  LSK EI++   ++VGS AT+YG+ L
Sbjct:   19 LGKPSPDAGPHGQDRVHHGTPLSEAPHD----DAHGNFQYDHEAFLGRD-VAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDV-----EDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDL 321          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Rcn3 (reticulocalbin 3, EF-hand calcium binding domain [Source:MGI Symbol;Acc:MGI:1277122])

HSP 1 Score: 155.606 bits (392), Expect = 1.002e-43
Identity = 105/313 (33.55%), Postives = 167/313 (53.35%), Query Frame = 1
Query:  154 FGISSSETEQHESDD-HHAD--SSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDS--YVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSE--KEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEH------EKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
             G  S +   H  D  HH    S  PH+      H +  +DH+A  G    ++EF  L PEE++ RLG +VD++D   DS  +V+  EL  WI  + +    +  +      D + D  + W E  + TYGH E  +E  ++      D + + + +  D+++F++AD++ DSM    E   F HP  +P M    + +TLED DKNKDG V ++E++ D   ++  EE       E++ F E+ D +K+G L GSE+  WV+P  +   + E  HL +E+D +KD  LSK EI++   ++VGS AT+YG+ L
Sbjct:   19 LGKPSPDAGPHGQDRVHHGTPLSEAPHD----DAHGNFQYDHEAFLGRD-VAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDV-----EDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDL 321          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|B5X186|CALUA_SALSA (Calumenin-A OS=Salmo salar OX=8030 GN=calua PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 3.333e-58
Identity = 121/323 (37.46%), Postives = 185/323 (57.28%), Query Frame = 1
Query:  103 MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD-EKMDKETEEH-----EKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            M I+  + C +L ++     +S  TE+ E   H A  S+  EH D  G     +DHDA  G   E++ F DL PEE+KRRLG++V+KID + D +V + EL  WI ++ +    E+   + +D D NND M++W EY + TYG        +      D   +   +  D+++F++AD+N D + +  EF  F HP  Y  M    + +T+ED DKN DG +DL E++GD    + E EE      E++ F+E+ DK+K+G +   E  DW++P     A +E +HL  E+D NKD  LSKEEI+N+++L+VGS ATD+G+ L
Sbjct:    1 MEIRPLLMCFALCVVY---ATSKPTEKKERIHHDAPLSS-REHDDAQGF---DYDHDAFLG-QKEAKSFDDLSPEESKRRLGVIVEKIDGDSDGFVTEVELRAWIKKAQKKYIYENVDRQWKDFDVNNDGMISWEEYRNVTYGTY------LDDPEPDDGYNYQHMMARDERRFKMADQNRDQIANKEEFTAFLHPEEYDHMKDIVVLETMEDIDKNGDGFIDLNEYIGDMYNHEDEMEEPDWVATEREQFSEFRDKNKDGKMDREETMDWILPSDYDHAEAEAKHLVYESDSNKDGKLSKEEILNKYDLFVGSQATDFGEAL 309          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q6IQP3|CALUA_DANRE (Calumenin-A OS=Danio rerio OX=7955 GN=calua PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 9.430e-56
Identity = 114/323 (35.29%), Postives = 186/323 (57.59%), Query Frame = 1
Query:  103 MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD-----EKMDK-ETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            M I+  + C +L ++     ++S+  + +   HH    +  EH D +      +DHDA  G   E++ F DL PEE+K RLG +V+KID + D +V + EL  WI ++ +    ++   + +D D NND+M++W EY + TYG        +      D   + + +  D+++F++AD N D + D  EF  F HP  Y  M    + +T+ED DKN DG +DL+E++GD     ++MD+ E    E++ F+E+ DK+K+G +   E  DW++P     A +E +HL  E+D NKD  L+KEEI+N+++L+VGS ATD+G+ L
Sbjct:    1 MEIRPLLMCFALCVVY----ATSKPTEKKDRVHHDAPLSSKEHDDGTNFE---YDHDAFLGEE-EAKTFDDLTPEESKNRLGKIVEKIDADEDGFVTEAELKAWIKKAQKKYIYDNVERQWKDFDLNNDRMISWEEYKNVTYGTY------LDDPEPDDGYNYKQMMARDERRFKMADGNGDHIADKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVATEREQFSEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQATDFGEAL 309          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|J3S9D9|RCN2V_CROAD (Reticulocalbin-2 OS=Crotalus adamanteus OX=8729 PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 3.324e-51
Identity = 102/276 (36.96%), Postives = 156/276 (56.52%), Query Frame = 1
Query:  250 HDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEE-------HEKKSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDD 1056
            H   +D +A+ G   E EEF  L PEE ++RL +++ +ID + D ++ + EL  WI  SF++  +EDA  + Q  D++ D  ++W EY  + Y     + +E       + + F +  L DKK+FQ A+++ DS LD  EFA F HP     M  F ++++LE+ DK+ DG V L+EF+GD + D   +E        E +   +YDKDK+G L   E+  WVMP  E  A  E  HL +E D++ D+ LS  EI+   +L++ S ATDYG+ L D
Sbjct:   24 HRPDYDKEALLGGQDEVEEFSKLSPEEQQKRLKVIISRIDVDLDGFLTEAELSSWIQHSFKSYIIEDAKQQFQHYDKDGDGRVSWEEYNIQMYDRV-IDFEEDTTLDDAEEESFRQLHLKDKKRFQKANKDGDSHLDFEEFAAFEHPEEADYMKEFVIQESLEEHDKDGDGFVSLQEFLGDYRRDPAAKEDPEWIVVEEDRFKNDYDKDKDGKLSPKELLTWVMPNNEGLAQEEAVHLLDEMDLDGDRRLSANEILENQDLFLNSEATDYGRQLHD 298          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q7SXV9|CALUB_DANRE (Calumenin-B OS=Danio rerio OX=7955 GN=calub PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.315e-49
Identity = 106/312 (33.97%), Postives = 174/312 (55.77%), Query Frame = 1
Query:  136 LTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD------EKMDKETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            L ++ L  + SS     + D  H D+   ++ +D   + D  +DH+A  G   E++ F  L PEE+K RLG +V+KID +HD +V   E+ +WI  + R    ED   + Q  D N+D  ++W EY   TYG+   E D        D   + + +  D+++F++AD++ D   +  EF  F HP  +  M    + +T+ED DKN DG +DL E++GD      +  + E  + E++ F E+ DK+K+G +   E  DW++P     A +E +HL  E+D +KD  L+K+EI+++++L+VGS ATD+G  L
Sbjct:    7 LFVVALCILQSSSKPMEKKDRVHHDAPLSNKDHDDEENFD--YDHEAFLG-QEEAKTFDQLTPEESKERLGKIVEKIDEDHDGFVTADEMKRWIKHAQRRWIYEDVDRQWQAHDLNSDSFVSWEEYKDATYGYILDEAD------PEDGFNYRQMMTRDERRFKMADQDGDLRANKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLNEYIGDMYSQNGDSSEPEWVKTEREQFTEFRDKNKDGRMDKDETRDWILPADYDHAEAEAKHLLYESDADKDGRLTKQEIVDKYDLFVGSQATDFGDAL 309          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q3T0K1|CALU_BOVIN (Calumenin OS=Bos taurus OX=9913 GN=CALU PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 3.201e-49
Identity = 107/323 (33.13%), Postives = 177/323 (54.80%), Query Frame = 1
Query:  103 MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD------EKMDKETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            M ++  + C+SL         S  TE+ +   HH    +   H D        +DHDA  G+  E++ F  L PEE+K RLG++VDKID + D +V + EL  WI  + +    ++   + Q+ D N D +++W EY + TYG    + D        D   + + ++ D+++F++AD++ D +    EF  F HP  Y  M    +++ +ED DKN DG +DL+E++GD         + E  + E++ F E+ DK+++G +   E  DW++P     A +E  HL  E+D NKD  L+KEEI+++++L+VGS ATD+G+ L
Sbjct:    1 MDLRQFLMCLSLCTAFAL---SKPTEKKDRV-HHEPQLSDKVHNDAQSF---DYDHDAFLGAE-EAKTFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDLNQDGLISWDEYRNVTYGTYLDDPD------PDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQEPMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEAL 309          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: A0A267GP25 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024316g1 PE=4 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 3.664e-101
Identity = 159/327 (48.62%), Postives = 225/327 (68.81%), Query Frame = 1
Query:   91 RFLIMIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEHEKKSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDMKPHE 1071
            + L ++I   +  IS  +      S++E  + E D      S   +H DK GHHD +FDH+AVTGSH ++EEFKDL PEE+K+RL +LV ++D++ +  +++ EL  WI+ SF+ LD EDA +KM++ DEN+DK +TW EY+ K YG+  +E+ E  K  S DM  F++ +  DK+KFQLAD N+D  LD+ E+  F+HPHNY  M+  E++KT++D+DKN DG +D KEF+G++KMD ET + E + F +YDK+ +G L   E+  W MP FE +A +E EHL  E+D +KD  LSK+EI++QHELWVGS ATDYGKHLDDMK  E
Sbjct:    4 QLLAVVIALALVAISAPV------SAAERPKGEPD-----ISAKAKHTDKDGHHDASFDHEAVTGSHKDAEEFKDLTPEESKKRLAVLVGRMDSDGNGKIDKNELTNWIVNSFKKLDREDAASKMEEHDENDDKKVTWPEYLHKAYGYKVEELKEFEKDKSPDMLSFLQMLEEDKRKFQLADHNHDGSLDLEEYTFFTHPHNYDIMAPVEIDKTMKDYDKNSDGFIDEKEFMGEDKMDPETSKAESEHFKQYDKNGDGKLDRDEVKAWTMPKFEDSAATEAEHLIKESDKDKDGVLSKDEILDQHELWVGSQATDYGKHLDDMKKDE 319          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: A0A4E0RT35 (Reticulocalbin-1 OS=Fasciola hepatica OX=6192 GN=D915_009175 PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 1.329e-87
Identity = 133/272 (48.90%), Postives = 194/272 (71.32%), Query Frame = 1
Query:  259 TFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEHEKKSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDMKPHEE 1074
            +FDH A+ G+H ++ +F+ LEPEEAK+RL  LV+++DTN D  VN+ EL  WI+ SF+ LDLE +  +++D DEN+D  ++WAEY+ KT+G+SE E+DE+ K    + + F++ V  +K KF  AD + + +L+  E+A F +PHNYP M+ +E+ +TL+DFD++KD  +  +E++ D KM  E  + EK +F  YDK+ +G L   E+ +WV PGFE+TAVSE EHL  ETD +KD  LSK+EI+ QHELWVGS ATDYG+HL+ M P +E
Sbjct:   62 SFDHQAILGTHEQAMQFRQLEPEEAKKRLARLVERMDTNQDGAVNKEELVDWIVHSFKLLDLESSRQRLKDRDENSDGAVSWAEYLHKTFGYSELEMDELKKNDGPETQAFVQSVEHEKVKFDSADLDKNGLLNETEYAAFEYPHNYPHMAPYEIIQTLKDFDRDKDEFISEEEYLQDSKMQPEALQIEKANFKRYDKNGDGKLDKEELVNWVTPGFERTAVSEAEHLIMETDSDKDGQLSKDEILRQHELWVGSQATDYGRHLEQM-PRDE 332          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: A0A504YZD3 (Reticulocalbin-1 (Fragment) OS=Fasciola gigantica OX=46835 GN=FGIG_06313 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 7.218e-87
Identity = 129/267 (48.31%), Postives = 191/267 (71.54%), Query Frame = 1
Query:  259 TFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEHEKKSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDM 1059
            +FDH A+ G+H ++ +F+ LEPEEAK+RL  LV+++DTN D  VN+ EL  WI+ SF+ LDLE +  +++D DEN+D  ++WAEY+ KT+G+SE E++E+ K    + + F++ V  +K KF  AD + + +L+  E+A F +PHNYP M+ +E+ +TL+DFD++KDG +  +E++ D KM  E  + EK +F  YDK+ +G L   E+ +WV PGFE+TA SE +HL  ETD +KD  LSK+EI+ QHELWVGS ATDYG+HL+ M
Sbjct:   62 SFDHQAILGTHEQAMQFRQLEPEEAKKRLARLVERMDTNQDGAVNKEELVDWIVHSFKLLDLESSRQRLKDRDENSDGAVSWAEYLHKTFGYSELEMEELKKNDGPETQAFVQSVEHEKVKFDSADLDKNGLLNETEYAAFEYPHNYPHMAPYEIIQTLKDFDRDKDGFIGEEEYLQDSKMQPEALQIEKANFKRYDKNGDGKLDKEELVNWVTPGFERTAASEADHLIMETDSDKDGQLSKDEILRQHELWVGSQATDYGRHLEQM 328          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: A0A4S2M724 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002236 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 9.477e-86
Identity = 135/322 (41.93%), Postives = 203/322 (63.04%), Query Frame = 1
Query:  118 KITCISLTIILLFGISSSETEQHESDD----HHADSSTPH------EHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEHEKKSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLD 1053
            +   + + I++   +  S++++ E+ D     H     P        H++  G HD   DH+ V GS  +++ FK LEPEEAK RLG L +K+DTN +  ++++EL  WI+QSF NLDLE A  K++D D + D  LTW EY ++ YG+S  E++++ K  S + + F++ +  +K KF+ AD + +  L+  EF  F HPHNYP M+ +E+  TL DFD + DG +  +E++ D+KM +E  + E ++F  YD + +G L   E+  WV PGF++TA  E EHLF+ETD N DK LSKEE++ QHELWVGS ATDYG+HL+
Sbjct:    5 QFAPLFICIVICVWVEKSQSDEFENLDVLMNEHLRPDDPQIPTSGSVHFNAFGQHDFDLDHEVVLGSFEQTQYFKQLEPEEAKMRLGQLFEKMDTNQNGNLDKSELIDWIVQSFTNLDLESAKIKLKDYDSDQDGTLTWEEYTNRVYGYSSTELEQLAKDSSNETQAFLQSIEEEKIKFKSADVDQNGHLNATEFTAFEHPHNYPHMAPYEIIHTLRDFDADDDGFISQQEYLADDKMHREAFKIELENFKRYDTNGDGRLDQEEMKHWVTPGFQRTATEEAEHLFSETDANGDKELSKEEVLAQHELWVGSQATDYGRHLE 326          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: A0A4Z2CL09 (Reticulocalbin-2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010150 PE=4 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 2.937e-84
Identity = 141/329 (42.86%), Postives = 214/329 (65.05%), Query Frame = 1
Query:   88 LRFLIMIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEHEKKSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDMKPHEE 1074
            L +LI ++   ITC +    +    +S      E D H  D    HEHYD  G H   +DHD +TGSH  S++FK+LEPEEAK +LG L  KID ++++ +++ EL  WI+QSF +LDLE +  + ++ D + D  L W+EY +K YG++E+E++++ K G  +   F++ +  +K +F  AD++    L+  EF  F HPHNY  M+ +EL+ TL DFDK+KDG +   E++ D+KM+K+    E+++F  YD + +G L   E+  W+ PGF +TA  E+EHLFNETD +KD  L+KEE+I+QH+LWVGS ATDYG+HL+++ P +E
Sbjct:    4 LNYLIYMLHI-ITCSNDFNNIDGKFNSYYLRPDEPDLHMLDDYQGHEHYDDFGQHYSEYDHDLITGSHEYSQKFKELEPEEAKLQLGKLFHKIDVDNNAKIDKEELKNWIIQSFISLDLEASKPRFKEYDADGDGQLAWSEYTNKIYGYTEQELEDLRKDGKNETSLFMQSIDEEKFRFDSADQDKTGYLNETEFVAFEHPHNYRHMAPYELKHTLRDFDKDKDGYISEVEYLADDKMNKDALIVERENFKNYDINADGKLDHDEMALWITPGFNRTATDEMEHLFNETDKDKDGLLTKEEVIDQHDLWVGSQATDYGRHLENL-PRDE 330          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: calua (calumenin [Source:NCBI gene;Acc:103043492])

HSP 1 Score: 189.504 bits (480), Expect = 7.771e-57
Identity = 115/323 (35.60%), Postives = 186/323 (57.59%), Query Frame = 1
Query:  103 MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD-----EKMDK-ETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            M ++  + C +L ++     ++S+  + +   HH    +  EH D        +DHDA  G    ++ F DL PEE+K RLG +V+KID + D +V + EL +WI ++ +    ++   + +D D NND M++W EY + TYG        +      D   + + +  D+++F++ADRN DS+ D  EF  F HP  Y  M    + +T+ED DKN DG +DL+E++GD     ++MD+ E    E++ F+E+ DK+K+G +   E  DW++P     A +E +HL  E+D NKD  LSKEEI+N+++L+VGS ATD+G+ L
Sbjct:    1 MEVRPLLMCFALCVVY----ATSKPTEKKDRVHHDAPLSSKEHNDGENF---DYDHDAFLGEEV-AKSFDDLTPEESKDRLGKIVEKIDDDQDGFVTEAELKEWIKKAQKKYIYDNVDRQWKDFDMNNDGMISWDEYKNVTYGTY------LDDPEPDDGYNYKQMMARDERRFKMADRNGDSIADKEEFTAFLHPEEYEHMKEIVVLETMEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVATEREQFSEFRDKNKDGKMDKEETMDWILPADYDHAEAEAKHLVYESDSNKDGKLSKEEILNKYDLFVGSQATDFGEAL 309          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: calub (calumenin-B [Source:NCBI gene;Acc:103027690])

HSP 1 Score: 174.481 bits (441), Expect = 4.137e-51
Identity = 117/321 (36.45%), Postives = 177/321 (55.14%), Query Frame = 1
Query:  121 ITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFD--HDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLM--DKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD------EKMDKETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            + CI L ++ +    SS+    +   HH  S +  EH D     DE FD  H+A  G   E++ F  L PEE+K RLGL+VDKID +HD++V   EL KWI  + +    ED   + Q  D N D  ++W EY + TYG+        I   S    GF    +M  D+++F++AD + +   D  EF  F HP  Y  M    + +T+ED DKN DG +DL E++GD      +  + E    E++ F E+ DK+K+G +   E  DW++P     A +E +HL  E+D +KD  L+K+EI+++++L+VGS ATD+G+ L
Sbjct:    7 LLCIVLCVVHI----SSKPMDKKDRVHHDASLSNKEHED-----DENFDYDHEAFLG-QEEAKTFDQLTPEESKERLGLIVDKIDEDHDAHVTVEELKKWIKHAQKRWIYEDVDRQWQSHDLNADGYVSWEEYKNATYGY--------ILDDSDPDDGFNYRQMMARDERRFKMADTDGNLQADKEEFTAFLHPEEYDYMKDIVVLETMEDIDKNGDGFIDLDEYIGDMYSQDGDPTEPEWVRTEREQFTEFRDKNKDGRMDKEETRDWILPSDYDHAEAEAKHLLYESDTDKDGMLTKQEIVDKYDLFVGSQATDFGEAL 309          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:103045651])

HSP 1 Score: 165.622 bits (418), Expect = 9.181e-48
Identity = 103/313 (32.91%), Postives = 174/313 (55.59%), Query Frame = 1
Query:  136 LTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYG-HSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEH------EKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            L + L+ G++ +   Q E   HH    + H H D    H   +DH+A  G   E++ F  L PEE+K +LG +VD+IDT+ D +V+  EL  WI    R    E+     ++ D++ D  + W EY + TYG + + E  ++      + + +   ++ D+++F++AD++ D +    EF  F HP  +  M    +++T+ED DKN DG ++L+E++GD    ++ E        EKK F+E+ D +K+G L  SE+  W++PG    A  E +HL +ETD + D  ++K+EI+    ++VGS AT+YG+ L
Sbjct:    4 LLLSLIVGVTVAVPPQ-EKRVHHQRDLSDHAHDDA---HSFQYDHEAFLGKE-EAKTFDQLTPEESKAKLGKIVDRIDTDKDGFVSHAELHHWIKHRQRRYIEENVDKHWKEYDQDKDGKIAWTEYKNTTYGFYLDDEFSDV-----ENRESYKAMLMRDERRFKVADKDGDGIASREEFTAFLHPEEFSYMKDLVVQETVEDIDKNGDGKINLEEYIGDMYTSEDGENEPEWVNTEKKQFSEFRDVNKDGFLDASEVAQWILPGDVDHADIEAKHLIHETDRDNDDKMTKKEILENWNMFVGSQATNYGEDL 306          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: rcn1 (reticulocalbin 1 [Source:NCBI gene;Acc:103039743])

HSP 1 Score: 146.747 bits (369), Expect = 1.616e-40
Identity = 101/316 (31.96%), Postives = 163/316 (51.58%), Query Frame = 1
Query:  130 ISLTIILLFG--ISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD----EKMDKETE--EHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            + L ++ LF   +    T + E   H    S P    D+S      +DH+A  G   +++ F  L P E++ RLG +VD+ID + + Y+   EL  WI +  +    E+      D D N D  ++W EY   TYG+     +E     +TD   F + +  D+++F+LAD + D   +  EF  F HP  +  M    + +T+ED DKN DG VD  E++ D    E+   E +  + E+  F+++ D +K+G +   EI  W++P     A +E  HL  E+D +KD+ L+KEEI+    ++VGS AT+YG+ L
Sbjct:    6 VLLAVLSLFACPVWGKPTLRKERVIHDPQPSRPPPEEDQS----HRYDHEAFLGKE-DAKTFDQLSPAESRDRLGKIVDRIDADGNGYITTEELKAWIKRVQKRYVYENVAKVWSDYDLNKDNKISWDEYKQATYGYYLANPEEF--EDATDQFSFKKMLPRDERRFKLADLDGDLAAEREEFTAFLHPEEFDHMKEIVVLETMEDIDKNGDGHVDEDEYIADMFAHEEGGPEPDWVKTERDQFSDFRDLNKDGKMDLEEIRHWILPQDYDHAQAEARHLLLESDTDKDQMLTKEEILENWNMFVGSQATNYGEDL 314          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: rcn2 (reticulocalbin 2 [Source:NCBI gene;Acc:103045530])

HSP 1 Score: 138.658 bits (348), Expect = 1.171e-37
Identity = 96/297 (32.32%), Postives = 153/297 (51.52%), Query Frame = 1
Query:  205 ADSSTPHEHYDKSGHHDETFDHDAVTGSHHE-SEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDK-----ETEEHEKKSFAE-YDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDMKPHEE 1074
            A S T H+H   S HH     H++      E  +E K L P E + ++  +V +IDT+ D ++   E+  WI + ++   ++DA  +    D N+D ++TW EY    +GH+  E+DE       + +      L +K++F  AD +  S L+V EF  F+HP     MS F +E  L ++D +KDG + L EF+GD +  +     + E  E   F + YD++K+G L   E   WV P    +A  E  HL  E D + D+ LS+ EI+   ++++ S  TDYG+ L    PH+E
Sbjct:   12 ALSCTAHQHL--SEHH---IQHNSNAFLDDEDKDEIKKLSPSEQRGKMVEIVKRIDTDSDKFLTPEEITVWIQRVYKRYAMDDAQERFPGFDINSDGLVTWDEYNMVMHGHT-VEVDENAVLEDPEEESLRFLHLKEKRRFDFADTDGTSGLNVTEFLAFTHPSEVDHMSDFAIEDVLSEYDLDKDGFISLSEFIGDLRASESDEPSQWEAEETVRFKDLYDQNKDGKLNRDEQLRWVAPNSYGSAREEAVHLIKEMDQDGDERLSETEILKNQDIFMNSEVTDYGRQL--HVPHDE 300          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 150.214 bits (378), Expect = 1.972e-43
Identity = 89/241 (36.93%), Postives = 138/241 (57.26%), Query Frame = 1
Query:  349 LLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETE------EHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            ++V +ID N D  V +TEL +WI  + R   LE+A  +    D + D  + WAEY + TY +  +E  E       D  G+   VL D+++FQ AD + D      E+A F HP  +P M    + +T+ED DKN DG +++ E++GD   ++  E      E E+K FAE  D D +GL+   E+  W++P     A +E +HL +E D ++D NL++EEII +++L+VGS ATD+G+ L
Sbjct:    1 MIVTRIDENGDGLVTETELTEWIRHAQRRWVLEEAERQWSSHDLDGDGYVNWAEYKNATYSYLAEEDPE-------DPDGYRAMVLRDERRFQAADVDGDGRASRNEYAAFLHPEEHPHMRNLVVTETIEDIDKNGDGFINVDEYIGDMYSEESEEGDSEWVESERKQFAELRDTDGDGLMGHDEVAAWILPDDYDQAEAESKHLIHECDDDQDGNLTREEIIAKYDLFVGSQATDFGEAL 234          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 152.525 bits (384), Expect = 2.355e-43
Identity = 102/323 (31.58%), Postives = 165/323 (51.08%), Query Frame = 1
Query:  118 KITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDET---FDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLM--DKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD------EKMDKETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            K+  ++L   L     ++E +         +   P E   +  H DE    +DH+A  G+   ++ F  L PEE+K RLG +V+KID++ D  V Q E+  WI  + R    ED   +    D + D  ++W EY + TYG         +     +  GF    ++  D+++F+ AD + D      EF  F HP  +  M    + +T+ED DKN DG +DL E++GD      E  + E  + E++ F ++ D +K+G +   E   W++P     A +E  HL  E+D +KD  LSKEEI+++H+L+VGS AT++G+ L
Sbjct:    7 KVAFVALCAWLALAKPTAEKK---------NRVHPDEPLSEKKHDDEQSFDYDHEAFLGAE-TAKTFDQLSPEESKERLGKIVEKIDSDGDGLVTQDEMTMWIKHTQRRWVYEDVDRQWTGHDIDGDGSVSWEEYRNATYG--------FLAVSPIEEDGFNYKQMLGRDERRFKAADVDGDGQASKEEFTAFLHPEEFEHMKDIIVTETMEDIDKNGDGFIDLNEYIGDMYNQAGESEEPEWVKTERQQFTDFRDTNKDGKMDKEETMAWILPSDYDHAEAEARHLIYESDSDKDGKLSKEEILDKHDLFVGSQATNFGEAL 311          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: rcn2 (reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-62])

HSP 1 Score: 107.457 bits (267), Expect = 1.535e-27
Identity = 75/230 (32.61%), Postives = 109/230 (47.39%), Query Frame = 1
Query:  421 QSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTY----GHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEHEK--------KSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDMKPHEE 1074
            QSFR    E+      +VD + D +++W EY    Y    G    E        +  M+ +      +KKKF  AD +    L++ EF  F HP  +  M    LE+ L + DK+ DG VDL EF+GD   D  T + +         K  +E+D D +G L  SE+  W+MP   + A  E EHL    D + D  LS +E++   EL++ S  TDYG+ L +   H E
Sbjct:    2 QSFRRYATEETRAFFPEVDRDGDGVVSWDEYRQHEYESLPGGDGGEAAAAAAQVAHRMQLYAR----EKKKFGKADSDGVQGLNITEFLAFEHPEEFDYMQDSVLEEALLEHDKDGDGFVDLAEFLGDYHRDPSTPQSDPEWVITETDKFTSEFDIDHDGKLNPSELLSWLMPNNLEVAEDETEHLLEHMDTDGDGQLSHDEVVQNKELFLTSEVTDYGRQLGEQYAHHE 227          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: rcn2 (reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-62])

HSP 1 Score: 100.523 bits (249), Expect = 9.137e-25
Identity = 72/241 (29.88%), Postives = 108/241 (44.81%), Query Frame = 1
Query:  421 QSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTY--------------GHSEKEIDEMIKTGSTDMKGFIEGVLM-DKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEHEK--------KSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDMKPHEE 1074
            QSFR    E+      +VD + D +++W EY    Y                              + +  ++ +   +KKKF  AD +    L++ EF  F HP  +  M    LE+ L + DK+ DG VDL EF+GD   D  T + +         K  +E+D D +G L  SE+  W+MP   + A  E EHL    D + D  LS +E++   EL++ S  TDYG+ L +   H E
Sbjct:    2 QSFRRYATEETRAFFPEVDRDGDGVVSWDEYRQHEYESLPGGDGGEAAAAAGGGGGDGGGGDDEEEEERSSLQSLYAREKKKFGKADSDGVQGLNITEFLAFEHPEEFDYMQDSVLEEALLEHDKDGDGFVDLAEFLGDYHRDPSTPQSDPEWVITETDKFTSEFDIDHDGKLNPSELLSWLMPNNLEVAEDETEHLLEHMDTDGDGQLSHDEVVQNKELFLTSEVTDYGRQLGEQYAHHE 242          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: sdf4 (stromal cell derived factor 4 [Source:NCBI gene;Acc:406360])

HSP 1 Score: 82.4185 bits (202), Expect = 3.474e-18
Identity = 69/259 (26.64%), Postives = 123/259 (47.49%), Query Frame = 1
Query:  340 RLGLLVDKIDTNHDSYVNQTELFKWIMQSFR---NLDLEDATTKMQDVDENNDKMLTWAEY-----VSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKK---FQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVG----------DEKMDKETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            RL   + ++D + D  ++  EL +WI++  R      L++     + +D + D ++TW EY     VSK  G  EK+I E I+             LMD  K    Q  D   D  L+  EF  F HP +   M ++ +++ + D D++KD  + L EF            ++ +D +     +K F E  D +K+G +  SE+ +++ P     A+SE + + +  D ++D  LS +E++   E + GS   DY +++
Sbjct:    1 RLCASLVRVDKDRDKRISAVELQEWIVEKTREHLQQALDENKPHFRTLDPDGDGLVTWDEYRLRYLVSK--GFDEKDIAERIRDKQELKIDEETEELMDNLKERWNQADDAPQDQKLNEKEFLSFQHPEHSRSMLSYMVQEIIHDLDQDKDQRLSLSEFASLPLGTVENQKEQDIDDDWVRERRKEFIEVIDSNKDGFITRSELEEYMDPTSSHNALSEAKQMISVADEDEDAQLSLDEVLRYSEYFTGSKLVDYARNV 257          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO35844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKE6])

HSP 1 Score: 174.481 bits (441), Expect = 1.486e-51
Identity = 119/324 (36.73%), Postives = 172/324 (53.09%), Query Frame = 1
Query:  130 ISLTIILLFGISSSETEQHESDDH---HADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD-EKMDKETEEHEK----KSFAEYDKDKNGLLQGSEITDWVMPGFEK-TAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDMKPHEE 1074
            ++   ++LF + +      ESD     H D  +  EH+DK G H+  +DH+A  G+  E EEF  L PEEAK+RL  L+ ++D N D  V   EL  W+   F+   +E     +++ D N D  + W EY   TYG  + E DE       +MK F+     DK++F  AD N D  L   E A F HP + PEMS   + +T+ED D++KDG + LKEF+G+ E+   E  +  K    +   EYDK+K+G L   E+  W++P  +   A  E +HL +  D N D  L+ EEI   + ++VGS ATDYG+ L    P EE
Sbjct:    1 MATKFVVLFALLTVALGHAESDKRPKTHTDKLSEAEHFDKEGEHNPDYDHEAFLGT--EKEEFDHLPPEEAKKRLRALIREVDNNKDGAVTTEELTDWVKGVFKKRSMEGVDNDLKEKDANEDGKVDWNEYSKGTYG-DQTEDDE-------EMKEFLR---RDKRRFDAADTNKDGFLTREEMAIFLHPESSPEMSEVHILETIEDIDRDKDGLISLKEFLGEYEEEPGEVPDWVKDETNRFNEEYDKNKDGKLDKEEVRLWILPETDHLMAAEEAKHLVSSADDNSDGKLTIEEIEKNYAVFVGSEATDYGRAL----PKEE 307          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO32638 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUH8])

HSP 1 Score: 160.614 bits (405), Expect = 4.509e-46
Identity = 115/298 (38.59%), Postives = 158/298 (53.02%), Query Frame = 1
Query:  250 HDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLED-------------ATTKMQD-VDENNDKM---LTWAEYVSKTYG------HSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD-----EKMDKETE--EHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            H+  +DH+A  G   E + F  L PEE+K RLG LVDKID +HD  V + EL +WI +S +    ED             A  KM D VD     M   + W EY + TYG       SE   D MIK               D+++++ AD N D  L   E+  F HP  Y  M    +E+TL+D DKNKDG V L+E++GD     EK D+E +  + E++ F    DK+++G +   E+ DW++P       +EV HL NE DVNKD  L+K EII++HE++ GS ATD+G  L
Sbjct:   45 HNTEYDHEAFLGD--EKKTFDQLSPEESKERLGKLVDKIDVDHDGKVTEEELKQWIKKSAKRYVYEDVDRQWDHLKKIEHAKIKMDDLVDGKRVDMAAPIGWEEYKNNTYGFIKEDDKSEYNYDNMIKR--------------DRRRWEKADINRDDKLSKEEYTAFLHPEEYEYMKDVVVEETLDDIDKNKDGYVSLEEYLGDLYPESEKEDEEPDWVKTEREQFLTVRDKNRDGKMDKDEVRDWIVPADFDHVGAEVTHLINEADVNKDGYLTKSEIIDKHEVFAGSQATDFGDAL 326          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO42789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S7])

HSP 1 Score: 149.058 bits (375), Expect = 2.319e-42
Identity = 94/266 (35.34%), Postives = 154/266 (57.89%), Query Frame = 1
Query:  265 DHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLE-DATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEHEKKSFAE-YDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDD 1056
            DH A  G    ++EF++L PEEA+RRL +LV +ID N D +V + EL  WI    +  ++E D     +D+D NND   TW E++ +TYG ++++I++  K    ++K +IE    D++K++ AD++ DS L   E+  F HP  +  M  +   K + + DK+KDG + L+E++   +M  +    +K+ F E +D++K+G L   E+ DW  P     A+ E +HL    D+N D  LS +EI+  HE + GS+AT +G+   D
Sbjct:    7 DHVAFLGEEM-AKEFENLSPEEARRRLRMLVPRIDINKDGFVEEAELEIWIRHKMKKWEVEEDVDAIFRDMDFNNDNHATWKEFMMRTYGFTDEDINK--KWERNNLKDYIED---DRRKWKYADQDKDSRLTREEYEYFHHPKEHEVMIPYIAMKVMLEGDKDKDGFLSLQEYLDWLEM-PDFHIMDKRDFEEKHDQNKDGKLDLKEVEDWRRPKNFNKALEEAQHLIEHADLNGDGKLSADEIVTSHEFFAGSYATQFGQTFHD 265          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO47673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLD6])

HSP 1 Score: 134.806 bits (338), Expect = 9.159e-37
Identity = 92/296 (31.08%), Postives = 154/296 (52.03%), Query Frame = 1
Query:  226 EHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDA-------------TTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEE------HEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLD 1053
            EH+ K+G H+  +DHDA  G   + +EF  L P+E+KRRLGL+VD+ID + D  +  TE+ +WI  +      +D                K ++   N D  + W  Y    +G +  + +E             +    D+K++++ADRN D+ L   EF    HP  +  M    L++++ D D N+DG +  +EF+G    +K TEE        ++ F E+ D +K+G L   E+ D++ P ++    +E +HL NE D N+D  L+K+EI++  E +VGS A ++G+ L+
Sbjct:   13 EHFSKTGVHNPEYDHDAFLG--QDKKEFDSLTPQESKRRLGLIVDRIDKDQDGRITYTEMKEWINYAGNRYAFDDGDRLWKAIKKREEQIAKKENKSFNPDAPIDWDLYKEDAFGKTITDANE-------------KRYQRDRKQWEVADRNKDTKLSKEEFPALFHPSVFDYMQDLVLDESMLDIDTNRDGYISQEEFLGKATEEKGTEEEKEMIARRRQEFLEHRDTNKDGRLDRRELKDYLFPAYDHVG-AEAQHLINEVDKNEDGMLTKDEIMDNFEKFVGSRAAEFGQALN 292          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO31169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYP9])

HSP 1 Score: 134.035 bits (336), Expect = 1.015e-36
Identity = 87/272 (31.99%), Postives = 145/272 (53.31%), Query Frame = 1
Query:  262 FDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTY-GHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEHEKKSFA--------EYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            +DHDA  G   ++ EF +L P++ K+RL  L  KID + D  ++  EL +WI  + +    + + ++M+ +D+N D  ++W EYV+  Y   +EK +    K    +MK        D+K+++ AD +ND++L + E   F HP   P M++  +++ +E  D +KDG +   E+ G   +     E  + S          + DKDK+G L   E+  W+ P    ++  E EHL  E D NKD  L+ +EI+ ++EL+ GS AT+YG  L
Sbjct:    2 YDHDAFLG-EDQAAEFDELTPKQTKQRLRELFPKIDVDQDQKISLKELVEWIDVNMKKHTRKSSESRMEQMDKNKDGKVSWEEYVNVEYDPKNEKGMSNENKDHLKEMKK------RDEKRWKHADMDNDNLLTIDELQMFIHPEETPRMTSVLVQENMEMLDSDKDGKISFAEYAGKLSVMWRMREDNQDSLKSLKDDFNNDLDKDKDGSLNKEELKSWIFPSGSPSS-GEAEHLMTEVDKNKDNFLTVDEIMERYELFAGSRATNYGNML 265          
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Match: calub (calumenin [Source:NCBI gene;Acc:101165303])

HSP 1 Score: 176.022 bits (445), Expect = 1.134e-51
Identity = 109/323 (33.75%), Postives = 181/323 (56.04%), Query Frame = 1
Query:  103 MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD------EKMDKETEEHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            M ++  + C +L ++     +S  TE+   D  H D    +  +D + + D  +DH+A  G   E++ F  L PEE+K RLG+LVD+ID + D YV   E+ +WI  + +    +D   + +  D N D  ++W EY + TYG+   + D        D   + + +  D+++F++AD++ND   +  EF  F HP  Y  M    + +T+ED DKN DG +DL E++GD      E  + E  + E++ F E+ DK+K+G +   E  DW++P     A +E +HL  E+DV+KD  L+K EI+++++L+VGS ATD+G+ L
Sbjct:    4 MELRPLVMCFALCVVY---ATSKPTEK--KDRVHHDEPLSNLEHDDADNFD--YDHEAFLG-QEEAKSFDQLTPEESKERLGMLVDRIDEDKDGYVTAEEMKRWIKDAQKRWIYDDVDRQWKSHDLNGDGFVSWEEYKNATYGYVLDDQD------PDDGFSYKQMMARDERRFKMADQDNDMKANKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLDEYIGDMYNQDGETTEPEWVKTEREQFTEFRDKNKDGKMDKEETKDWILPSDYDHAEAEAKHLVYESDVDKDGRLTKAEIVDKYDLFVGSQATDFGEAL 312          
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Match: rcn3 (reticulocalbin-1 [Source:NCBI gene;Acc:101175408])

HSP 1 Score: 174.481 bits (441), Expect = 4.176e-51
Identity = 109/320 (34.06%), Postives = 174/320 (54.37%), Query Frame = 1
Query:  136 LTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD--EKMDKETEE----HEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDDMKPHEE 1074
            L  + +   ++      E   HH    + H H D  G+    +DH+A  G   E++ F  L PEE+K RL  +V++IDT+ D +++  EL  WI    R    ++     +D D+N D  + W EY + TYG+   E  + ++  +T    +   +  D+++F+ ADR+ D +    EF  F HP  +  M    +++TLED DKNKDG +D+ E++GD     D ETE      EKK F+E+ D +K+G L   E+  W++PG    A +E +HL +ETD +KD  ++K+EI+    ++VGS AT+YG+ L   K H+E
Sbjct:    8 LAFLCILAATAVSVPPQEKRVHHQPDLSSHVHDDAHGYQ---YDHEAFLGKE-EAKTFDQLTPEESKARLAKIVERIDTDKDGFISHAELHHWIKHRQRRYIEDNVNKHWKDYDKNRDDQIAWEEYKNTTYGYYLGEDFDDVEDKAT----YKSMLARDERRFRAADRDADGIATRSEFTAFLHPEEFDHMKDVVVQETLEDIDKNKDGKIDINEYIGDMFTPEDGETEPDWVHTEKKHFSEFRDSNKDGYLDAGEVAHWILPGEVDHADNEAKHLIHETDTDKDGKVTKKEILANWNMFVGSQATNYGEDL--TKKHDE 317          
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Match: rcn1 (reticulocalbin 1 [Source:NCBI gene;Acc:101175141])

HSP 1 Score: 147.132 bits (370), Expect = 2.064e-40
Identity = 94/270 (34.81%), Postives = 147/270 (54.44%), Query Frame = 1
Query:  262 FDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGD----EKMDKETE--EHEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            +DH+A  G   E++ F  L PEE++ RLG +V++ID + D Y+   EL  WI +  +    E+      D D N D  ++W EY   TYG+     +E       D   F + +  D+++F+ AD N D+  D  EF  F HP  +  M    +++TLED DKN DG VD  E++ D    E    E +  + E++ F+++ D +K+G +   EI  W+MP     A +E  HL  E+D +KD+ L+K+EI+    ++VGS AT+YG+ L
Sbjct:   79 YDHEAFLGKE-EAKTFDQLTPEESRDRLGKIVERIDGDGDGYITTAELKDWIKRVQKRYVYENVAKVWTDYDLNKDNRISWDEYKQATYGYYLANPEEF--QDDKDQFSFKKMLPRDERRFKAADLNGDNTADKEEFTSFLHPEEFDHMKDIVVQETLEDIDKNGDGYVDEDEYIADMFSHEDGGPEPDWVKTEREQFSDFRDLNKDGKMDKDEIRHWIMPQDYDHAQAEARHLVYESDQDKDQKLTKDEILENWNMFVGSQATNYGEDL 345          
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Match: pstpip1a (proline-serine-threonine phosphatase-interacting protein 1 [Source:NCBI gene;Acc:101156493])

HSP 1 Score: 144.05 bits (362), Expect = 1.271e-39
Identity = 104/322 (32.30%), Postives = 153/322 (47.52%), Query Frame = 1
Query:  106 IIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHD-AVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEK-EIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKET----EEHEKKSFAE-YDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHL 1050
            ++K     + L +   FG SS    +H  D  + D   P              DHD AV      +EE K L PEE + +L  +V KIDTN D+ +   E+  WI   +R   LEDA  +  + D N D +LTW EY   T  H +    DE       +     +  L +KK+F  AD ++   L V EF  F+HP     M+ F ++  L ++D +KDG + L EF+GD + +  +    E  E   F E YD+DK+G L   E   W+ P    +A  E  HL NE D + D+ +S  E++   + ++ S  TDYG+ L
Sbjct:    1 MMKRVAVFVWLVVQFGFGFSS---HKHLQDHFNGDQHNP--------------DHDMAVLLGDETTEEIKKLTPEEQREKLLEIVKKIDTNGDNLLGAEEITLWIQHVYRKYALEDAEERFPEFDLNKDGVLTWEEY--NTVAHDQLFTFDESTVLEDPEQDSLRQLHLKEKKRFDFADIDDTPGLSVSEFLAFTHPSEVDRMADFTIQDVLTEYDTDKDGFISLSEFIGDVRGEDNSPSKWEIEETVRFKELYDQDKDGNLNRDEQLRWIAPNSYGSAREEALHLINEMDQDGDEQISVAEVLKNQDTFMNSEVTDYGRQL 303          
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Match: pstpip1a (proline-serine-threonine phosphatase-interacting protein 1 [Source:NCBI gene;Acc:101156493])

HSP 1 Score: 114.39 bits (285), Expect = 3.176e-27
Identity = 88/273 (32.23%), Postives = 127/273 (46.52%), Query Frame = 1
Query:  106 IIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHD-AVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEK-EIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKET----EEHEKKSFAE-YDKDKNGLLQGSEITDWVMP 903
            ++K     + L +   FG SS    +H  D  + D   P              DHD AV      +EE K L PEE + +L  +V KIDTN D+ +   E+  WI   +R   LEDA  +  + D N D +LTW EY   T  H +    DE       +     +  L +KK+F  AD ++   L V EF  F+HP     M+ F ++  L ++D +KDG + L EF+GD + +  +    E  E   F E YD+DK+G L   E   W+ P
Sbjct:    1 MMKRVAVFVWLVVQFGFGFSS---HKHLQDHFNGDQHNP--------------DHDMAVLLGDETTEEIKKLTPEEQREKLLEIVKKIDTNGDNLLGAEEITLWIQHVYRKYALEDAEERFPEFDLNKDGVLTWEEY--NTVAHDQLFTFDESTVLEDPEQDSLRQLHLKEKKRFDFADIDDTPGLSVSEFLAFTHPSEVDRMADFTIQDVLTEYDTDKDGFISLSEFIGDVRGEDNSPSKWEIEETVRFKELYDQDKDGNLNRDEQLRWIAP 254          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000054251.1 (SMESG000054251.1)

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 294/297 (98.99%), Postives = 295/297 (99.33%), Query Frame = 1
Query:  103 MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEHEKKSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEI 993
            M IKTKITCISLTIILLFGI+SSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFV DEKMDKETEEHEKKSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEI
Sbjct:    1 MSIKTKITCISLTIILLFGIASSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVVDEKMDKETEEHEKKSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEI 297          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000028234.1 (SMESG000028234.1)

HSP 1 Score: 145.976 bits (367), Expect = 1.103e-40
Identity = 93/283 (32.86%), Postives = 155/283 (54.77%), Query Frame = 1
Query:  238 KSGHHDETFDHDAVTGSHHESEEFKD--LEPEEA----KRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFV----GDEKMDKETEEHEKKSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDD 1056
            K   +D+ + HD       +SE+ KD  +  EE+    K+ LG L  KID N D +V + EL +WI+Q    + + +A  +++ +D+NND  +TW E++ + YG+     D++    +++    I+    DK +F +AD + +  L + E   F  PHN+ EM  +E+ + L ++DKNKD  +D  EF+    G  K+  + + +  K F +YD D N  L  +E+  W+ P   + A +E ++L N +D+NKD+ LSKEEI+     WV S AT++G    D
Sbjct:   17 KISENDQLYPHDV------QSEQIKDADMMIEESSNHTKQGLGKLFHKIDANQDLFVTKDELIRWIVQYNEEILMREAKFELKRIDKNNDNFVTWEEFMKEHYGNLSLNEDKV----NSEHNEIIQFFKDDKYRFTIADADKNERLSIEELKAFLRPHNHVEMLDYEVYRALIEYDKNKDKVIDRTEFIQTQYGSNKLTLQQKSYVNKVFDKYDTDHNNQLSENEMKVWLKPDIIQFAQTESQYLLNVSDLNKDEKLSKEEILENFGHWVSSKATNFGADFKD 289          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000028234.1 (SMESG000028234.1)

HSP 1 Score: 145.976 bits (367), Expect = 1.454e-40
Identity = 93/283 (32.86%), Postives = 155/283 (54.77%), Query Frame = 1
Query:  238 KSGHHDETFDHDAVTGSHHESEEFKD--LEPEEA----KRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFV----GDEKMDKETEEHEKKSFAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYGKHLDD 1056
            K   +D+ + HD       +SE+ KD  +  EE+    K+ LG L  KID N D +V + EL +WI+Q    + + +A  +++ +D+NND  +TW E++ + YG+     D++    +++    I+    DK +F +AD + +  L + E   F  PHN+ EM  +E+ + L ++DKNKD  +D  EF+    G  K+  + + +  K F +YD D N  L  +E+  W+ P   + A +E ++L N +D+NKD+ LSKEEI+     WV S AT++G    D
Sbjct:   27 KISENDQLYPHDV------QSEQIKDADMMIEESSNHTKQGLGKLFHKIDANQDLFVTKDELIRWIVQYNEEILMREAKFELKRIDKNNDNFVTWEEFMKEHYGNLSLNEDKV----NSEHNEIIQFFKDDKYRFTIADADKNERLSIEELKAFLRPHNHVEMLDYEVYRALIEYDKNKDKVIDRTEFIQTQYGSNKLTLQQKSYVNKVFDKYDTDHNNQLSENEMKVWLKPDIIQFAQTESQYLLNVSDLNKDEKLSKEEILENFGHWVSSKATNFGADFKD 299          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000076911.1 (SMESG000076911.1)

HSP 1 Score: 139.428 bits (350), Expect = 5.928e-38
Identity = 105/322 (32.61%), Postives = 166/322 (51.55%), Query Frame = 1
Query:  100 IMIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHHDETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLV-DKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENN-DKMLTWAEYVSKTYGHSEKEI-DEMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEE----HEKKSFAEY-DKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATDYG 1041
            + +I  KI    L  +++  + S   +   S + H   S P         HD + DH +  G+  ES+ F  L PEE+K RL  L+ +K+DT+ D +V   EL  W M +   L  E    K+     N+ D ++ + EY    YG  + ++ D++ K     MK        D +K++LAD N D  LD  EF  F HP +YP+M +  +++T+E  DKN+DG +DL E++ D   +   EE     E+ +F  + DK+++  L  +E+ +W+MP       +E +HL +  D N+D  LS EEII  ++ +VGS  TDYG
Sbjct:    1 MQLIIAKILSSVLIFVIILSVDSHRIKDVNSIEEHL--SNPE--------HDTSIDHKSFLGTE-ESKTFDKLLPEESKSRLKKLISEKVDTDKDGFVTVQELELW-MITVAKLSKERERDKLFPFFSNSIDALMDYEEYSQGIYGGLQADLLDDVSKANLMIMKQ------QDDRKWKLADENQDGKLDRNEFLMFQHPEDYPKMKSIVIQETMEVSDKNQDGFLDLNEYISDIWPNNRPEESLLKQEEDTFYNHRDKNQDKKLDETEVGEWLMPTGYDPIDAETKHLMHIADTNEDDQLSMEEIITHYDTFVGSQVTDYG 304          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000034805.1 (SMESG000034805.1)

HSP 1 Score: 133.65 bits (335), Expect = 1.581e-35
Identity = 101/355 (28.45%), Postives = 174/355 (49.01%), Query Frame = 1
Query:  103 MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSST-----------------------PHEHYDKSGHH-DETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTELFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEIDEMIKTG-STDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYPEMSTFELEKTLEDFDKNKDGGVDLKEFVG---DEKMDKETEEHEKKS-----FAEYDKDKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQHELWVGSHATD----YGKHLDD 1056
            M  K  I  + L ++ +  I  S+ +     DHH   S                        PHE +D   H  D  +D D VTG+ H ++  K    E+ K  +  +  K+D N+D+ +++ EL  +I+ + + L  E  + + ++VD+N+D+ ++  EY    +  + + ++ + ++  S+  + F + +  ++++F+ AD ++D  L+V E+    +P  YP M+   + + +EDFD N DG V   E++    D   DK+  E E K      F +YDKDKNG +   E    + PG+E  A  EV+HLF ETD NKD  ++ +E+ +   LW+G    D    Y  H DD
Sbjct:    1 MNPKCFILSLMLFVMFIAQIKCSDPDHDTDQDHHESESVEHGDDFHHDDSHHDDPSHGDDYEPHE-FDYDPHQTDSDYDEDLVTGTSHHAKRTK----EQTKTEIDEIFKKVDKNNDTKIDRDELTLYIIDNMKKLHTEITSDEFKEVDKNSDQKVSLDEYFLHKHQKTSEALENLTRSANSSKTQDFAKKIQHERERFKAADSDSDGFLNVHEYLLMLYPVFYPHMAHTIVHEYIEDFDTNNDGLVGKDEYIKHFLDIAADKKISEEEVKKKREAEFDKYDKDKNGKIDPEEYYAILKPGYENPAKEEVDHLFKETDTNKDGIITLDEVESHAHLWLGGEPLDEDSEYSHHYDD 350          
The following BLAST results are available for this feature:
BLAST of Reticulocalbin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CALU3.936e-5234.05calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU4.421e-5134.06calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU2.629e-4934.05calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU2.677e-4834.06calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
RCN22.434e-4535.09reticulocalbin 2 [Source:HGNC Symbol;Acc:HGNC:9935... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calu-14.453e-3931.71CALUmenin (Calcium-binding protein) homolog [Sour... [more]
calu-14.453e-3931.71CALUmenin (Calcium-binding protein) homolog [Sour... [more]
calu-21.254e-3132.10CALUmenin (Calcium-binding protein) homolog [Sour... [more]
cmd-13.155e-627.61Calmodulin [Source:UniProtKB/Swiss-Prot;Acc:O1630... [more]
K03A1.47.773e-627.01pep chromosome:WBcel235:X:7296098:7298741:-1 gene:... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG316501.452e-5637.46gene:FBgn0031673 transcript:FBtr0301907[more]
CG316501.452e-5637.46gene:FBgn0031673 transcript:FBtr0301905[more]
CG316501.452e-5637.46gene:FBgn0031673 transcript:FBtr0079033[more]
CG316501.452e-5637.46gene:FBgn0031673 transcript:FBtr0079034[more]
CG316501.452e-5637.46gene:FBgn0031673 transcript:FBtr0301906[more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calua1.484e-5635.29calumenin a [Source:NCBI gene;Acc:415241][more]
calua1.484e-5635.29calumenin a [Source:NCBI gene;Acc:415241][more]
rcn35.856e-5036.09reticulocalbin 3, EF-hand calcium binding domain [... [more]
rcn35.856e-5036.09reticulocalbin 3, EF-hand calcium binding domain [... [more]
calub9.583e-5033.97calumenin b [Source:NCBI gene;Acc:394057][more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rcn33.278e-5232.70reticulocalbin 3 [Source:NCBI gene;Acc:395023][more]
rcn31.178e-4833.02reticulocalbin 3 [Source:NCBI gene;Acc:395023][more]
calu4.720e-4735.56calumenin [Source:NCBI gene;Acc:407965][more]
calu7.352e-4736.30calumenin [Source:NCBI gene;Acc:407965][more]
rcn24.841e-4435.42reticulocalbin 2 [Source:NCBI gene;Acc:733807][more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Calu5.439e-5133.44calumenin [Source:MGI Symbol;Acc:MGI:1097158][more]
Rcn26.747e-4936.21reticulocalbin 2 [Source:MGI Symbol;Acc:MGI:134976... [more]
Calu1.119e-4733.44calumenin [Source:MGI Symbol;Acc:MGI:1097158][more]
Rcn31.002e-4333.55reticulocalbin 3, EF-hand calcium binding domain [... [more]
Rcn31.002e-4333.55reticulocalbin 3, EF-hand calcium binding domain [... [more]
back to top
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B5X186|CALUA_SALSA3.333e-5837.46Calumenin-A OS=Salmo salar OX=8030 GN=calua PE=2 S... [more]
sp|Q6IQP3|CALUA_DANRE9.430e-5635.29Calumenin-A OS=Danio rerio OX=7955 GN=calua PE=2 S... [more]
sp|J3S9D9|RCN2V_CROAD3.324e-5136.96Reticulocalbin-2 OS=Crotalus adamanteus OX=8729 PE... [more]
sp|Q7SXV9|CALUB_DANRE1.315e-4933.97Calumenin-B OS=Danio rerio OX=7955 GN=calub PE=2 S... [more]
sp|Q3T0K1|CALU_BOVIN3.201e-4933.13Calumenin OS=Bos taurus OX=9913 GN=CALU PE=2 SV=1[more]
back to top
BLAST of Reticulocalbin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GP253.664e-10148.62Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4E0RT351.329e-8748.90Reticulocalbin-1 OS=Fasciola hepatica OX=6192 GN=D... [more]
A0A504YZD37.218e-8748.31Reticulocalbin-1 (Fragment) OS=Fasciola gigantica ... [more]
A0A4S2M7249.477e-8641.93Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2CL092.937e-8442.86Reticulocalbin-2 OS=Schistosoma japonicum OX=6182 ... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calua7.771e-5735.60calumenin [Source:NCBI gene;Acc:103043492][more]
calub4.137e-5136.45calumenin-B [Source:NCBI gene;Acc:103027690][more]
rcn39.181e-4832.91reticulocalbin 3 [Source:NCBI gene;Acc:103045651][more]
rcn11.616e-4031.96reticulocalbin 1 [Source:NCBI gene;Acc:103039743][more]
rcn21.171e-3732.32reticulocalbin 2 [Source:NCBI gene;Acc:103045530][more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CALU1.972e-4336.93calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU2.355e-4331.58calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
rcn21.535e-2732.61reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-... [more]
rcn29.137e-2529.88reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-... [more]
sdf43.474e-1826.64stromal cell derived factor 4 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO358441.486e-5136.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326384.509e-4638.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427892.319e-4235.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476739.159e-3731.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311691.015e-3631.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calub1.134e-5133.75calumenin [Source:NCBI gene;Acc:101165303][more]
rcn34.176e-5134.06reticulocalbin-1 [Source:NCBI gene;Acc:101175408][more]
rcn12.064e-4034.81reticulocalbin 1 [Source:NCBI gene;Acc:101175141][more]
pstpip1a1.271e-3932.30proline-serine-threonine phosphatase-interacting p... [more]
pstpip1a3.176e-2732.23proline-serine-threonine phosphatase-interacting p... [more]
back to top
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054251.10.000e+098.99SMESG000054251.1[more]
SMESG000028234.11.103e-4032.86SMESG000028234.1[more]
SMESG000028234.11.454e-4032.86SMESG000028234.1[more]
SMESG000076911.15.928e-3832.61SMESG000076911.1[more]
SMESG000034805.11.581e-3528.45SMESG000034805.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012371 ID=SMED30012371|Name=Reticulocalbin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1178bp
GGACAATGGAATAATGCCACGTAATTTTAATGATTAATATATACCAAAGA
AATTTGGATATTTAAAGGTAATTAATTATAAAAATATTTACGATTTTTAA
TCATGATTATTAAAACAAAAATTACTTGTATCAGTCTAACAATAATTTTA
TTATTTGGGATTTCGAGTTCGGAAACAGAACAGCACGAATCAGACGACCA
TCATGCAGACTCTTCAACTCCTCACGAACATTACGACAAATCAGGACATC
ACGATGAAACTTTTGATCATGATGCTGTAACAGGATCCCATCATGAATCA
GAAGAATTCAAAGATCTCGAACCGGAAGAAGCTAAACGACGATTGGGATT
GTTAGTGGATAAAATCGACACCAACCACGACTCTTATGTTAATCAAACCG
AATTGTTTAAATGGATCATGCAATCTTTCAGAAATCTTGATCTAGAAGAT
GCCACAACAAAAATGCAAGATGTTGATGAAAATAATGATAAAATGCTCAC
TTGGGCTGAATATGTATCTAAAACTTACGGTCACAGTGAAAAGGAAATTG
ATGAAATGATAAAAACAGGCAGTACTGATATGAAAGGATTTATTGAAGGT
GTTTTAATGGATAAGAAGAAATTCCAATTAGCTGATAGAAACAATGACAG
CATGTTGGATGTGCCAGAGTTTGCCAAATTCTCTCATCCCCATAATTATC
CGGAAATGTCAACTTTTGAACTCGAGAAGACATTAGAGGATTTCGATAAA
AACAAAGACGGCGGAGTTGATCTAAAAGAATTTGTTGGGGATGAAAAAAT
GGATAAAGAAACAGAAGAACACGAAAAGAAATCATTCGCAGAGTACGACA
AGGACAAAAATGGTCTGCTGCAAGGTTCAGAAATAACCGATTGGGTTATG
CCTGGTTTTGAAAAGACCGCGGTAAGCGAAGTGGAACATTTATTCAATGA
AACTGATGTCAATAAAGATAAAAATCTCAGTAAAGAAGAAATCATCAATC
AACACGAACTCTGGGTCGGCAGTCACGCTACTGACTACGGCAAGCATTTA
GATGACATGAAGCCGCATGAAGAGTTATAATCAAACTCTTTATTGTTTTT
ATTATTAGCTTATTGTGTTCTAAATGTTGCATATTTGCTTTTGTGTTGAA
CATTATGTTTTCATTAAATAAATGTTTT
back to top

protein sequence of SMED30012371-orf-1

>SMED30012371-orf-1 ID=SMED30012371-orf-1|Name=SMED30012371-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=326bp
MIIKTKITCISLTIILLFGISSSETEQHESDDHHADSSTPHEHYDKSGHH
DETFDHDAVTGSHHESEEFKDLEPEEAKRRLGLLVDKIDTNHDSYVNQTE
LFKWIMQSFRNLDLEDATTKMQDVDENNDKMLTWAEYVSKTYGHSEKEID
EMIKTGSTDMKGFIEGVLMDKKKFQLADRNNDSMLDVPEFAKFSHPHNYP
EMSTFELEKTLEDFDKNKDGGVDLKEFVGDEKMDKETEEHEKKSFAEYDK
DKNGLLQGSEITDWVMPGFEKTAVSEVEHLFNETDVNKDKNLSKEEIINQ
HELWVGSHATDYGKHLDDMKPHEEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000484secretory system
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding