Prominin (Prom) protein, putative

Overview
NameProminin (Prom) protein, putative
Smed IDSMED30012368
Length (bp)2691
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Prominin (Prom) protein, putative (SMED30012368) t-SNE clustered cells

Violin plots show distribution of expression levels for Prominin (Prom) protein, putative (SMED30012368) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Prominin (Prom) protein, putative (SMED30012368) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Prominin (Prom) protein, putative (SMED30012368) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012368

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30012368h1SMcG0005517 dd_Smed_v4_6506_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30012368h1SMcG0005517 dd_Smed_v4_6506_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012368h1SMcG0005517 dd_Smed_v4_6506_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012368h1SMcG0005517 dd_Smed_v4_6506_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012368h1SMcG0005517 dd_Smed_v4_6506_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012368h1SMcG0005517 dd_Smed_v4_6506_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012368h1SMcG0005517 dd_Smed_v4_6506_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012368h1SMcG0005517 dd_Smed_v4_6506_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012368h1SMcG0005517 dd_Smed_v4_6506_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Prominin (Prom) protein, putative vs. Ensembl Xenopus
Match: prom1 (prominin 1 [Source:NCBI gene;Acc:100036621])

HSP 1 Score: 57.3806 bits (137), Expect = 9.710e-8
Identity = 80/376 (21.28%), Postives = 144/376 (38.30%), Query Frame = 1
Query: 1411 GANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYXXXXXXXXXXXXXAKQPNYSTDGLMEGLFTQCQTKNFYSAFQRMTEKYNSLFFKSQFQS--------IDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKLLNDLKSAPVDLXXXXXXXXXXXXXXXXXRKIM--------------QTIFQSLTNIENHY----TKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVID--ILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGDGVKKNPANQGKPP 2454
            G NFL+  V  +F+ S ++M+ VL   L    V+   C  F     D                       N S     +G+FT  Q  N ++    + E  N   +  +  S        + ++I+ +   K NL  + +     D   FD  ++ V+       L    N+L+    DL  + +   ++  + + IR I               Q I ++    +       T  ++   + N+N   +IK +S  ++  +    +  +  +  ++   V+  +   NVID  +  F C  +VD VN  W+GLG   +L+IP++IFA+ L   YRR+       D P++  + G      G         +  PP
Sbjct:  478 GGNFLMAGVGFSFIFSWILMLIVLVTFLAGGNVEKLVCEPFQERALDT----------------------NISDCKENKGIFTALQIDNLFN----LNEFLNINMYIDEISSRIETLNLDLSNIILLDEKGKRNLEDFSSTG--IDEIDFDAFLSEVAKSNTKVDLLAFANELEEN-ADLLPKGALGNALKGHANSIRTIHIQQVVPLEQSMVKKQKILKACITFQGKVLDVITAVEAAQNLINNNASSVIKQESKKLMDEVIGYFIQYVQWVKDSIAFDVAGCKPVANVIDTAVDVFLCSYIVDSVNSFWFGLGGATVLLIPAIIFAIRLAKFYRRMDT----EDPPNFFLFTGGLHPPPGQKTPLTGLPRPPPP 820          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Xenopus
Match: prom1 (prominin 1 [Source:NCBI gene;Acc:100036621])

HSP 1 Score: 56.6102 bits (135), Expect = 1.703e-7
Identity = 88/372 (23.66%), Postives = 155/372 (41.67%), Query Frame = 1
Query: 1363 CGERPEEDASCFNRG----VGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYF----------TNSTKDNAPQNYXXXXXXXXXXXXXAKQPNYSTDGLMEGLFTQCQTKNFYSAFQRMTEKYNSLFFKSQFQS--------IDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKLLNDLKSAPVDLXXXXXXXXXXXXXXXXXRKI-----------MQTIFQSLT-------NIENHY----TKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVID--ILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRI 2340
            CG   ++  S   RG     G NFL+  V  +F+ S ++M+ VL   L    V+   C  F          T    ++  +NY     Y   S+ L  +  YS     +G+FT  Q  N ++    + E  N   +  +  S        + ++I+ +   K NL  + +     D   FD  ++ V+       L    N+L+    DL  + +   ++  + + IR I           M T+ QS+        +IE       T  ++   + N+N   +IK +S  ++  +    +  +  +  ++   V+  +   NVID  +  F C  +VD VN  W+GLG   +L+IP++IFA+ L   YRR+
Sbjct:  474 CGY--DQQTSPTTRGCISNTGGNFLMAGVGFSFIFSWILMLIVLVTFLAGGNVEKLVCEPFQERALFKVLDTPYLINSQWKNYLSGVLYQNPSVNLTFEKVYSDCKENKGIFTALQIDNLFN----LNEFLNINMYIDEISSRIETLNLDLSNIILLDEKGKRNLEDFSSTG--IDEIDFDAFLSEVAKSNTKVDLLAFANELEEN-ADLLPKGALGNALKGHANSIRTIHIQQVVPLEQSMTTLNQSIKLLQRTSFDIEGKVLDVITAVEAAQNLINNNASSVIKQESKKLMDEVIGYFIQYVQWVKDSIAFDVAGCKPVANVIDTAVDVFLCSYIVDSVNSFWFGLGGATVLLIPAIIFAIRLAKFYRRM 836          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Xenopus
Match: prom1 (prominin 1 [Source:NCBI gene;Acc:100036621])

HSP 1 Score: 55.8398 bits (133), Expect = 2.856e-7
Identity = 73/331 (22.05%), Postives = 135/331 (40.79%), Query Frame = 1
Query: 1411 GANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYXXXXXXXXXXXXXAKQPNYSTDGLMEGLFTQCQTKNFYSAFQRMTEKYNSLFFKSQFQS--------IDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKLLNDLKSAPVDLXXXXXXXXXXXXXXXXXRKI-----------MQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVID--ILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRI 2340
            G NFL+  V  +F+ S ++M+ VL   L    V+   C  F                       K+ +  N S     +G+FT  Q  N ++    + E  N   +  +  S        + ++I+ +   K NL  + +     D   FD  ++ V+       L    N+L+    DL  + +   ++  + + IR I           M+        + +  T  ++   + N+N   +IK +S  ++  +    +  +  +  ++   V+  +   NVID  +  F C  +VD VN  W+GLG   +L+IP++IFA+ L   YRR+
Sbjct:  471 GGNFLMAGVGFSFIFSWILMLIVLVTFLAGGNVEKLVCEPFQERA-----------------LFKVCRDTNISDCKENKGIFTALQIDNLFN----LNEFLNINMYIDEISSRIETLNLDLSNIILLDEKGKRNLEDFSSTG--IDEIDFDAFLSEVAKSNTKVDLLAFANELEEN-ADLLPKGALGNALKGHANSIRTIHIQQVVPLEQSMKACITFQGKVLDVITAVEAAQNLINNNASSVIKQESKKLMDEVIGYFIQYVQWVKDSIAFDVAGCKPVANVIDTAVDVFLCSYIVDSVNSFWFGLGGATVLLIPAIIFAIRLAKFYRRM 777          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Xenopus
Match: prom1 (prominin 1 [Source:NCBI gene;Acc:100036621])

HSP 1 Score: 54.6842 bits (130), Expect = 6.576e-7
Identity = 34/116 (29.31%), Postives = 60/116 (51.72%), Query Frame = 1
Query: 2032 TKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVID--ILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRI--QKFYPDRDE 2367
            T  ++   + N+N   +IK +S  ++  +    +  +  +  ++   V+  +   NVID  +  F C  +VD VN  W+GLG   +L+IP++IFA+ L   YRR+  +  Y D  E
Sbjct:  726 TAVEAAQNLINNNASSVIKQESKKLMDEVIGYFIQYVQWVKDSIAFDVAGCKPVANVIDTAVDVFLCSYIVDSVNSFWFGLGGATVLLIPAIIFAIRLAKFYRRMDTEDVYDDATE 841          
BLAST of Prominin (Prom) protein, putative vs. Ensembl Xenopus
Match: prom1 (prominin 1 [Source:NCBI gene;Acc:100036621])

HSP 1 Score: 54.299 bits (129), Expect = 9.347e-7
Identity = 31/105 (29.52%), Postives = 56/105 (53.33%), Query Frame = 1
Query: 2032 TKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVID--ILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRI 2340
            T  ++   + N+N   +IK +S  ++  +    +  +  +  ++   V+  +   NVID  +  F C  +VD VN  W+GLG   +L+IP++IFA+ L   YRR+
Sbjct:  707 TAVEAAQNLINNNASSVIKQESKKLMDEVIGYFIQYVQWVKDSIAFDVAGCKPVANVIDTAVDVFLCSYIVDSVNSFWFGLGGATVLLIPAIIFAIRLAKFYRRM 811          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A564YL07 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6965 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 6.052e-44
Identity = 211/843 (25.03%), Postives = 384/843 (45.55%), Query Frame = 1
Query:   61 KMFKIAVILSIFYISSITCISNSTFESMKQGISPFNRAGNIFFNLIRGDVDSSS--------INIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFXXXXXXXXXXVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAP--PSQIDNEHMQKTFKEL-ESAIKKFFDNLMNVSEVVNLIDQSKIVKQ-----AIGSKEISNFQNYMXXXXXXXXXXXDTLSQVKTNISTKL-SPCLSDQ---CRDMKDKIDS-LKVI-TVDESQLNKITDLLDSLNSTNFQERLNKVINLNAYGITDLKL----------VLDSEVKNFKN--------IINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKSIEKYRXXXXXXXXXXXXXXXXXXXXXXXXXNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYXXXXXXXXXXXXXAKQPNYSTDGLMEGLFTQCQTKNFYSAFQ------RMTEKYNSLFFKSQFQSIDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKL------LNDLKSAPVDLXXXXXXXXXXXXXXXXXR--KIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYAR---ADGDG 2418
            ++ KIA+ + +F +      + +T   +++ +        +F +LIRG+V   +        I++  +   T  + ++ K    Y+   I    G++FA+ +P++G+F C  RCCGRCGGR+ PMD K    ++V Y+I L  L  I + A+++   N QL +ES+ + DPSI        QFE      +   +E++ A    S +D    ++ F  + +  +  F  + ++ S    ++ + + ++Q     A GS++ ++ ++++  + K        L  +KTNIS  L + C  +Q   CR+++   D+ LKV  T+D+ Q   IT  L  L +       NKV  L+ +    LK+          +LD    +  N        + + Q F D+ K  L  L +  +N       ++  PL         FQ    +  Y  + +L L   I ++        +   CG+RP E+AS  NRGVGANFLL  +  TFL S+L+MI      L+  +VQT+ CRY T    D  P    + D  +       K    +       L T+C  ++   +         +++   + F +S  ++ + V   +L + L  T   T++   ++    +   S +L   +E L+++      +  L+S  ++   +   I     +   IR    ++ ++  L +I   Y +       F+S L   + +   I ++ +    L  + L     +  + C  + +   + +   C N ++P NG W+GLG+FL+L IP +IF + LV+LYR+ +K+ PD ++PDY +Y  FY R   ++GD 
Sbjct:    8 QLLKIAIFV-VFLLQIANANNTATTVQLRKSVQFSYDGAYLFLDLIRGNVSRRATGEMLEVIIDLKNHRYPTILLTAVFKHFPGYMGCLIF---GVLFAMLVPMVGIFFCCIRCCGRCGGRLTPMDRKADPYRRVCYTITLALLITIQLAAIVLCFINYQLYYESLTSKDPSIGAI----PQFEISSREFQNGMTEVLNAAKNSSSVDLVAQKQRFDAVFDVGLSDFQRDFVDNSSAAAVMKEKETLQQVVYRFAAGSRDSNSMKDFISLLKKVEM----ELPFIKTNISDILNTECTVNQLSACRELRFTTDNDLKVAYTMDQFQTKDITAFLQILENVQ-----NKVKELDEFDDPLLKMKENVKKAIQPILDDAWNDLSNSPKTREDLVKSLQGFADYIKSFLSGLDELLINYT-----SSEKPL---------FQGGNEVFLYSGFAFLCLPAFIILLFYLGLSFGV---CGDRPHEEASFCNRGVGANFLLSGIVFTFLFSTLLMIVCTVIFLSAGLVQTEVCRYVT----DRYPNGPAVFDDTVEAFFASLKSVGVANVRPFSTLLTRCANESLVDSLGDEAVGIMVSDNSINSFLESILRTFNGV---DLISPLRKTAVDTLNKLNEVRDLQRYDFSQALQKTSERLTEISDFEAYITQLESLDIENLKDPIMILKETVSSLTIRMDSPIRQLYADLQSIRGTYNQLAEELNSFSSELDRTVPTSIRIQIESMRPLFLKELRLAVIASWRDIPCTRLHSAATNAVDTVCHNFMNPPNGIWFGLGIFLVLCIPVLIFGVKLVNLYRKTEKYSPDYEQPDYISYHAFYMRPAASEGDA 809          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A564YL70 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6965 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 8.909e-44
Identity = 211/843 (25.03%), Postives = 384/843 (45.55%), Query Frame = 1
Query:   61 KMFKIAVILSIFYISSITCISNSTFESMKQGISPFNRAGNIFFNLIRGDVDSSS--------INIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFXXXXXXXXXXVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAP--PSQIDNEHMQKTFKEL-ESAIKKFFDNLMNVSEVVNLIDQSKIVKQ-----AIGSKEISNFQNYMXXXXXXXXXXXDTLSQVKTNISTKL-SPCLSDQ---CRDMKDKIDS-LKVI-TVDESQLNKITDLLDSLNSTNFQERLNKVINLNAYGITDLKL----------VLDSEVKNFKN--------IINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKSIEKYRXXXXXXXXXXXXXXXXXXXXXXXXXNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYXXXXXXXXXXXXXAKQPNYSTDGLMEGLFTQCQTKNFYSAFQ------RMTEKYNSLFFKSQFQSIDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKL------LNDLKSAPVDLXXXXXXXXXXXXXXXXXR--KIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYAR---ADGDG 2418
            ++ KIA+ + +F +      + +T   +++ +        +F +LIRG+V   +        I++  +   T  + ++ K    Y+   I    G++FA+ +P++G+F C  RCCGRCGGR+ PMD K    ++V Y+I L  L  I + A+++   N QL +ES+ + DPSI        QFE      +   +E++ A    S +D    ++ F  + +  +  F  + ++ S    ++ + + ++Q     A GS++ ++ ++++  + K        L  +KTNIS  L + C  +Q   CR+++   D+ LKV  T+D+ Q   IT  L  L +       NKV  L+ +    LK+          +LD    +  N        + + Q F D+ K  L  L +  +N       ++  PL         FQ    +  Y  + +L L   I ++        +   CG+RP E+AS  NRGVGANFLL  +  TFL S+L+MI      L+  +VQT+ CRY T    D  P    + D  +       K    +       L T+C  ++   +         +++   + F +S  ++ + V   +L + L  T   T++   ++    +   S +L   +E L+++      +  L+S  ++   +   I     +   IR    ++ ++  L +I   Y +       F+S L   + +   I ++ +    L  + L     +  + C  + +   + +   C N ++P NG W+GLG+FL+L IP +IF + LV+LYR+ +K+ PD ++PDY +Y  FY R   ++GD 
Sbjct:    8 QLLKIAIFV-VFLLQIANANNTATTVQLRKSVQFSYDGAYLFLDLIRGNVSRRATGEMLEVIIDLKNHRYPTILLTAVFKHFPGYMGCLIF---GVLFAMLVPMVGIFFCCIRCCGRCGGRLTPMDRKADPYRRVCYTITLALLITIQLAAIVLCFINYQLYYESLTSKDPSIGAI----PQFEISSREFQNGMTEVLNAAKNSSSVDLVAQKQRFDAVFDVGLSDFQRDFVDNSSAAAVMKEKETLQQVVYRFAAGSRDSNSMKDFISLLKKVEM----ELPFIKTNISDILNTECTVNQLSACRELRFTTDNDLKVAYTMDQFQTKDITAFLQILENVQ-----NKVKELDEFDDPLLKMKENVKKAIQPILDDAWNDLSNSPKTREDLVKSLQGFADYIKSFLSGLDELLINYT-----SSEKPL---------FQGGNEVFLYSGFAFLCLPAFIILLFYLGLSFGV---CGDRPHEEASFCNRGVGANFLLSGIVFTFLFSTLLMIVCTVIFLSAGLVQTEVCRYVT----DRYPNGPAVFDDTVEAFFASLKSVGVANVRPFSTLLTRCANESLVDSLGDEAVGIMVSDNSINSFLESILRTFNGV---DLISPLRKTAVDTLNKLNEVRDLQRYDFSQALQKTSERLTEISDFEAYITQLESLDIENLKDPIMILKETVSSLTIRMDSPIRQLYADLQSIRGTYNQLAEELNSFSSELDRTVPTSIRIQIESMRPLFLKELRLAVIASWRDIPCTRLHSAATNAVDTVCHNFMNPPNGIWFGLGIFLVLCIPVLIFGVKLVNLYRKTEKYSPDYEQPDYISYHAFYMRPAASEGDA 809          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A4Z2DIH5 (Prominin (Prom) isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_000597 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 4.959e-42
Identity = 205/826 (24.82%), Postives = 373/826 (45.16%), Query Frame = 1
Query:  178 NIFFNLIRGDVDSSS-----INIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFXXXXXXXXXXVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHMQKTFKELESAIKKFFDNLMNVSE---VVNLIDQSKIVKQAI--GSKEISNFQNYMXXXXXXXXXXXDTLSQVKTN-ISTKLSPCLSDQCRD-MKDKIDSLKVITVDES-QLNKITDLLDSLNSTNFQERLNKVINLNAYG--ITDLKLV----LDSEV-KNFKNIINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKSIEKYRXXXXXXXXXXXXXXXXXXXXXXXXXNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQ--NYXXXXXXXXXXXXXAKQPNYSTD----------------------GLMEGLFTQCQTKNFYSA-------FQRMTEKYNSLF--FKSQFQSIDSVIVSNLANKLNLT-QYLTVDPFTDLSKFDQLINSVSLPMNN-ESLSKLLNDLKSAPVD-LXXXXXXXXXXXXXXXXXRKIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGDGVKKNPA---NQGKPPHRGYKPIP 2478
            N F +LIRG    ++     IN+    +   +  S++ V + YL + I    G++FA+ +P++GL  C  RCCG+CGGRV+ +D KH  CK+V Y++CL  +    + AV++   N+ L HE++V+ DP I    Q+     + + +L+ M  ++ K   +    E  ++  + ++  +  F ++ + +S+   V ++I + +   +    GS+ IS   +Y  +   ++ +   T+ Q  T+ ++T  S     +C + MK   D LKV  +    QL+++  +     S   Q  L  V +LN +   I +L ++    +DS++ + +K++  +    +    +   ++  +   +K A +     +  +SN   +    +++E Y  Y  + L     +I +  +LGL FG CG+RP E+A   NRGVGAN LL +V   FL S+++M+  +   L    +QT+ CRY T    D   +   Y       +L       P+ S                         L + + T+C+ + F  A       +  + +  + +     + F+  D  +VS L N +  +   L    F     F + IN  + P+ N   L++ ++ LK   +D L+  I ++ +    +   R  + T+F    +  N      S    +N  L   + S     L ++       + L     +  + C  +R      +   C   + P N  W GLG  LLL IP+++FA+ L  LYR+ +K+  D +EPDY +Y GFY R   D    N     N+ +  H+GY  +P
Sbjct:   49 NFFLDLIRGQKPPTAVFETLINVRTSHHSRLTYRSVEPVVTTYLGYGICLIIGVLFAILMPVVGLLFCCARCCGKCGGRVQFVDSKHDPCKRVTYTVCLVLIVTFQLAAVVLVFINHYLFHEALVSRDPRIGAVSQINLSLVEFEASLKDM-VQMAKNTSTTDLAEQKERFMRIVDDGLVDFQEDFIKISQANDVSSVISEFQTTSRDFLPGSEAISQI-SYFNHSLYEMISELPTIRQRLTDTLNTGCSIEKIIECHELMKLANDKLKVRLLPSMLQLDEVISI-----SNQIQRHLTDVDSLNEFSETINNLAVIVRRSIDSDLDRAWKDLAQSPETREKLASVFEGIVANASTALKFARD----LISMDSNEEVNNNYLRTVE-YLLYGGMALLCIPILIFLLLYLGLCFGTCGDRPYEEAGLCNRGVGANLLLAAVGFMFLFSAILMVFCILPFLVGGPLQTEVCRYLTGRYPDGPRKMDQYVFETLKSILVAVERPLPDSSKSRSLHINKDSINTVQSTLDIVRFNLSDTILTRCEHEPFVKAISTGEFVWPVLNDAIDGILQGLVASFKRAD--LVSPLQNIIQSSLAALERLKFLSAINFSEAINQANTPITNINDLNEFVSRLKGLNMDSLTPHIQALVNGPVKLDASRSNIHTLFMRFNSFPNQMNHVVSNLNRYNEKLSTSVHSSMDRGLIKLRPLFTKELQLAVIATWHDIPCQSLRLAAKRGVDSVCYTFLMPFNAFWTGLGFTLLLFIPAIVFAVKLAGLYRKTEKYSRDYEEPDYISYHGFYMRPPTDYQDNNTQKLRNKSR-KHKGYVAVP 859          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A4Z2DIF1 (Prominin (Prom) isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_000597 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.182e-40
Identity = 199/802 (24.81%), Postives = 363/802 (45.26%), Query Frame = 1
Query:  178 NIFFNLIRGDVDSSS-----INIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFXXXXXXXXXXVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHMQKTFKELESAIKKFFDNLMNVSE---VVNLIDQSKIVKQAI--GSKEISNFQNYMXXXXXXXXXXXDTLSQVKTN-ISTKLSPCLSDQCRD-MKDKIDSLKVITVDES-QLNKITDLLDSLNSTNFQERLNKVINLNAYG--ITDLKLV----LDSEV-KNFKNIINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKSIEKYRXXXXXXXXXXXXXXXXXXXXXXXXXNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQ--NYXXXXXXXXXXXXXAKQPNYSTD----------------------GLMEGLFTQCQTKNFYSA-------FQRMTEKYNSLF--FKSQFQSIDSVIVSNLANKLNLT-QYLTVDPFTDLSKFDQLINSVSLPMNN-ESLSKLLNDLKSAPVD-LXXXXXXXXXXXXXXXXXRKIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGD 2415
            N F +LIRG    ++     IN+    +   +  S++ V + YL + I    G++FA+ +P++GL  C  RCCG+CGGRV+ +D KH  CK+V Y++CL  +    + AV++   N+ L HE++V+ DP I    Q+     + + +L+ M  ++ K   +    E  ++  + ++  +  F ++ + +S+   V ++I + +   +    GS+ IS   +Y  +   ++ +   T+ Q  T+ ++T  S     +C + MK   D LKV  +    QL+++  +     S   Q  L  V +LN +   I +L ++    +DS++ + +K++  +    +    +   ++  +   +K A +     +  +SN   +    +++E Y  Y  + L     +I +  +LGL FG CG+RP E+A   NRGVGAN LL +V   FL S+++M+  +   L    +QT+ CRY T    D   +   Y       +L       P+ S                         L + + T+C+ + F  A       +  + +  + +     + F+  D  +VS L N +  +   L    F     F + IN  + P+ N   L++ ++ LK   +D L+  I ++ +    +   R  + T+F    +  N      S    +N  L   + S     L ++       + L     +  + C  +R      +   C   + P N  W GLG  LLL IP+++FA+ L  LYR+ +K+  D +EPDY +Y GFY R   D
Sbjct:   49 NFFLDLIRGQKPPTAVFETLINVRTSHHSRLTYRSVEPVVTTYLGYGICLIIGVLFAILMPVVGLLFCCARCCGKCGGRVQFVDSKHDPCKRVTYTVCLVLIVTFQLAAVVLVFINHYLFHEALVSRDPRIGAVSQINLSLVEFEASLKDM-VQMAKNTSTTDLAEQKERFMRIVDDGLVDFQEDFIKISQANDVSSVISEFQTTSRDFLPGSEAISQI-SYFNHSLYEMISELPTIRQRLTDTLNTGCSIEKIIECHELMKLANDKLKVRLLPSMLQLDEVISI-----SNQIQRHLTDVDSLNEFSETINNLAVIVRRSIDSDLDRAWKDLAQSPETREKLASVFEGIVANASTALKFARD----LISMDSNEEVNNNYLRTVE-YLLYGGMALLCIPILIFLLLYLGLCFGTCGDRPYEEAGLCNRGVGANLLLAAVGFMFLFSAILMVFCILPFLVGGPLQTEVCRYLTGRYPDGPRKMDQYVFETLKSILVAVERPLPDSSKSRSLHINKDSINTVQSTLDIVRFNLSDTILTRCEHEPFVKAISTGEFVWPVLNDAIDGILQGLVASFKRAD--LVSPLQNIIQSSLAALERLKFLSAINFSEAINQANTPITNINDLNEFVSRLKGLNMDSLTPHIQALVNGPVKLDASRSNIHTLFMRFNSFPNQMNHVVSNLNRYNEKLSTSVHSSMDRGLIKLRPLFTKELQLAVIATWHDIPCQSLRLAAKRGVDSVCYTFLMPFNAFWTGLGFTLLLFIPAIVFAVKLAGLYRKTEKYSRDYEEPDYISYHGFYMRPPTD 836          
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Match: A0A0X3P063 (Prominin-1 OS=Schistocephalus solidus OX=70667 GN=PROM1 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 7.944e-37
Identity = 210/849 (24.73%), Postives = 379/849 (44.64%), Query Frame = 1
Query:  124 NSTFESMKQGISPFNRAGNIFFNLIRGDVDSSSI-----NIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFXXXXXXXXXXVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPP--SQIDNEHMQKTFKEL-ESAIKKFFDNLM---NVSEVVNLID--QSKIVKQAIGSKEISNFQNYMXXXXXXXXXXXDTLSQVKTNISTKL-SPCLSDQ---CRDMKDKIDSLKVITVDESQLNKITDLLDSLNSTNFQERLNKVINLNAYGITDLKLVLDSEVKNFKNIINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKS--------------------IEKYRXXXXXXXXXXXXXXXXXXXXXXXXXNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYXXXXXXXXXXXXXAKQPNYSTDGLMEGLF---------TQCQTKNFYSAFQRMTEKYNSLFFKSQFQSIDSVIVSNLANKLNLTQYLTVDPF--------TDLSK--------FDQLINSVSLPMNN-ESLSKLLNDLKSAPV-DLXXXXXXXXXXXXXXXXXRKIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGDGVKKNPANQGKPPHRGYKPIP 2478
            +ST   ++  ++  +   N + +LIRG+    +       I +      S   I  V  N+  ++     G++F + +PIIGLF C  RCC RCGGRVK MD +   C++V Y+I L  +T + + A++    N QL +E+VV+ D ++    Q+    ++    +E    +II A    S I+ ++ +  F  + +  +  F ++ +   + +EV+ L    QS + + A      + +++++K +      L      ++ +I+  L + C   +   CR+       L+ IT+++ + N   +   S       + +NK++NL A   TD+      ++  F N I  Q+     K+ L  ++D +   +  + E     +++    + D   + S                      +Y YY  + L     +II F++LGL FG CG+RP E+A   NRGVGAN L+  + +TFL ++ +M+   +  L   +VQT+ CRY TN    N P+         + +   +  PN   D  +E  F         T+C  +    A         S+ +    QSI++V+  NL N  N      + P         T LSK        F   IN ++ P+      +  + +L+S  + DL S +  +++    +     +++ I+  L ++   Y +  S  + F+ +L   + +     +  +    L  + L     + ++ C  + T  +  +   C   + P+NG W   G  LLL I S+IFA+ LVSLYR+I+K+ PD +EPDY +Y GFY R   +   + P  + +   +G K  P
Sbjct:   28 SSTAVQLRASVAFSHDVANYYLDLIRGNASEEATAEVLTGIRDMARDRPSTQYIIPVFRNFPGYTACVVFGVLFIILVPIIGLFFCCLRCCHRCGGRVKLMDRRKDPCRRVTYTIFLALITTLQLVAIVFAFINYQLHYEAVVSRDVAVGCVPQLNFSAQQFDIAVE----QIIVAAKNTSTINLDNQKAKFDAMVDDGLTAFQNDFVRNSSATEVLRLQQEFQSVVFRYAENQLPPTTWRDFIKQLRDLQTELQPHAPSLRASIAEALNTGCEVSKITACRE-------LRTITLEQLEPNFTLEQFQS-------DDVNKLLNLLASSQTDVH-----DLDQFNNTI--QSMKSDIKRELQPILDGAWRNLSDSPETRQDLVRSMEELAGDVHRSLSAFHSSLVEFTTVRDSPDGIKFREYAYYSGIALICLPVLIIFFYYLGLCFGTCGDRPYEEAGLCNRGVGANLLMAGIVLTFL-TAFLMLFCTATFLPGGLVQTELCRYLTNRYP-NGPR-VIDDTVINIANFVQSSHPNQPRDLRLERFFKMRVAELLLTRCANQTLVDA-----AGDESIGWMVSNQSINTVL-ENLLNTFNSID--IISPLRNSAAGMQTTLSKLGSFEGFDFSTAINQLNQPLIRIPDFADYIRNLRSLNIADLKSLVDDLENKHQLLHLQLGLIKEIYLQLNSLGPLYFQLTSALQTFSQDLEQTVPNSIHARINDMRSLFLRELRLAVIASWREIPCTNLHTASVSAVDALCVTYLGPLNGFWASFGTCLLLSIVSLIFAVKLVSLYRKIEKYSPDYEEPDYISYHGFYMRPTNEVDVQRP--RKRRGQKGNKNAP 838          
BLAST of Prominin (Prom) protein, putative vs. Planmine SMEST
Match: SMESG000025078.1 (SMESG000025078.1)

HSP 1 Score: 1451.42 bits (3756), Expect = 0.000e+0
Identity = 808/811 (99.63%), Postives = 808/811 (99.63%), Query Frame = 1
Query:   52 MELKMFKIAVILSIFYISSITCISNSTFESMKQGISPFNRAGNIFFNLIRGDVDSSSINIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFXXXXXXXXXXVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHMQKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISNFQNYMXXXXXXXXXXXDTLSQVKTNISTKLSPCLSDQCRDMKDKIDSLKVITVDESQLNKITDLLDSLNSTNFQERLNKVINLNAYGITDLKLVLDSEVKNFKNIINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKSIEKYRXXXXXXXXXXXXXXXXXXXXXXXXXNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYXXXXXXXXXXXXXAKQPNYSTDGLMEGLFTQCQTKNFYSAFQRMTEKYNSLFFKSQFQSIDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKLLNDLKSAPVDLXXXXXXXXXXXXXXXXXRKIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGDGVKKNPANQGKPPHRGYKPIPLQ 2484
            MELKMFKIAVILSIFYISSITCISNSTFESMKQGISPFNRAGNIFFNLIRGDVDSSSINIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFCRCCGRCGGRVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHMQKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISNFQNYMKNVNKKLKNLNDTLSQVKTNISTKLSPCLSDQCRDMKDKIDSLKVITVDESQLNKITDLLDSLNSTNFQERLNKVINLN YGITDLKLVLDSEVKNFKNIINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKSIEKYRYYIYLGLSIGIAIIIIFHFLGLLFGNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYKLLDKYLVLSLKLAKQPNYSTDGLMEGLFTQCQTKNFYSAFQRMTEKYNSLFFKSQFQSIDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKLLNDLKSAPVDLSSEISSIKSIAANISQIRKIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILK IEKNILDLMNLLFGTMFSKVSC EVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGDGVKKNPANQGKPPHRGYKPIPLQ
Sbjct:    1 MELKMFKIAVILSIFYISSITCISNSTFESMKQGISPFNRAGNIFFNLIRGDVDSSSINIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFCRCCGRCGGRVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHMQKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISNFQNYMKNVNKKLKNLNDTLSQVKTNISTKLSPCLSDQCRDMKDKIDSLKVITVDESQLNKITDLLDSLNSTNFQERLNKVINLNTYGITDLKLVLDSEVKNFKNIINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKSIEKYRYYIYLGLSIGIAIIIIFHFLGLLFGNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYKLLDKYLVLSLKLAKQPNYSTDGLMEGLFTQCQTKNFYSAFQRMTEKYNSLFFKSQFQSIDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKLLNDLKSAPVDLSSEISSIKSIAANISQIRKIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILKLIEKNILDLMNLLFGTMFSKVSCVEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGDGVKKNPANQGKPPHRGYKPIPLQ 811          
BLAST of Prominin (Prom) protein, putative vs. Planmine SMEST
Match: SMESG000025078.1 (SMESG000025078.1)

HSP 1 Score: 1442.94 bits (3734), Expect = 0.000e+0
Identity = 804/807 (99.63%), Postives = 804/807 (99.63%), Query Frame = 1
Query:   64 MFKIAVILSIFYISSITCISNSTFESMKQGISPFNRAGNIFFNLIRGDVDSSSINIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFXXXXXXXXXXVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHMQKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISNFQNYMXXXXXXXXXXXDTLSQVKTNISTKLSPCLSDQCRDMKDKIDSLKVITVDESQLNKITDLLDSLNSTNFQERLNKVINLNAYGITDLKLVLDSEVKNFKNIINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKSIEKYRXXXXXXXXXXXXXXXXXXXXXXXXXNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYXXXXXXXXXXXXXAKQPNYSTDGLMEGLFTQCQTKNFYSAFQRMTEKYNSLFFKSQFQSIDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKLLNDLKSAPVDLXXXXXXXXXXXXXXXXXRKIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGDGVKKNPANQGKPPHRGYKPIPLQ 2484
            MFKIAVILSIFYISSITCISNSTFESMKQGISPFNRAGNIFFNLIRGDVDSSSINIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFCRCCGRCGGRVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHMQKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISNFQNYMKNVNKKLKNLNDTLSQVKTNISTKLSPCLSDQCRDMKDKIDSLKVITVDESQLNKITDLLDSLNSTNFQERLNKVINLN YGITDLKLVLDSEVKNFKNIINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKSIEKYRYYIYLGLSIGIAIIIIFHFLGLLFGNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYKLLDKYLVLSLKLAKQPNYSTDGLMEGLFTQCQTKNFYSAFQRMTEKYNSLFFKSQFQSIDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKLLNDLKSAPVDLSSEISSIKSIAANISQIRKIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILK IEKNILDLMNLLFGTMFSKVSC EVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGDGVKKNPANQGKPPHRGYKPIPLQ
Sbjct:    1 MFKIAVILSIFYISSITCISNSTFESMKQGISPFNRAGNIFFNLIRGDVDSSSINIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFCRCCGRCGGRVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHMQKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISNFQNYMKNVNKKLKNLNDTLSQVKTNISTKLSPCLSDQCRDMKDKIDSLKVITVDESQLNKITDLLDSLNSTNFQERLNKVINLNTYGITDLKLVLDSEVKNFKNIINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKSIEKYRYYIYLGLSIGIAIIIIFHFLGLLFGNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYKLLDKYLVLSLKLAKQPNYSTDGLMEGLFTQCQTKNFYSAFQRMTEKYNSLFFKSQFQSIDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKLLNDLKSAPVDLSSEISSIKSIAANISQIRKIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILKLIEKNILDLMNLLFGTMFSKVSCVEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGDGVKKNPANQGKPPHRGYKPIPLQ 807          
BLAST of Prominin (Prom) protein, putative vs. Planmine SMEST
Match: SMESG000025078.1 (SMESG000025078.1)

HSP 1 Score: 1394.02 bits (3607), Expect = 0.000e+0
Identity = 778/781 (99.62%), Postives = 778/781 (99.62%), Query Frame = 1
Query:  142 MKQGISPFNRAGNIFFNLIRGDVDSSSINIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFXXXXXXXXXXVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHMQKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISNFQNYMXXXXXXXXXXXDTLSQVKTNISTKLSPCLSDQCRDMKDKIDSLKVITVDESQLNKITDLLDSLNSTNFQERLNKVINLNAYGITDLKLVLDSEVKNFKNIINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKSIEKYRXXXXXXXXXXXXXXXXXXXXXXXXXNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYXXXXXXXXXXXXXAKQPNYSTDGLMEGLFTQCQTKNFYSAFQRMTEKYNSLFFKSQFQSIDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKLLNDLKSAPVDLXXXXXXXXXXXXXXXXXRKIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGDGVKKNPANQGKPPHRGYKPIPLQ 2484
            MKQGISPFNRAGNIFFNLIRGDVDSSSINIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFCRCCGRCGGRVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHMQKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISNFQNYMKNVNKKLKNLNDTLSQVKTNISTKLSPCLSDQCRDMKDKIDSLKVITVDESQLNKITDLLDSLNSTNFQERLNKVINLN YGITDLKLVLDSEVKNFKNIINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKSIEKYRYYIYLGLSIGIAIIIIFHFLGLLFGNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYKLLDKYLVLSLKLAKQPNYSTDGLMEGLFTQCQTKNFYSAFQRMTEKYNSLFFKSQFQSIDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKLLNDLKSAPVDLSSEISSIKSIAANISQIRKIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILK IEKNILDLMNLLFGTMFSKVSC EVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGDGVKKNPANQGKPPHRGYKPIPLQ
Sbjct:    1 MKQGISPFNRAGNIFFNLIRGDVDSSSINIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPIIGLFICFCRCCGRCGGRVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHMQKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISNFQNYMKNVNKKLKNLNDTLSQVKTNISTKLSPCLSDQCRDMKDKIDSLKVITVDESQLNKITDLLDSLNSTNFQERLNKVINLNTYGITDLKLVLDSEVKNFKNIINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKDFQTTKSIEKYRYYIYLGLSIGIAIIIIFHFLGLLFGNCGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDNAPQNYKLLDKYLVLSLKLAKQPNYSTDGLMEGLFTQCQTKNFYSAFQRMTEKYNSLFFKSQFQSIDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLINSVSLPMNNESLSKLLNDLKSAPVDLSSEISSIKSIAANISQIRKIMQTIFQSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILKLIEKNILDLMNLLFGTMFSKVSCVEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGDGVKKNPANQGKPPHRGYKPIPLQ 781          
BLAST of Prominin (Prom) protein, putative vs. Planmine SMEST
Match: SMESG000013192.1 (SMESG000013192.1)

HSP 1 Score: 85.8853 bits (211), Expect = 6.802e-17
Identity = 71/223 (31.84%), Postives = 124/223 (55.61%), Query Frame = 1
Query:  322 IVFAVFLPIIGLFICFXXXXXXXXXXVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIITLFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQIDNEHM--QKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISNFQNYMXXXXXXXXXXXDTLSQVKTNI----STKLSPCLSDQCRDMKDKIDSLKVITVDESQ 972
            ++F V +PI+G   C CRC G+CGG+VK MDPKH  CK+  Y++ L  ++VIM+  +++   NNQL+H+++ N    IN   Q+KN  E +  +L  +  EI  A  S  +N+ M  +  F+++ S  +++F+ L   S    + D   ++ +A     +S   N+++ V K  + L D  +++KT I    +TK++  +SD     K   D+LK +   +S+
Sbjct:  100 VLFVVLMPIVGFCFCLCRCGGKCGGKVKGMDPKHAICKRYTYAVLLGMISVIMLAGIVLAFINNQLIHDTLTNPSKEINAISQIKNSAELMHNSLSNISIEISNAEKSSRNNDGMIDKTQFQDVLS--RQYFNKLKVDSFNEKVKDSLSLIMEA-----LSQTTNFLQRVKKPNEKLKDLETKLKTYIENLETTKMNQAVSDLLSTCKSDFDALKQLMKSQSK 315          

HSP 2 Score: 81.6481 bits (200), Expect = 1.265e-15
Identity = 44/137 (32.12%), Postives = 74/137 (54.01%), Query Frame = 1
Query: 2053 EIFNSNLVVIIKSQSPIILKRIEKNILDLMNLLFGTMFSKVSCAEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSMIFALLLVSLYRRIQKFYPDRDEPDYENYIGFYA-RADGDGVKKNPANQGKPPHR 2460
            E F+SN+   + S   I +K I       +N ++   + +V C  +  +   ++   C  ++ P NG WYG+G+ L+  IP++IFA+ L  LYR  +K+  D +EPDY +Y+GFY   AD   +KK  + +    +R
Sbjct:  583 EFFDSNVSNNLNSALTIEVKSI-------LNKVYIGSYDQVKCVGMYNSTKMLIDAFCVTLLWPYNGFWYGIGICLVFTIPAIIFAVKLAGLYRHTEKYSADYEEPDYHSYMGFYTNNADNIPMKKPKSGKSSQKNR 712          

HSP 3 Score: 63.929 bits (154), Expect = 4.023e-10
Identity = 29/64 (45.31%), Postives = 35/64 (54.69%), Query Frame = 1
Query: 1363 CGERPEEDASCFNRGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKDN 1554
            CGERP EDA   NRGVGAN ++  V   FL +  IM   ++        QT+ CRY TNS  D 
Sbjct:  385 CGERPFEDARICNRGVGANLMMAGVAFAFLFTPSIMGITMTLFTNGGFTQTEACRYLTNSYGDG 448          
The following BLAST results are available for this feature:
BLAST of Prominin (Prom) protein, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prom19.710e-821.28prominin 1 [Source:NCBI gene;Acc:100036621][more]
prom11.703e-723.66prominin 1 [Source:NCBI gene;Acc:100036621][more]
prom12.856e-722.05prominin 1 [Source:NCBI gene;Acc:100036621][more]
prom16.576e-729.31prominin 1 [Source:NCBI gene;Acc:100036621][more]
prom19.347e-729.52prominin 1 [Source:NCBI gene;Acc:100036621][more]
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YL076.052e-4425.03Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564YL708.909e-4425.03Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A4Z2DIH54.959e-4224.82Prominin (Prom) isoform 3 OS=Schistosoma japonicum... [more]
A0A4Z2DIF11.182e-4024.81Prominin (Prom) isoform 2 OS=Schistosoma japonicum... [more]
A0A0X3P0637.944e-3724.73Prominin-1 OS=Schistocephalus solidus OX=70667 GN=... [more]
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prominin (Prom) protein, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000025078.10.000e+099.63SMESG000025078.1[more]
SMESG000025078.10.000e+099.63SMESG000025078.1[more]
SMESG000025078.10.000e+099.62SMESG000025078.1[more]
SMESG000013192.16.802e-1731.84SMESG000013192.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012368 ID=SMED30012368|Name=Prominin (Prom) protein, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=2691bp
CTTCTAACGCATGATTTGGACATTTTAAATTAGATTTAAAATAAAAATTT
TATGGAATTAAAAATGTTCAAAATAGCAGTAATTTTATCAATTTTCTATA
TATCTTCAATCACTTGTATCTCAAATTCAACCTTTGAATCAATGAAACAA
GGAATTTCTCCTTTTAATAGGGCAGGAAATATATTCTTTAACTTAATTCG
TGGCGATGTTGATTCATCATCAATAAATATCGACGAATATATAAATTTAA
CATTTTCAATAGATTCTATCAAAAAAGTAGCATCGAATTATTTAAGTCAT
TCCATTTTATTTGCAACTGGAATAGTGTTTGCAGTATTTCTTCCTATTAT
TGGACTATTTATCTGTTTTTGTCGTTGTTGTGGTCGATGTGGCGGTCGAG
TCAAACCTATGGATCCGAAACATGTAAAATGTAAAAAGGTTGCCTACAGT
ATTTGCCTTACAACTCTCACAGTGATTATGATATTCGCAGTGATTATAAC
GCTATTCAACAATCAACTGGTCCACGAATCAGTTGTCAATTCTGATCCAT
CTATCAATATTTTCCTTCAAGTCAAAAATCAGTTTGAGAAAATCAAAACC
AATCTTGAAACGATGAAATCTGAAATCATTAAAGCGCCACCGTCCCAAAT
TGACAATGAACATATGCAAAAAACTTTTAAAGAGCTCGAAAGCGCAATCA
AGAAGTTCTTCGATAATTTAATGAATGTGTCCGAAGTTGTGAATTTAATT
GATCAATCAAAAATAGTAAAACAAGCTATTGGATCCAAGGAAATTTCAAA
TTTTCAGAATTACATGAAGAATGTTAATAAAAAATTAAAAAATCTCAACG
ATACACTTTCACAAGTCAAAACCAATATATCAACTAAACTTTCTCCTTGT
TTATCAGATCAATGTCGTGATATGAAAGATAAAATTGACTCTTTGAAAGT
TATAACAGTGGATGAAAGCCAACTCAATAAAATAACTGATTTGCTAGACA
GTTTAAACAGCACAAACTTCCAAGAGAGATTGAACAAAGTAATTAATTTG
AACGCATATGGAATAACAGATTTAAAGCTGGTCTTGGATAGCGAAGTTAA
AAATTTCAAAAATATAATTAACAACCAAACTTTCACTGATCATGCTAAAA
AAATATTGGTTCAACTAATAGATAGAAGTTTGAATATTGTGAAATTAGCA
GCGGAAAATACTCCATCACCCTTGAAAAATGAGTCAAATTACAGCAAAGA
TTTCCAGACGACAAAATCAATTGAAAAATATAGATATTATATATATCTTG
GACTTTCCATAGGCATTGCAATAATAATTATATTCCATTTTCTGGGCTTA
TTATTTGGAAATTGTGGTGAGCGTCCGGAAGAAGATGCTAGCTGTTTTAA
TCGTGGAGTTGGTGCCAATTTTCTGCTGATATCAGTTACAGTGACATTTC
TTTTGTCATCATTGATTATGATCACTGTTCTTTCGAATCTACTGACAACA
AATATAGTGCAAACAGATTTTTGTCGTTATTTCACAAATTCCACCAAAGA
TAATGCACCTCAAAATTATAAATTATTGGATAAATATCTTGTGTTATCAC
TGAAATTGGCTAAACAACCAAATTATTCGACCGATGGATTAATGGAAGGA
CTTTTCACTCAATGTCAAACCAAGAACTTTTATTCGGCATTTCAGCGAAT
GACAGAGAAATATAATAGTCTATTCTTCAAATCTCAATTTCAGTCAATTG
ACAGTGTAATCGTTTCTAATCTTGCCAACAAACTCAACTTGACACAATAT
CTCACAGTCGATCCATTTACTGATCTATCAAAATTTGATCAACTGATCAA
TTCCGTCTCTTTGCCTATGAATAATGAATCATTGAGCAAATTATTGAACG
ATTTGAAATCAGCTCCAGTTGATCTCAGTTCAGAAATTTCTTCAATCAAA
TCAATCGCTGCCAATATTTCTCAAATCCGAAAAATTATGCAGACTATTTT
TCAAAGTCTGACAAATATCGAAAATCATTACACAAAATGGAAGTCGATGG
CTGAAATATTCAACAGCAATCTAGTTGTTATCATTAAATCGCAAAGCCCG
ATTATTTTGAAACGTATTGAAAAAAATATTTTGGATCTAATGAATTTATT
GTTCGGAACAATGTTTTCAAAGGTTTCCTGTGCGGAAGTTAGGACTAATG
TCATTGATATTTTGAAATTTACGTGTGAAAATGTTGTTGATCCAGTGAAC
GGATGTTGGTACGGCCTCGGTGTGTTTTTGCTTCTTGTCATTCCATCAAT
GATATTCGCACTTTTGTTGGTTAGTTTATATCGGAGAATCCAAAAATTTT
ATCCAGATAGAGATGAACCAGATTATGAAAACTATATCGGTTTCTATGCT
AGAGCTGACGGCGACGGTGTTAAAAAAAATCCAGCCAATCAAGGCAAGCC
TCCTCATAGGGGATACAAACCAATTCCACTCCAATAAATATTCCATTTTA
TTTGTGACTTCACCTTCTGTAAATCTATTATTTGTGTATATATCTAAATA
TGTGACGATTTTTATGTTATTCGATTGAATTATCAAACTGAAATAACTAT
AACATTGTTTTGTTGTTTTCATTATCTGTTTTTATGAGTCTTCTTATTTG
TTTATTATGCCAATAAATTTTGTCTATTCTTTGAAAAAAAA
back to top

protein sequence of SMED30012368-orf-1

>SMED30012368-orf-1 ID=SMED30012368-orf-1|Name=SMED30012368-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=812bp
MELKMFKIAVILSIFYISSITCISNSTFESMKQGISPFNRAGNIFFNLIR
GDVDSSSINIDEYINLTFSIDSIKKVASNYLSHSILFATGIVFAVFLPII
GLFICFCRCCGRCGGRVKPMDPKHVKCKKVAYSICLTTLTVIMIFAVIIT
LFNNQLVHESVVNSDPSINIFLQVKNQFEKIKTNLETMKSEIIKAPPSQI
DNEHMQKTFKELESAIKKFFDNLMNVSEVVNLIDQSKIVKQAIGSKEISN
FQNYMKNVNKKLKNLNDTLSQVKTNISTKLSPCLSDQCRDMKDKIDSLKV
ITVDESQLNKITDLLDSLNSTNFQERLNKVINLNAYGITDLKLVLDSEVK
NFKNIINNQTFTDHAKKILVQLIDRSLNIVKLAAENTPSPLKNESNYSKD
FQTTKSIEKYRYYIYLGLSIGIAIIIIFHFLGLLFGNCGERPEEDASCFN
RGVGANFLLISVTVTFLLSSLIMITVLSNLLTTNIVQTDFCRYFTNSTKD
NAPQNYKLLDKYLVLSLKLAKQPNYSTDGLMEGLFTQCQTKNFYSAFQRM
TEKYNSLFFKSQFQSIDSVIVSNLANKLNLTQYLTVDPFTDLSKFDQLIN
SVSLPMNNESLSKLLNDLKSAPVDLSSEISSIKSIAANISQIRKIMQTIF
QSLTNIENHYTKWKSMAEIFNSNLVVIIKSQSPIILKRIEKNILDLMNLL
FGTMFSKVSCAEVRTNVIDILKFTCENVVDPVNGCWYGLGVFLLLVIPSM
IFALLLVSLYRRIQKFYPDRDEPDYENYIGFYARADGDGVKKNPANQGKP
PHRGYKPIPLQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR008795Prominin
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 248..275
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 790..811
NoneNo IPR availableTMHMMTMhelixcoord: 455..477
NoneNo IPR availableTMHMMTMhelixcoord: 85..107
NoneNo IPR availableTMHMMTMhelixcoord: 413..435
NoneNo IPR availableTMHMMTMhelixcoord: 130..152
NoneNo IPR availableTMHMMTMhelixcoord: 9..28
NoneNo IPR availableTMHMMTMhelixcoord: 738..760
IPR008795PromininPFAMPF05478Prominincoord: 80..761
e-value: 9.1E-56
score: 189.3
IPR008795PromininPANTHERPTHR22730PROMININ PROM PROTEINcoord: 69..788