Sorting nexin

Overview
NameSorting nexin
Smed IDSMED30012364
Length (bp)1899
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sorting nexin (SMED30012364) t-SNE clustered cells

Violin plots show distribution of expression levels for Sorting nexin (SMED30012364) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sorting nexin (SMED30012364) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sorting nexin (SMED30012364) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012364

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012364SMESG000066985.1 Contig1649GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30012364SMESG000066985.1 dd_Smed_v4_2271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012364SMESG000066985.1 dd_Smed_v4_2271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012364SMESG000066985.1 dd_Smed_v4_2271_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sorting nexin vs. Ensembl Human
Match: SNX32 (sorting nexin 32 [Source:HGNC Symbol;Acc:HGNC:26423])

HSP 1 Score: 393.275 bits (1009), Expect = 1.965e-131
Identity = 213/397 (53.65%), Postives = 285/397 (71.79%), Query Frame = 1
Query:  181 ASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLL--RSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLK 1365
              E  PS    +L  +S   L VEISDA+SER+KV FTV TK+ L  F   EFSV RQHEEF+WLHD   E E+YAG+I PPAPP+PDF+ SR+KL KL E ++++ +++F KMK ELEAEYLA FKKTVAMHEVFLQRLAAHP L+ D NF +FLEY  +LSVRGK+RKE   GF++ +  + DE L+   S  KE D FF +E+ +L++Y+  +RD+ ++AD++ R HK ++D YI +S AL            L ++FL L+++FE +RKLE R+A+DEDLKLSD LRYY  DSQAAK LLYRR RALADYE+A K ++KAR++ +EV  AE+ Q     +F+++SDSAK +++DFK RR++ F+KNL EL +L+LKHA+    +LR  L +LK
Sbjct:    8 GKEGKPSCASVDLQGDSS--LQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGGFLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVN--QLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALK 400          
BLAST of Sorting nexin vs. Ensembl Human
Match: SNX6 (sorting nexin 6 [Source:HGNC Symbol;Acc:HGNC:14970])

HSP 1 Score: 389.423 bits (999), Expect = 7.292e-130
Identity = 217/399 (54.39%), Postives = 292/399 (73.18%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASL 1362
             P+  SE +   +   +   SD  L V+ISDA+SER+KV FTVHTK++L  FK  EFSV RQHEEF+WLHD   E EDYAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHPIL+ D+NF +FLEY+ +LSVRGK++KEK   F K +  + D  ++ S  K+ D FF +E+ +L++Y+  V+D++ K+D+MTR HKS +D Y  + ++L     Q  T   D+   FL +S++F++ RK+E R++ DEDLKLSD L+YY  +SQAAK LLYRRSR+L DYE+A K ++KAR+K K+V  AET+Q     KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L+  LA L
Sbjct:    8 GPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRRDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIV-SGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDST---DICKFFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVL 402          
BLAST of Sorting nexin vs. Ensembl Human
Match: SNX6 (sorting nexin 6 [Source:HGNC Symbol;Acc:HGNC:14970])

HSP 1 Score: 389.808 bits (1000), Expect = 7.862e-130
Identity = 217/399 (54.39%), Postives = 292/399 (73.18%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASL 1362
             P+  SE +   +   +   SD  L V+ISDA+SER+KV FTVHTK++L  FK  EFSV RQHEEF+WLHD   E EDYAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHPIL+ D+NF +FLEY+ +LSVRGK++KEK   F K +  + D  ++ S  K+ D FF +E+ +L++Y+  V+D++ K+D+MTR HKS +D Y  + ++L     Q  T   D+   FL +S++F++ RK+E R++ DEDLKLSD L+YY  +SQAAK LLYRRSR+L DYE+A K ++KAR+K K+V  AET+Q     KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L+  LA L
Sbjct:   20 GPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRRDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIV-SGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDST---DICKFFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVL 414          
BLAST of Sorting nexin vs. Ensembl Human
Match: SNX5 (sorting nexin 5 [Source:HGNC Symbol;Acc:HGNC:14969])

HSP 1 Score: 369.007 bits (946), Expect = 5.570e-122
Identity = 199/377 (52.79%), Postives = 279/377 (74.01%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTAL 1353
            N D  L ++I DA+SER+KV FTVHTKTTL  F++ EFSV RQHE+FVWLHD L ET DYAG+I PPAP KPDFD  R+K+ KL E E +M K++F KMK ELEAEYLA FKKTV+ HEVFLQRL++HP+L  D NF +FLEYD +LSVR K+ KE F GF K V  + DE L  +  KE D FF  EK +L++YY  ++DS +KADKMTR HK+++D YI  +  L   A++  T    +    L ++++FE++RK+E R+++DEDLKL++ LRYY  + +AAK LLYRR++AL DYE++ K ++KAR K K+V  AE  Q +   KF+++S+SAK ++++FK++R+A F+KNL E+++L++KHAR ++ +L++ +
Sbjct:   26 NVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLF-TGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTV---IKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCI 398          
BLAST of Sorting nexin vs. Ensembl Human
Match: SNX5 (sorting nexin 5 [Source:HGNC Symbol;Acc:HGNC:14969])

HSP 1 Score: 369.007 bits (946), Expect = 5.570e-122
Identity = 199/377 (52.79%), Postives = 279/377 (74.01%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTAL 1353
            N D  L ++I DA+SER+KV FTVHTKTTL  F++ EFSV RQHE+FVWLHD L ET DYAG+I PPAP KPDFD  R+K+ KL E E +M K++F KMK ELEAEYLA FKKTV+ HEVFLQRL++HP+L  D NF +FLEYD +LSVR K+ KE F GF K V  + DE L  +  KE D FF  EK +L++YY  ++DS +KADKMTR HK+++D YI  +  L   A++  T    +    L ++++FE++RK+E R+++DEDLKL++ LRYY  + +AAK LLYRR++AL DYE++ K ++KAR K K+V  AE  Q +   KF+++S+SAK ++++FK++R+A F+KNL E+++L++KHAR ++ +L++ +
Sbjct:   26 NVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLF-TGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTV---IKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCI 398          
BLAST of Sorting nexin vs. Ensembl Celegans
Match: snx-6 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8])

HSP 1 Score: 326.635 bits (836), Expect = 2.882e-106
Identity = 187/382 (48.95%), Postives = 270/382 (70.68%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKES 1371
            NSD+ + V+ISDA+SEREKV +TVHT+T L++ K  E +V R+HEEF+WLH  LE+ E+YAG I PPAPPKP+FD SR+KL KL E E  M K++F KMK +LE +YLA FKKTVAMHEVFLQR+AAHP+ +ND NF IFL+Y++ LSVRGK++KE+   F K+ T + DE LL S QK+ D FF  EK Y+V+Y + ++++  K++K+    K++  S+  +  + E   +       L+ TF   +    +++K+E+R + DE+LKL DTL Y+  D+QAAK LLYRR R LA+YE+A K +E+AR+K +E+  AE  Q++A  KF++I+  +K ++ + K RR+  FKKNLT+L +L++KH++  I +LR  +  LK S
Sbjct:    2 NSDEAICVDISDALSEREKVKYTVHTRTRLQEMK-PETAVVREHEEFLWLHGTLEDNENYAGFIIPPAPPKPNFDSSREKLQKLGEGEATMTKEEFLKMKHDLEQDYLAQFKKTVAMHEVFLQRIAAHPVFKNDQNFRIFLQYENELSVRGKNKKEQVESFWKRFTQSADEVLL-SGQKDVDEFFEKEKNYMVEYNIHIKEAAAKSEKLIAARKNVVASFSKIGDSFERIARGEPNK-SLARTFAQGADAMFKLKKVESRSSNDEELKLGDTLHYFARDTQAAKDLLYRRMRCLANYEAANKNLERARAKNREIPKAEAEQSEACKKFEEITGLSKNELKELKTRRVQAFKKNLTDLAELEIKHSKAEISLLRDVVERLKSS 380          
BLAST of Sorting nexin vs. Ensembl Celegans
Match: snx-6 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8])

HSP 1 Score: 326.635 bits (836), Expect = 2.882e-106
Identity = 187/382 (48.95%), Postives = 270/382 (70.68%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKES 1371
            NSD+ + V+ISDA+SEREKV +TVHT+T L++ K  E +V R+HEEF+WLH  LE+ E+YAG I PPAPPKP+FD SR+KL KL E E  M K++F KMK +LE +YLA FKKTVAMHEVFLQR+AAHP+ +ND NF IFL+Y++ LSVRGK++KE+   F K+ T + DE LL S QK+ D FF  EK Y+V+Y + ++++  K++K+    K++  S+  +  + E   +       L+ TF   +    +++K+E+R + DE+LKL DTL Y+  D+QAAK LLYRR R LA+YE+A K +E+AR+K +E+  AE  Q++A  KF++I+  +K ++ + K RR+  FKKNLT+L +L++KH++  I +LR  +  LK S
Sbjct:    2 NSDEAICVDISDALSEREKVKYTVHTRTRLQEMK-PETAVVREHEEFLWLHGTLEDNENYAGFIIPPAPPKPNFDSSREKLQKLGEGEATMTKEEFLKMKHDLEQDYLAQFKKTVAMHEVFLQRIAAHPVFKNDQNFRIFLQYENELSVRGKNKKEQVESFWKRFTQSADEVLL-SGQKDVDEFFEKEKNYMVEYNIHIKEAAAKSEKLIAARKNVVASFSKIGDSFERIARGEPNK-SLARTFAQGADAMFKLKKVESRSSNDEELKLGDTLHYFARDTQAAKDLLYRRMRCLANYEAANKNLERARAKNREIPKAEAEQSEACKKFEEITGLSKNELKELKTRRVQAFKKNLTDLAELEIKHSKAEISLLRDVVERLKSS 380          
BLAST of Sorting nexin vs. Ensembl Celegans
Match: snx-6 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8])

HSP 1 Score: 327.02 bits (837), Expect = 3.853e-105
Identity = 187/382 (48.95%), Postives = 270/382 (70.68%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKES 1371
            NSD+ + V+ISDA+SEREKV +TVHT+T L++ K  E +V R+HEEF+WLH  LE+ E+YAG I PPAPPKP+FD SR+KL KL E E  M K++F KMK +LE +YLA FKKTVAMHEVFLQR+AAHP+ +ND NF IFL+Y++ LSVRGK++KE+   F K+ T + DE LL S QK+ D FF  EK Y+V+Y + ++++  K++K+    K++  S+  +  + E   +       L+ TF   +    +++K+E+R + DE+LKL DTL Y+  D+QAAK LLYRR R LA+YE+A K +E+AR+K +E+  AE  Q++A  KF++I+  +K ++ + K RR+  FKKNLT+L +L++KH++  I +LR  +  LK S
Sbjct:   99 NSDEAICVDISDALSEREKVKYTVHTRTRLQEMK-PETAVVREHEEFLWLHGTLEDNENYAGFIIPPAPPKPNFDSSREKLQKLGEGEATMTKEEFLKMKHDLEQDYLAQFKKTVAMHEVFLQRIAAHPVFKNDQNFRIFLQYENELSVRGKNKKEQVESFWKRFTQSADEVLL-SGQKDVDEFFEKEKNYMVEYNIHIKEAAAKSEKLIAARKNVVASFSKIGDSFERIARGEPNK-SLARTFAQGADAMFKLKKVESRSSNDEELKLGDTLHYFARDTQAAKDLLYRRMRCLANYEAANKNLERARAKNREIPKAEAEQSEACKKFEEITGLSKNELKELKTRRVQAFKKNLTDLAELEIKHSKAEISLLRDVVERLKSS 477          
BLAST of Sorting nexin vs. Ensembl Celegans
Match: snx-6 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8])

HSP 1 Score: 327.02 bits (837), Expect = 3.853e-105
Identity = 187/382 (48.95%), Postives = 270/382 (70.68%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKES 1371
            NSD+ + V+ISDA+SEREKV +TVHT+T L++ K  E +V R+HEEF+WLH  LE+ E+YAG I PPAPPKP+FD SR+KL KL E E  M K++F KMK +LE +YLA FKKTVAMHEVFLQR+AAHP+ +ND NF IFL+Y++ LSVRGK++KE+   F K+ T + DE LL S QK+ D FF  EK Y+V+Y + ++++  K++K+    K++  S+  +  + E   +       L+ TF   +    +++K+E+R + DE+LKL DTL Y+  D+QAAK LLYRR R LA+YE+A K +E+AR+K +E+  AE  Q++A  KF++I+  +K ++ + K RR+  FKKNLT+L +L++KH++  I +LR  +  LK S
Sbjct:   99 NSDEAICVDISDALSEREKVKYTVHTRTRLQEMK-PETAVVREHEEFLWLHGTLEDNENYAGFIIPPAPPKPNFDSSREKLQKLGEGEATMTKEEFLKMKHDLEQDYLAQFKKTVAMHEVFLQRIAAHPVFKNDQNFRIFLQYENELSVRGKNKKEQVESFWKRFTQSADEVLL-SGQKDVDEFFEKEKNYMVEYNIHIKEAAAKSEKLIAARKNVVASFSKIGDSFERIARGEPNK-SLARTFAQGADAMFKLKKVESRSSNDEELKLGDTLHYFARDTQAAKDLLYRRMRCLANYEAANKNLERARAKNREIPKAEAEQSEACKKFEEITGLSKNELKELKTRRVQAFKKNLTDLAELEIKHSKAEISLLRDVVERLKSS 477          
BLAST of Sorting nexin vs. Ensembl Celegans
Match: snx-6 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8])

HSP 1 Score: 289.656 bits (740), Expect = 2.177e-92
Identity = 166/346 (47.98%), Postives = 241/346 (69.65%), Query Frame = 1
Query:  334 EFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKES 1371
            E +V R+HEEF+WLH  LE+ E+YAG I PPAPPKP+FD SR+KL KL E E  M K++F KMK +LE +YLA FKKTVAMHEVFLQR+AAHP+ +ND NF IFL+Y++ LSVRGK++KE+   F K+ T + DE LL S QK+ D FF  EK Y+V+Y + ++++  K++K+    K++  S+  +  + E   +       L+ TF   +    +++K+E+R + DE+LKL DTL Y+  D+QAAK LLYRR R LA+YE+A K +E+AR+K +E+  AE  Q++A  KF++I+  +K ++ + K RR+  FKKNLT+L +L++KH++  I +LR  +  LK S
Sbjct:    4 ETAVVREHEEFLWLHGTLEDNENYAGFIIPPAPPKPNFDSSREKLQKLGEGEATMTKEEFLKMKHDLEQDYLAQFKKTVAMHEVFLQRIAAHPVFKNDQNFRIFLQYENELSVRGKNKKEQVESFWKRFTQSADEVLL-SGQKDVDEFFEKEKNYMVEYNIHIKEAAAKSEKLIAARKNVVASFSKIGDSFERIARGEPNK-SLARTFAQGADAMFKLKKVESRSSNDEELKLGDTLHYFARDTQAAKDLLYRRMRCLANYEAANKNLERARAKNREIPKAEAEQSEACKKFEEITGLSKNELKELKTRRVQAFKKNLTDLAELEIKHSKAEISLLRDVVERLKSS 347          
BLAST of Sorting nexin vs. Ensembl Fly
Match: Snx6 (gene:FBgn0032005 transcript:FBtr0079631)

HSP 1 Score: 364.385 bits (934), Expect = 6.265e-120
Identity = 199/377 (52.79%), Postives = 278/377 (73.74%), Query Frame = 1
Query:  241 LNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLA-LSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKE 1368
            L+VEISDA+SE+EKV FTVHT+TTL  F  K+ +V RQHEEFVWLHD++EE +DYAG I PP PP+PDFD SR+KL +L E E NM K++F KMK+ELEAEYLATFKKTVAMHEVFL+RLA+HP+ + D +  +FLEYD +L  + + +   F GF+K +  T DE LL +  ++ + FF NE  +L +Y+  +R++ ++ +KMT++HK + DS+  +S AL        G+++   TF+A  +++FE ++ LE R+A+D+DLKL DTLRYYQ DS AAKALL RR R LA YE+A + +EKARSK K+V AAETAQ +A +KF+ +S   K +++ F+ RR+A FKK+L EL++L++KHA+   + LR +L +LKE
Sbjct:   74 LHVEISDALSEKEKVKFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPRKKMAIFGGFVKSLGKTTDEILLSATVRDVNDFFENELQFLTEYHGHLREAALRTEKMTQRHKDVGDSHQKISNALTQLSTTEKGNVE---TFVAKTAEIFERIKNLETRVASDQDLKLGDTLRYYQRDSDAAKALLIRRLRCLAAYEAANRNLEKARSKNKDVHAAETAQAEACEKFESMSACGKEELIGFRNRRVAAFKKSLVELSELEIKHAKTQYEYLRQSLLALKE 447          
BLAST of Sorting nexin vs. Ensembl Fly
Match: Snx6 (gene:FBgn0032005 transcript:FBtr0306170)

HSP 1 Score: 358.221 bits (918), Expect = 2.066e-117
Identity = 199/383 (51.96%), Postives = 277/383 (72.32%), Query Frame = 1
Query:  241 LNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLA-LSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGK------XXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKE 1368
            L+VEISDA+SE+EKV FTVHT+TTL  F  K+ +V RQHEEFVWLHD++EE +DYAG I PP PP+PDFD SR+KL +L E E NM K++F KMK+ELEAEYLATFKKTVAMHEVFL+RLA+HP+ + D +  +FLEYD +L  + + +   F GF+K +  T DE LL +  ++ + FF NE  +L +Y+  +R++ ++ +KMT++HK + DS+  +S AL        G+++   TF+A  +++FE ++ LE R+A+D+DLKL DTLRYYQ DS AAKALL RR R LA YE+A + +EKARSK K      EV  AETAQ +A +KF+ +S   K +++ F+ RR+A FKK+L EL++L++KHA+   + LR +L +LKE
Sbjct:   74 LHVEISDALSEKEKVKFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPRKKMAIFGGFVKSLGKTTDEILLSATVRDVNDFFENELQFLTEYHGHLREAALRTEKMTQRHKDVGDSHQKISNALTQLSTTEKGNVE---TFVAKTAEIFERIKNLETRVASDQDLKLGDTLRYYQRDSDAAKALLIRRLRCLAAYEAANRNLEKARSKNKDVHAPLEVQEAETAQAEACEKFESMSACGKEELIGFRNRRVAAFKKSLVELSELEIKHAKTQYEYLRQSLLALKE 453          
BLAST of Sorting nexin vs. Ensembl Fly
Match: Snx1 (gene:FBgn0031534 transcript:FBtr0343238)

HSP 1 Score: 73.9442 bits (180), Expect = 1.557e-13
Identity = 101/417 (24.22%), Postives = 189/417 (45.32%), Query Frame = 1
Query:  142 DDEDLFQS-IAPNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREK----VVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKL-MKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIK---QVTATMDETLLRSNQKEEDSFFLNE--KVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKAR-SKGK-------------XXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKH 1317
            ++ DLF S ++P++  + +P QE   LT++ D  +++ +SD     +     + + V TKT + +FK  EFS  R+  +F+ +HD L       G I PPAP K     ++ K+  + SE    M ++  +  +A LE                F+ R A HP+L+ D++F  FLE D  L     +      G I+   +V  T+++   + +  E D +F ++  +V  +D  L    + +K+   +R+  S+    +  S A+    + HTG   LS     L+ V E++  L +  A  +   L++ ++ Y     A K + + R +A  +++ A   + K R ++G+             +    E    +   +F  IS   K ++  F+  R+  FK N+ +  + Q+ H
Sbjct:   43 NESDLFVSALSPSSIGDIHPLQEV--LTDDGDYFISIVVSDPQKIGDGMGSYLAYKVTTKTNIPKFKRSEFSTLRRFSDFLGIHDLLVGKYMRLGRIIPPAPSKNIIGSTKVKISPQQSEPGTPMTQEWVEIRRAALER---------------FVHRTAQHPVLRVDLDFMNFLESDQELPRSVNTSALSGAGVIRLFNKVGETVNKITYKMD--ENDPWFDDKITEVESLDANLQKLHNAMKSLVTSRRELSLLTGLVAKSAAMLSTCEEHTG---LSRALSNLADVEEKIELLRSEQANSDFFILAEFIKDYLGLFGAIKCIFHERVKAFQNWQYAQMQLSKRRENRGRFELANRADKLDQAQQEVDEGKVQRCQQQFDDISAEIKREMERFELTRVKDFKVNIIKYIEDQMAH 437          
BLAST of Sorting nexin vs. Ensembl Fly
Match: Snx1 (gene:FBgn0031534 transcript:FBtr0077517)

HSP 1 Score: 72.7886 bits (177), Expect = 2.911e-13
Identity = 102/419 (24.34%), Postives = 190/419 (45.35%), Query Frame = 1
Query:  142 DDEDLFQS-IAPNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREK----VVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKL-MKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIK---QVTATMDETLLRSNQKEEDSFFLNE--KVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKAR-SKGK---------------XXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKH 1317
            ++ DLF S ++P++  + +P QE   LT++ D  +++ +SD     +     + + V TKT + +FK  EFS  R+  +F+ +HD L       G I PPAP K     ++ K+  + SE    M ++  +  +A LE                F+ R A HP+L+ D++F  FLE D  L     +      G I+   +V  T+++   + +  E D +F ++  +V  +D  L    + +K+   +R+  S+    +  S A+    + HTG   LS     L+ V E++  L +  A  +   L++ ++ Y     A K + + R +A  +++ A   + K R ++G+               EV   +    +   +F  IS   K ++  F+  R+  FK N+ +  + Q+ H
Sbjct:   43 NESDLFVSALSPSSIGDIHPLQEV--LTDDGDYFISIVVSDPQKIGDGMGSYLAYKVTTKTNIPKFKRSEFSTLRRFSDFLGIHDLLVGKYMRLGRIIPPAPSKNIIGSTKVKISPQQSEPGTPMTQEWVEIRRAALER---------------FVHRTAQHPVLRVDLDFMNFLESDQELPRSVNTSALSGAGVIRLFNKVGETVNKITYKMD--ENDPWFDDKITEVESLDANLQKLHNAMKSLVTSRRELSLLTGLVAKSAAMLSTCEEHTG---LSRALSNLADVEEKIELLRSEQANSDFFILAEFIKDYLGLFGAIKCIFHERVKAFQNWQYAQMQLSKRRENRGRFELANRADKLDQAQQEVDEWQGKVQRCQQQFDDISAEIKREMERFELTRVKDFKVNIIKYIEDQMAH 439          
BLAST of Sorting nexin vs. Ensembl Zebrafish
Match: snx6 (sorting nexin 6 [Source:ZFIN;Acc:ZDB-GENE-050913-152])

HSP 1 Score: 389.037 bits (998), Expect = 6.078e-130
Identity = 218/400 (54.50%), Postives = 288/400 (72.00%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLK 1365
             P+  SE +       +   +D  L V+ISDA+SER+KV FTVHTK+TL  FK  EFSV RQHEEF+WLHD   E E+YAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHP+L+ D+NF +FLEY+ +LSVRGK++KEK   F K V  + D  L+ +  K+ D FF +EK +L++Y+  V+DS+ K+D+M R HKS +D    +++ L     Q  T   DL   FL +S++FE+ RK+E R+A DEDLKL+D L+YY  +SQAAK LLYRR RAL DYE+A K ++KAR+K K+V  AET Q     KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L++ L  LK
Sbjct:    8 GPDFLSEEDRGPRAVNVDLQTDATLQVDISDALSERDKVKFTVHTKSTLPNFKQNEFSVVRQHEEFIWLHDSFVENEEYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPVLRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNVVKSADGVLV-AGVKDVDDFFEHEKTFLLEYHNRVKDSSAKSDRMIRSHKSAADDINRIASTLYTLGTQDST---DLCKFFLKVSELFEKTRKIEARVAADEDLKLADLLKYYLRESQAAKDLLYRRGRALVDYENANKALDKARAKNKDVLQAETTQQVCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQSCLGVLK 403          
BLAST of Sorting nexin vs. Ensembl Zebrafish
Match: snx6 (sorting nexin 6 [Source:ZFIN;Acc:ZDB-GENE-050913-152])

HSP 1 Score: 389.037 bits (998), Expect = 6.926e-130
Identity = 218/400 (54.50%), Postives = 288/400 (72.00%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLK 1365
             P+  SE +       +   +D  L V+ISDA+SER+KV FTVHTK+TL  FK  EFSV RQHEEF+WLHD   E E+YAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHP+L+ D+NF +FLEY+ +LSVRGK++KEK   F K V  + D  L+ +  K+ D FF +EK +L++Y+  V+DS+ K+D+M R HKS +D    +++ L     Q  T   DL   FL +S++FE+ RK+E R+A DEDLKL+D L+YY  +SQAAK LLYRR RAL DYE+A K ++KAR+K K+V  AET Q     KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L++ L  LK
Sbjct:    9 GPDFLSEEDRGPRAVNVDLQTDATLQVDISDALSERDKVKFTVHTKSTLPNFKQNEFSVVRQHEEFIWLHDSFVENEEYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPVLRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNVVKSADGVLV-AGVKDVDDFFEHEKTFLLEYHNRVKDSSAKSDRMIRSHKSAADDINRIASTLYTLGTQDST---DLCKFFLKVSELFEKTRKIEARVAADEDLKLADLLKYYLRESQAAKDLLYRRGRALVDYENANKALDKARAKNKDVLQAETTQQVCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQSCLGVLK 404          
BLAST of Sorting nexin vs. Ensembl Zebrafish
Match: snx5 (sorting nexin 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2857])

HSP 1 Score: 361.303 bits (926), Expect = 3.476e-119
Identity = 203/384 (52.86%), Postives = 273/384 (71.09%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFL----ALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLK 1365
            N+D  L ++I DA+ ER+KV FTVHTKTTL  F+  +FSV RQHE+F+WLHD + ETE+YAG+I PPAPPKPDF+  R+K+ KL E E++M K+++ KMK ELEAEYLA FKKTV +HEVFLQRL++HP    D NF IFLEYD +LSVR K+ KE F GF K +  T DE L+ S  KE D FF  EK +L+DY   ++DST KA+KMTR HK+++D Y  +S AL           D +S F        +VFE++RK+E+R+A+D++LKL++ LRYY  D QAAK LLYRR+RALADYE++ K ++KAR KGK+V  AE  Q Q   KF ++S+S K ++  FK RR+  F+KNL E+T+L++KHA+  +  L+ ++  LK
Sbjct:   21 NNDASLLIDIPDALCERDKVKFTVHTKTTLSSFQKPDFSVPRQHEDFIWLHDAIVETEEYAGLIIPPAPPKPDFEGPREKMHKLGEGESSMTKEEYAKMKQELEAEYLAVFKKTVQVHEVFLQRLSSHPSFSKDRNFHIFLEYDQDLSVRRKNAKEMFGGFFKNMVKTADEVLI-SGVKEVDEFFEQEKTFLLDYSNKIKDSTAKAEKMTRSHKNVADDYNHISGALNSVAA------DNNSAFKKHLEKCVEVFEKLRKVEDRVASDQELKLTELLRYYTRDIQAAKDLLYRRARALADYENSNKALDKARLKGKDVPQAEENQKQCLQKFDRLSESGKKELTSFKARRVVAFRKNLIEMTELEIKHAKNSMSTLQGSIELLK 397          
BLAST of Sorting nexin vs. Ensembl Zebrafish
Match: si:dkey-28n18.9 (si:dkey-28n18.9 [Source:ZFIN;Acc:ZDB-GENE-131127-205])

HSP 1 Score: 50.0618 bits (118), Expect = 5.757e-6
Identity = 83/378 (21.96%), Postives = 156/378 (41.27%), Query Frame = 1
Query:  244 NVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLA---TFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAV-QPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLK 1365
            ++ I+D   + + + F +   T+ K   +    V R +E+F WL       E+  G+                 ++         P     + KA  +  +LA    ++      E +LQ+ A HP L        FL   +N    GK + +K  G   +++  ++E + + + K+ D+FF NE+    +   + + +T K   +    + ++ +    ST+L   V Q     +  S   L LS + E +++   ++A++    L   L       +A K +L+RR+  L + E+  K+ EKA+   +EV  A     +   +F  IS  AK +I  F   R+   K  +    + QL  A+   Q+    L + K
Sbjct:   16 SIRITDVTQDGDVLTFAI---TSQKLNSSAGVCVFRTYEDFDWLQQSFFSQENVPGL---------------QGIIFPPLPSKAFPLQSSTQAKALKQLGFLALGQNWQSYCKALEFYLQQAATHPTLCKCKALDSFL---TNSESPGKQKGKK--GIFNRLSQAVEE-MRKESHKDVDNFFQNERNKNTNLAASSKVATEKLLDVVMTEQKLALACGHFSTSLHLCVNQDDAAAVAFSKVCLKLSDIIEAIKRNFEKVASNNLSTLGLGLDLESRYQEAEKEMLFRRTCKLIELETVKKSTEKAKPHKREVMEAFQKAVEK--EFSLISSVAKEEIERFHASRVNVLKSFMVCWCEQQLDTAKECAQLYSQHLEAFK 367          
BLAST of Sorting nexin vs. Ensembl Xenopus
Match: snx6 (sorting nexin 6 [Source:NCBI gene;Acc:394595])

HSP 1 Score: 389.808 bits (1000), Expect = 4.942e-130
Identity = 217/399 (54.39%), Postives = 294/399 (73.68%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASL 1362
             P+  SE + +     +    D  L V+ISDA+SER+KV FTVHTK++L  FK  EFSV RQHEEF+WLHD   E E+YAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHPIL+ D+NF +FLEY+ +LSVRGK++KEK   F K V  + D  ++ S  K+ D FF +E+ +LV+Y+  V+D++ K+DKMTR HK+ +D Y  + +++     Q ++   D+   FL +S++F++ RK+E R+A DEDLKLSD L+YY  +SQAAK LLYRRSR+L DYE+A K ++KAR+K K+V AAET Q  +  KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L++ LA L
Sbjct:    9 GPDFLSEEDRAPRAINVDLQPDATLQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEEYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKSVVKSADGVIV-SGTKDVDDFFDHERTFLVEYHNRVKDASAKSDKMTRSHKNAADDYNRIGSSMYTLGTQDNS---DICKFFLRVSELFDKTRKIEARVAADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLAAETTQQLSCQKFEKISESAKQELMDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQSCLAVL 403          
BLAST of Sorting nexin vs. Ensembl Xenopus
Match: snx6 (sorting nexin 6 [Source:NCBI gene;Acc:394595])

HSP 1 Score: 388.652 bits (997), Expect = 1.144e-129
Identity = 216/392 (55.10%), Postives = 291/392 (74.23%), Query Frame = 1
Query:  190 SNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASL 1362
            S+P      +    D  L V+ISDA+SER+KV FTVHTK++L  FK  EFSV RQHEEF+WLHD   E E+YAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHPIL+ D+NF +FLEY+ +LSVRGK++KEK   F K V  + D  ++ S  K+ D FF +E+ +LV+Y+  V+D++ K+DKMTR HK+ +D Y  + +++     Q ++   D+   FL +S++F++ RK+E R+A DEDLKLSD L+YY  +SQAAK LLYRRSR+L DYE+A K ++KAR+K K+V AAET Q  +  KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L++ LA L
Sbjct:   12 SSPDPRAINVDLQPDATLQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEEYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKSVVKSADGVIV-SGTKDVDDFFDHERTFLVEYHNRVKDASAKSDKMTRSHKNAADDYNRIGSSMYTLGTQDNS---DICKFFLRVSELFDKTRKIEARVAADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLAAETTQQLSCQKFEKISESAKQELMDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQSCLAVL 399          
BLAST of Sorting nexin vs. Ensembl Xenopus
Match: snx6 (sorting nexin 6 [Source:NCBI gene;Acc:394595])

HSP 1 Score: 388.267 bits (996), Expect = 1.493e-129
Identity = 214/379 (56.46%), Postives = 287/379 (75.73%), Query Frame = 1
Query:  229 SDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASL 1362
             D  L V+ISDA+SER+KV FTVHTK++L  FK  EFSV RQHEEF+WLHD   E E+YAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHPIL+ D+NF +FLEY+ +LSVRGK++KEK   F K V  + D  ++ S  K+ D FF +E+ +LV+Y+  V+D++ K+DKMTR HK+ +D Y  + +++     Q ++   D+   FL +S++F++ RK+E R+A DEDLKLSD L+YY  +SQAAK LLYRRSR+L DYE+A K ++KAR+K K+V AAET Q  +  KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L++ LA L
Sbjct:   21 PDATLQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEEYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKSVVKSADGVIV-SGTKDVDDFFDHERTFLVEYHNRVKDASAKSDKMTRSHKNAADDYNRIGSSMYTLGTQDNS---DICKFFLRVSELFDKTRKIEARVAADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLAAETTQQLSCQKFEKISESAKQELMDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQSCLAVL 395          
BLAST of Sorting nexin vs. Ensembl Xenopus
Match: snx6 (sorting nexin 6 [Source:NCBI gene;Acc:394595])

HSP 1 Score: 381.333 bits (978), Expect = 2.996e-127
Identity = 219/394 (55.58%), Postives = 283/394 (71.83%), Query Frame = 1
Query:  184 SESNPSQEKNE-LTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASL 1362
            SES     KNE L  N D  L V+ISDA+SER+KV FTVHTK++L  FK  EFSV RQHEEF+WLHD   E E+YAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHPIL+ D+NF +FLEY+ +LSVRGK++KEK   F K V  + D  ++ S  K+ D FF +E+ +LV+Y+  V+D++ K+DKMTR HK                          S  FL +S++F++ RK+E R+A DEDLKLSD L+YY  +SQAAK LLYRRSR+L DYE+A K ++KAR+K K+V AAET Q  +  KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L++ LA L
Sbjct:    6 SESEGGTFKNENLVFNPDATLQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEEYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKSVVKSADGVIV-SGTKDVDDFFDHERTFLVEYHNRVKDASAKSDKMTRSHK--------------------------SKFFLRVSELFDKTRKIEARVAADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLAAETTQQLSCQKFEKISESAKQELMDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQSCLAVL 372          
BLAST of Sorting nexin vs. Ensembl Xenopus
Match: snx6 (sorting nexin 6 [Source:NCBI gene;Acc:394595])

HSP 1 Score: 376.711 bits (966), Expect = 2.617e-125
Identity = 214/398 (53.77%), Postives = 282/398 (70.85%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASL 1362
             P+  SE + +     +    D  L V+ISDA+SER+KV FTVHTK++L  FK  EFSV RQHEEF+WLHD   E E+YAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHPIL+ D+NF +FLEY+ +LSVRGK++KEK   F K V  + D  ++ S  K+ D FF +E+ +LV+Y+  V+D++ K+DKMTR HK                          S  FL +S++F++ RK+E R+A DEDLKLSD L+YY  +SQAAK LLYRRSR+L DYE+A K ++KAR+K K+V AAET Q  +  KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L++ LA L
Sbjct:    8 GPDFLSEEDRAPRAINVDLQPDATLQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEEYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKSVVKSADGVIV-SGTKDVDDFFDHERTFLVEYHNRVKDASAKSDKMTRSHK--------------------------SKFFLRVSELFDKTRKIEARVAADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLAAETTQQLSCQKFEKISESAKQELMDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQSCLAVL 378          
BLAST of Sorting nexin vs. Ensembl Mouse
Match: Snx6 (sorting nexin 6 [Source:MGI Symbol;Acc:MGI:1919433])

HSP 1 Score: 388.267 bits (996), Expect = 1.163e-129
Identity = 216/399 (54.14%), Postives = 292/399 (73.18%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASL 1362
             P+  SE +   +   +   SD  L V+ISDA+SER++V FTVHTK++L  FK  EFSV RQHEEF+WLHD   E EDYAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHPIL+ D+NF +FLEY+ +LSVRGK++KEK   F K +  + D  ++ S  K+ D FF +E+ +L++Y+  V+D++ K+D+MTR HKS +D Y  + ++L     Q  T   D+   FL +S++F++ RK+E R++ DEDLKLSD L+YY  +SQAAK LLYRRSR+L DYE+A K ++KAR+K K+V  AET+Q     KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L+  LA L
Sbjct:    8 GPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDRVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIV-SGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDST---DICKFFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVL 402          
BLAST of Sorting nexin vs. Ensembl Mouse
Match: Snx32 (sorting nexin 32 [Source:MGI Symbol;Acc:MGI:2444704])

HSP 1 Score: 385.571 bits (989), Expect = 1.425e-128
Identity = 213/397 (53.65%), Postives = 283/397 (71.28%), Query Frame = 1
Query:  181 ASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLR--SNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLK 1365
             +ES PS    +L  +S   L VEISDA+SER+KV FTV TK+ L  F   EFSV RQHEEF+WLHD   E E+YAG+I PPAPP+PDF+ SR+KL KL E  +++ +++F KMK ELEAEYLA FKKTVAMHEVFLQRLAAHP L+ D NFS+FLEY  +LSVR K+RKE   G ++ +  + DE L+   S  KE D FF +E+ +LV+Y+  +RD+  +AD++   HK ++D+YI +S AL          L  S  FL L+++FE +RKLE R+A+DEDLKLSD LRYY  DSQAAK LLYRR RALADYE+A K ++KAR++ +EV  AE+ Q     +F+++SDSAK +++DFK RR++ F+KNL EL +L+LKHA+    +L+  L +LK
Sbjct:    9 GNESKPSSTSVDLQGDSP--LQVEISDAVSERDKVKFTVQTKSGLPHFAQSEFSVVRQHEEFIWLHDTYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGNSSITREEFSKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFSVFLEYSQDLSVREKNRKEVLGGLLRSIVRSADEVLITGISGLKEVDDFFEHERTFLVEYHTRIRDTCQRADRVMHSHKCLADNYIPISAALSSLGTQEVNQLKRS--FLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESRQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLLLQNTLVALK 401          
BLAST of Sorting nexin vs. Ensembl Mouse
Match: Snx32 (sorting nexin 32 [Source:MGI Symbol;Acc:MGI:2444704])

HSP 1 Score: 380.563 bits (976), Expect = 4.954e-126
Identity = 209/383 (54.57%), Postives = 276/383 (72.06%), Query Frame = 1
Query:  181 ASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLR--SNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHAR 1323
             +ES PS    +L  +S   L VEISDA+SER+KV FTV TK+ L  F   EFSV RQHEEF+WLHD   E E+YAG+I PPAPP+PDF+ SR+KL KL E  +++ +++F KMK ELEAEYLA FKKTVAMHEVFLQRLAAHP L+ D NFS+FLEY  +LSVR K+RKE   G ++ +  + DE L+   S  KE D FF +E+ +LV+Y+  +RD+  +AD++   HK ++D+YI +S AL          L  S  FL L+++FE +RKLE R+A+DEDLKLSD LRYY  DSQAAK LLYRR RALADYE+A K ++KAR++ +EV  AE+ Q     +F+++SDSAK +++DFK RR++ F+KNL EL +L+LKHA+
Sbjct:    9 GNESKPSSTSVDLQGDSP--LQVEISDAVSERDKVKFTVQTKSGLPHFAQSEFSVVRQHEEFIWLHDTYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGNSSITREEFSKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFSVFLEYSQDLSVREKNRKEVLGGLLRSIVRSADEVLITGISGLKEVDDFFEHERTFLVEYHTRIRDTCQRADRVMHSHKCLADNYIPISAALSSLGTQEVNQLKRS--FLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESRQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAK 387          
BLAST of Sorting nexin vs. Ensembl Mouse
Match: Snx5 (sorting nexin 5 [Source:MGI Symbol;Acc:MGI:1916428])

HSP 1 Score: 369.007 bits (946), Expect = 3.702e-122
Identity = 201/377 (53.32%), Postives = 279/377 (74.01%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTAL 1353
            N D  L ++I DA+SER+KV FTVHTKTTL  F++ EFSV RQHE+FVWLHD L ET DYAG+I PPAP KPDFD  R+K+ KL E E +M K++F KMK ELEAEYLA FKKTV+ HEVFLQRL++HP+L  D NF +FLEYD +LSVR K+ KE F GF K V  + DE L  S  KE D FF  EK +L++YY  ++DS  KADKMTR HK+++D YI  +  L   A++  T    +    L ++++FE++RK+E R+++DEDLKL++ LRYY  + +AAK LLYRR++AL DYE++ K ++KAR K K+V  AET Q +   KF+++S+SAK ++++FK++R+A F+KNL E+++L++KHAR ++ +L++ +
Sbjct:   26 NVDPSLQIDIPDALSERDKVKFTVHTKTTLSTFQSPEFSVTRQHEDFVWLHDTLTETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSTHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLF-SGVKEVDDFFEQEKNFLINYYNRIKDSCAKADKMTRSHKNVADDYIHTAACLHSLALEEPTV---IKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAETHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCI 398          
BLAST of Sorting nexin vs. Ensembl Mouse
Match: Snx5 (sorting nexin 5 [Source:MGI Symbol;Acc:MGI:1916428])

HSP 1 Score: 369.007 bits (946), Expect = 3.702e-122
Identity = 201/377 (53.32%), Postives = 279/377 (74.01%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTAL 1353
            N D  L ++I DA+SER+KV FTVHTKTTL  F++ EFSV RQHE+FVWLHD L ET DYAG+I PPAP KPDFD  R+K+ KL E E +M K++F KMK ELEAEYLA FKKTV+ HEVFLQRL++HP+L  D NF +FLEYD +LSVR K+ KE F GF K V  + DE L  S  KE D FF  EK +L++YY  ++DS  KADKMTR HK+++D YI  +  L   A++  T    +    L ++++FE++RK+E R+++DEDLKL++ LRYY  + +AAK LLYRR++AL DYE++ K ++KAR K K+V  AET Q +   KF+++S+SAK ++++FK++R+A F+KNL E+++L++KHAR ++ +L++ +
Sbjct:   26 NVDPSLQIDIPDALSERDKVKFTVHTKTTLSTFQSPEFSVTRQHEDFVWLHDTLTETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSTHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLF-SGVKEVDDFFEQEKNFLINYYNRIKDSCAKADKMTRSHKNVADDYIHTAACLHSLALEEPTV---IKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAETHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCI 398          
BLAST of Sorting nexin vs. UniProt/SwissProt
Match: sp|Q86XE0|SNX32_HUMAN (Sorting nexin-32 OS=Homo sapiens OX=9606 GN=SNX32 PE=1 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 9.436e-131
Identity = 213/397 (53.65%), Postives = 285/397 (71.79%), Query Frame = 1
Query:  181 ASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLL--RSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLK 1365
              E  PS    +L  +S   L VEISDA+SER+KV FTV TK+ L  F   EFSV RQHEEF+WLHD   E E+YAG+I PPAPP+PDF+ SR+KL KL E ++++ +++F KMK ELEAEYLA FKKTVAMHEVFLQRLAAHP L+ D NF +FLEY  +LSVRGK+RKE   GF++ +  + DE L+   S  KE D FF +E+ +L++Y+  +RD+ ++AD++ R HK ++D YI +S AL            L ++FL L+++FE +RKLE R+A+DEDLKLSD LRYY  DSQAAK LLYRR RALADYE+A K ++KAR++ +EV  AE+ Q     +F+++SDSAK +++DFK RR++ F+KNL EL +L+LKHA+    +LR  L +LK
Sbjct:    8 GKEGKPSCASVDLQGDSS--LQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGGFLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVN--QLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALK 400          
BLAST of Sorting nexin vs. UniProt/SwissProt
Match: sp|Q5R613|SNX6_PONAB (Sorting nexin-6 OS=Pongo abelii OX=9601 GN=SNX6 PE=2 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 3.076e-129
Identity = 217/399 (54.39%), Postives = 292/399 (73.18%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASL 1362
             P+  SE +   +   +   SD  L V+ISDA+SER+KV FTVHTK++L  FK  EFSV RQHEEF+WLHD   E EDYAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHPIL+ D+NF +FLEY+ +LSVRGK++KEK   F K +  + D  ++ S  K+ D FF +E+ +L++Y+  V+D++ K+D+MTR HKS +D Y  + ++L     Q  T   D+   FL +S++F++ RK+E R++ DEDLKLSD L+YY  +SQAAK LLYRRSR+L DYE+A K ++KAR+K K+V  AET+Q     KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L+  LA L
Sbjct:    8 GPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIV-SGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDST---DICKFFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVL 402          
BLAST of Sorting nexin vs. UniProt/SwissProt
Match: sp|Q9UNH7|SNX6_HUMAN (Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6 PE=1 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 3.502e-129
Identity = 217/399 (54.39%), Postives = 292/399 (73.18%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASL 1362
             P+  SE +   +   +   SD  L V+ISDA+SER+KV FTVHTK++L  FK  EFSV RQHEEF+WLHD   E EDYAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHPIL+ D+NF +FLEY+ +LSVRGK++KEK   F K +  + D  ++ S  K+ D FF +E+ +L++Y+  V+D++ K+D+MTR HKS +D Y  + ++L     Q  T   D+   FL +S++F++ RK+E R++ DEDLKLSD L+YY  +SQAAK LLYRRSR+L DYE+A K ++KAR+K K+V  AET+Q     KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L+  LA L
Sbjct:    8 GPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRRDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIV-SGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDST---DICKFFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVL 402          
BLAST of Sorting nexin vs. UniProt/SwissProt
Match: sp|Q6P8X1|SNX6_MOUSE (Sorting nexin-6 OS=Mus musculus OX=10090 GN=Snx6 PE=1 SV=2)

HSP 1 Score: 388.267 bits (996), Expect = 8.136e-129
Identity = 216/399 (54.14%), Postives = 292/399 (73.18%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASL 1362
             P+  SE +   +   +   SD  L V+ISDA+SER++V FTVHTK++L  FK  EFSV RQHEEF+WLHD   E EDYAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHPIL+ D+NF +FLEY+ +LSVRGK++KEK   F K +  + D  ++ S  K+ D FF +E+ +L++Y+  V+D++ K+D+MTR HKS +D Y  + ++L     Q  T   D+   FL +S++F++ RK+E R++ DEDLKLSD L+YY  +SQAAK LLYRRSR+L DYE+A K ++KAR+K K+V  AET+Q     KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L+  LA L
Sbjct:    8 GPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDRVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIV-SGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDST---DICKFFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVL 402          
BLAST of Sorting nexin vs. UniProt/SwissProt
Match: sp|Q80ZJ7|SNX32_MOUSE (Sorting nexin-32 OS=Mus musculus OX=10090 GN=Snx32 PE=2 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 9.965e-128
Identity = 213/397 (53.65%), Postives = 283/397 (71.28%), Query Frame = 1
Query:  181 ASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLR--SNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLK 1365
             +ES PS    +L  +S   L VEISDA+SER+KV FTV TK+ L  F   EFSV RQHEEF+WLHD   E E+YAG+I PPAPP+PDF+ SR+KL KL E  +++ +++F KMK ELEAEYLA FKKTVAMHEVFLQRLAAHP L+ D NFS+FLEY  +LSVR K+RKE   G ++ +  + DE L+   S  KE D FF +E+ +LV+Y+  +RD+  +AD++   HK ++D+YI +S AL          L  S  FL L+++FE +RKLE R+A+DEDLKLSD LRYY  DSQAAK LLYRR RALADYE+A K ++KAR++ +EV  AE+ Q     +F+++SDSAK +++DFK RR++ F+KNL EL +L+LKHA+    +L+  L +LK
Sbjct:    9 GNESKPSSTSVDLQGDSP--LQVEISDAVSERDKVKFTVQTKSGLPHFAQSEFSVVRQHEEFIWLHDTYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGNSSITREEFSKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFSVFLEYSQDLSVREKNRKEVLGGLLRSIVRSADEVLITGISGLKEVDDFFEHERTFLVEYHTRIRDTCQRADRVMHSHKCLADNYIPISAALSSLGTQEVNQLKRS--FLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESRQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLLLQNTLVALK 401          
BLAST of Sorting nexin vs. TrEMBL
Match: A0A1S3JVG7 (Sorting nexin OS=Lingula unguis OX=7574 GN=LOC106176296 PE=3 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 3.496e-143
Identity = 237/412 (57.52%), Postives = 306/412 (74.27%), Query Frame = 1
Query:  133 IHGDDEDLFQSIAPNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKE 1368
            + G DE       P+  +E  P     +L   +D  L V+ISDA+SER+KV FTVHTKTTL +FK  EFSV RQHEEFVWLHD+  E E+YAG++ PPAPP+PDFD SR+KL +L E E  M K++F KMK ELEAEYLATFKKTVAMHEVFLQRLA HP L+NDVNF +FLEYD +LSVRGK++KE+ +GF K +T T DE LL SNQK+ D FF +EK +LV+Y+  ++D+T + DK+TR HK+++DSYI +S+ L         +LD    F  L++ FE+ RKLE R+A+DEDLKLSDTLRYY  DS A K LLYRR R+LADYE+A K ++KARSK K+V  AET Q  A DKF+KIS++AK ++ +FK RRIA+F+KN+ +L +L+LKHA+  +Q+L+  LA+LKE
Sbjct:    2 MDGSDE------GPDLLAEDKPRSVSVDL--ETDTSLQVDISDALSERDKVKFTVHTKTTLPEFKQPEFSVVRQHEEFVWLHDRYNENEEYAGIVIPPAPPRPDFDASREKLQRLGEGEGTMTKEEFQKMKQELEAEYLATFKKTVAMHEVFLQRLAGHPQLRNDVNFKVFLEYDQDLSVRGKNKKERISGFFKNMTKTADEVLL-SNQKDVDEFFESEKGFLVEYHSKIKDATARGDKLTRAHKNVADSYIAISSGLTQLATIENTELD--KLFTKLAEFFEKARKLEGRVASDEDLKLSDTLRYYMRDSSAGKDLLYRRLRSLADYENANKALDKARSKNKDVHTAETQQQAACDKFEKISETAKGELTNFKTRRIAHFRKNMVDLVELELKHAKAQVQLLKNTLANLKE 402          
BLAST of Sorting nexin vs. TrEMBL
Match: A0A0L8H0E1 (Sorting nexin OS=Octopus bimaculoides OX=37653 GN=OCBIM_22024936mg PE=3 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 1.185e-140
Identity = 228/384 (59.38%), Postives = 297/384 (77.34%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHT-GDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKESS 1374
            ++D  L V+ISDA+SER+KV FTVHTKTTL QF+  EFSV RQHEEF+WLHD+  E E+YAG++ PPAPP+PDFD SR+KL +L E E NM K++F KMK ELEAEYLATFKKTVAMHEVFLQRLAAHP L+ DVNF +FLEY  +LSVRGK++KEK  GF K +T + DE LL SNQK+ D FF  +K +LV+Y++ ++D+  K+D+MT+ HK+++D YI +S+     VQ  T  + +L   F  L++  E+ RKLE R+A+DEDLK+SDTLRYY  DS AAK LLYRRSRALADYE A K ++KAR+K K+VA AE  Q QA++KF+KISD+A+ ++ +FK RRIAYF+KN  EL +L+LKHAR  +Q+L+  + ++KE S
Sbjct:   50 STDSSLVVDISDALSERDKVKFTVHTKTTLPQFQEPEFSVVRQHEEFIWLHDRYVENEEYAGIVIPPAPPRPDFDASREKLQRLGEGEGNMTKEEFTKMKQELEAEYLATFKKTVAMHEVFLQRLAAHPTLRGDVNFQVFLEYSQDLSVRGKNKKEKLGGFFKSITKSADEVLL-SNQKDVDDFFEQQKTFLVEYHVKIKDAATKSDRMTKTHKNVADCYIQISSGF---VQIATIENTELEKIFTRLTEALEKARKLEGRVASDEDLKISDTLRYYMRDSAAAKDLLYRRSRALADYEQANKALDKARTKNKDVALAEKNQLQAFEKFEKISDNARKELTEFKTRRIAYFRKNFVELVELELKHARAQLQLLKNCIVAMKEES 429          
BLAST of Sorting nexin vs. TrEMBL
Match: V4AW12 (Sorting nexin OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_225261 PE=3 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 6.050e-139
Identity = 237/404 (58.66%), Postives = 307/404 (75.99%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQ-FKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHT-GDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKESS 1374
            +P+  +E N  + +++  + +D  L V+ISDA+SER+KV FTVHTKTTL Q FK  EFSV RQHEEF+WLHD+  E E+YAG+I PPAPPKPDFD SR+KL +L E E  M +++F KMK ELEAEYLATFKKTVAMHEVFLQRLAAHP+L+ DVNF +FLE+DS+LSVRGK++KEK  GF + +  T DE LL S  K+ D FF NEK +LV+Y+  ++DST KAD+MTR HK+++D+YI +S+AL   VQ  T  + +L   F  +++  E+ RKLE R+ATDEDLKLSDTLRYY  DS A K LLYRR+R+LADYE+A K +EKAR+K KEV  AE  Q    +KF+KIS++AK ++ +FK RRIAYFKKNL E+T+L+LKHA   IQ+L+  + +LK+ S
Sbjct:    8 SPDLLAEDNV-KSRSDTVDLTDTSLVVDISDALSERDKVKFTVHTKTTLLQRFKQAEFSVVRQHEEFIWLHDRYVENEEYAGIIIPPAPPKPDFDASREKLQRLGEGEGTMTREEFVKMKQELEAEYLATFKKTVAMHEVFLQRLAAHPVLKTDVNFEVFLEFDSDLSVRGKNKKEKIGGFFRNIGKTADEALL-SQHKDVDEFFENEKQFLVEYHNKIKDSTGKADRMTRVHKNVADTYIQISSAL---VQLATLENTELDKIFTKVAEALEKARKLEGRVATDEDLKLSDTLRYYMRDSAAGKDLLYRRARSLADYENANKALEKARTKNKEVQQAERVQQTCCEKFEKISETAKKELTEFKTRRIAYFKKNLVEITELELKHANAQIQLLKNCIGALKKES 406          
BLAST of Sorting nexin vs. TrEMBL
Match: R7TJM9 (PX domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_183253 PE=4 SV=1)

HSP 1 Score: 412.535 bits (1059), Expect = 9.852e-136
Identity = 226/401 (56.36%), Postives = 305/401 (76.06%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHT-GDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKE 1368
             P+  +E + ++ +N +  N+D  L V+ISDA+SER+KV FTVHTKT+L +F+  EFSV RQHEEFVWLHD+ EETE+YAGVI PPAPPKPDFD SR+KL +L E E  M K++F KMK ELEAEYLATFKKTVAMHEVFLQR+AAHP+L++D NF +FLEY  +LSVRGK++KEK +GF K V+ + DE LL SNQKE D FF +++++L++Y+  ++D+T K D+MT+ HK+++DSYI +S+ L   +Q  T  D  L      ++  FE+ RK+E R+A+DEDLKLSDTLRYY  DS AAK LLYRR RALA+YE A K ++KAR+K K+V  AE  Q    +KF+KIS+ AK ++ DFK RRI++F+KN+ +L +L+LKHA+  +Q+L+  + +LKE
Sbjct:    8 GPDLLAEEHKNKSEN-VDLNTDTSLVVDISDALSERDKVKFTVHTKTSLVEFQQPEFSVVRQHEEFVWLHDRYEETEEYAGVIIPPAPPKPDFDASREKLQRLGEGEGTMTKEEFQKMKQELEAEYLATFKKTVAMHEVFLQRIAAHPLLRDDHNFRVFLEYGQDLSVRGKNKKEKLSGFFKTVSQSADEVLL-SNQKEVDDFFEHQRMFLLEYHTRIKDATGKCDRMTKSHKNVADSYIKISSGL---LQLSTIDDSSLDKLLSQMADGFEKARKIEGRVASDEDLKLSDTLRYYMRDSNAAKNLLYRRLRALANYEKANKDLDKARAKNKDVGVAENNQQMMCEKFEKISEVAKGELTDFKGRRISHFRKNMVDLAELELKHAKAQVQLLKQVITNLKE 403          
BLAST of Sorting nexin vs. TrEMBL
Match: K1PEW1 (Sorting nexin OS=Crassostrea gigas OX=29159 GN=CGI_10006896 PE=3 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 2.353e-135
Identity = 227/383 (59.27%), Postives = 288/383 (75.20%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKESS 1374
            ++D  L V+ISDA+SER+K+ FTVHTKTT  +FK  +FSV RQHEEFVWLHD+  E E+YAGVI PPAPPKPDF+ SR+KL KL E E  M K++F KMK ELEAEYLATFKKTVAMHEVFLQR+AAHP L+NDVNF +FL YD +LSVRGK++KEK  GF K +T T DE LL +N K+ D FF NEK +L++Y+  ++D+T K+D+MT+ H  ++DSYI +S+           +LD    F  +++  E+ RKLE R+ATDEDLKLSDTLRYY  DS AAK LLYRR+RALADYE+A K +EKAR K KEVA AE  Q  A +KF+KIS+ AK ++ +FK RRIAYFKKNL +L +L+LKHAR   Q+L   + +L++ +
Sbjct:   28 STDTSLLVDISDALSERDKIKFTVHTKTTQSRFKESDFSVVRQHEEFVWLHDRFVENEEYAGVIIPPAPPKPDFEASREKLQKLGEGEGTMTKEEFTKMKQELEAEYLATFKKTVAMHEVFLQRIAAHPQLKNDVNFEVFLAYDQDLSVRGKNKKEKIGGFFKSITKTADEVLL-ANLKDVDEFFENEKSFLMEYHNKIKDATQKSDRMTKCHGEVADSYIQISSGFVQLATVENTELD--KIFTKVAEALEKTRKLEGRVATDEDLKLSDTLRYYMKDSSAAKDLLYRRARALADYENANKALEKARLKNKEVAQAEKTQQTACEKFEKISEVAKKELTEFKTRRIAYFKKNLVDLVELELKHARAQTQLLTNCINALRDDA 407          
BLAST of Sorting nexin vs. Ensembl Cavefish
Match: snx6 (sorting nexin 6 [Source:NCBI gene;Acc:103040510])

HSP 1 Score: 388.652 bits (997), Expect = 7.944e-130
Identity = 217/400 (54.25%), Postives = 289/400 (72.25%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLK 1365
             P+  SE +       +   +D  L V+ISDA+SER+KV FTVHTK+TL  FK  EFSV RQHEEF+WLHD   E E+YAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHP+L+ D+NF +FLEY+ +LSVRGK++KEK   F K V  + D  ++ S  K+ D FF +EK +L++Y+  V+D++ K+D+M R HKS +D    +++ L     Q  T   D+   FL +S++FE+ RK+E R+A DEDLKL+D L+YY  +SQAAK LLYRR RAL DYE+A K ++KAR+K K+V  AET Q     KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L++ LA LK
Sbjct:    9 GPDFLSEEDRGPRAVNVDLQTDATLQVDISDALSERDKVKFTVHTKSTLPNFKQNEFSVVRQHEEFIWLHDSFVENEEYAGFIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPVLRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNVVKSADGVIV-SGVKDVDDFFEHEKTFLLEYHNRVKDASAKSDRMIRSHKSAADDINRIASTLYTLGTQDST---DVCKFFLKVSELFEKTRKIEARVAADEDLKLADLLKYYLRESQAAKDLLYRRGRALVDYENANKALDKARAKNKDVLQAETTQQVCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQSCLAVLK 404          
BLAST of Sorting nexin vs. Ensembl Cavefish
Match: snx6 (sorting nexin 6 [Source:NCBI gene;Acc:103040510])

HSP 1 Score: 379.407 bits (973), Expect = 1.833e-126
Identity = 215/397 (54.16%), Postives = 287/397 (72.29%), Query Frame = 1
Query:  175 NNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLK 1365
             ++ ES+P     +L   +D  L V+ISDA+SER+KV FTVHTK+TL  FK  EFSV RQHEEF+WLHD   E E+YAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHP+L+ D+NF +FLEY+ +LSVRGK++KEK   F K V  + D  ++ S  K+ D FF +EK +L++Y+  V+D++ K+D+M R HK++          +E      T  L +   FL +S++FE+ RK+E R+A DEDLKL+D L+YY  +SQAAK LLYRR RAL DYE+A K ++KAR+K K+V  AET Q     KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L++ LA LK
Sbjct:   10 GSSKESHPRAVNVDL--QTDATLQVDISDALSERDKVKFTVHTKSTLPNFKQNEFSVVRQHEEFIWLHDSFVENEEYAGFIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPVLRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNVVKSADGVIV-SGVKDVDDFFEHEKTFLLEYHNRVKDASAKSDRMIRSHKTL--------CLME------TFFLFVCRFFLKVSELFEKTRKIEARVAADEDLKLADLLKYYLRESQAAKDLLYRRGRALVDYENANKALDKARAKNKDVLQAETTQQVCCQKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQSCLAVLK 389          
BLAST of Sorting nexin vs. Ensembl Cavefish
Match: snx5 (sorting nexin 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2857])

HSP 1 Score: 359.377 bits (921), Expect = 6.278e-118
Identity = 196/381 (51.44%), Postives = 272/381 (71.39%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLK 1365
            N+D  L ++I DA+ ER+KV FTVHTKTTL  F+  EFSV RQHE+F+WLHD L ETE+YAG+I PPAPPKPDF+  R+K+ KL E E+ M K+++ KMK ELEAEYLA FKKTV +HE+FLQRL++HP+   D NF IFLEYD +LSVR K+ KE F GF K +  + DE L+ S  K+ D FF  EK +L+DY+  ++D+T KA+KMTR HK+++D YI +S  + +   + +T    L +     S++ E++RK+E R+A+D++LKL++ LRYY  D QAAK LLYRR+RALADYE++ K ++KAR K K++  AE  Q Q   KF K+S+S K ++  FK RR+  F+KNL E+ +L++KHA+    +L+  +  LK
Sbjct:   71 NNDSSLLIDIPDALCERDKVKFTVHTKTTLNSFQKPEFSVPRQHEDFIWLHDTLVETEEYAGLIIPPAPPKPDFEGPREKMHKLGEGESTMTKEEYAKMKQELEAEYLAVFKKTVQVHEIFLQRLSSHPVFSKDRNFQIFLEYDQDLSVRRKNAKEFFGGFFKNMVKSADEVLI-SGIKDVDEFFEQEKTFLLDYFSKIKDATAKAEKMTRSHKNVADDYIHISATVSNIGAEDNTA---LKTHLEKFSELLEKLRKVEGRVASDQELKLTELLRYYMRDIQAAKDLLYRRARALADYENSNKALDKARLKSKDIPQAEENQRQCLQKFDKLSESGKQELTSFKGRRVVAFRKNLIEMAELEIKHAKNSTALLQGCIEMLK 447          
BLAST of Sorting nexin vs. Ensembl Cavefish
Match: snx5 (sorting nexin 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2857])

HSP 1 Score: 347.821 bits (891), Expect = 1.703e-114
Identity = 194/370 (52.43%), Postives = 259/370 (70.00%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQ 1335
            N+D  L ++I DA+ ER+KV FTVHTKTTL  F+  EFSV RQHE+F+WLHD L ETE+YAG+I PPAPPKPDF+  R+K+ KL E E+ M K+++ KMK ELEAEYLA FKKTV +HE+FLQRL++HP+   D NF IFLEYD +LSVR K+ KE F GF K +  + DE L+ S  K+ D FF  EK +L+DY+  ++D+T KA+KMTR HK+++D YI +S      V  HTG                  RK+E R+A+D++LKL++ LRYY  D QAAK LLYRR+RALADYE++ K ++KAR K K++  AE  Q Q   KF K+S+S K ++  FK RR+  F+KNL E+ +L++KHA+  I+
Sbjct:    9 NNDSSLLIDIPDALCERDKVKFTVHTKTTLNSFQKPEFSVPRQHEDFIWLHDTLVETEEYAGLIIPPAPPKPDFEGPREKMHKLGEGESTMTKEEYAKMKQELEAEYLAVFKKTVQVHEIFLQRLSSHPVFSKDRNFQIFLEYDQDLSVRRKNAKEFFGGFFKNMVKSADEVLI-SGIKDVDEFFEQEKTFLLDYFSKIKDATAKAEKMTRSHKNVADDYIHISA----TVILHTG----------------VPRKVEGRVASDQELKLTELLRYYMRDIQAAKDLLYRRARALADYENSNKALDKARLKSKDIPQAEENQRQCLQKFDKLSESGKQELTSFKGRRVVAFRKNLIEMAELEIKHAKVRIK 357          
BLAST of Sorting nexin vs. Ensembl Cavefish
Match: si:dkey-28n18.9 (si:dkey-28n18.9 [Source:ZFIN;Acc:ZDB-GENE-131127-205])

HSP 1 Score: 56.225 bits (134), Expect = 5.169e-8
Identity = 95/391 (24.30%), Postives = 164/391 (41.94%), Query Frame = 1
Query:  187 ESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLA------TFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIK-ADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLS-STFLALSKVFEEVR----KLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHAR 1323
            ES PS   N          +++I+D   + E + F +   T+ K   +    V R +E+F WL   L   ED  G++  P                       +P   F + KA L+  +LA       ++K +   E++LQ++AAH  L      S F    S+    GK R +K  G   +++  M+E + +   K+ D FF +E+       +  + ST K  D +  +  +++  +   S  L   V  H     ++ S  L LS + E V+    K+ +   +   L L    RY     +A K +L+RR+  L + E+A +  E+A+   K +       TQ   +F  IS  AK +I  + + R++  +  L    + QL  A+
Sbjct:    6 ESAPSVSAN----------SIKITDITQDGETLTFAI---TSQKSNSSAGVCVFRTYEDFDWLQQSLLSQEDVPGLLGFPPL-----------------PGKPLPSTSFTQAKA-LKQFFLALGDEWKIYRKAL---ELYLQQVAAHTTLSKSKALSSFF---SSTESPGKQRGKK--GIFNRLSHVMEE-MRKEGHKDVDKFFQSERDSCTHLSVLFKVSTEKFLDTVLTKQLAVACGHFSTSLHL---VCNHDNPAAVTFSICLKLSDIIEAVKVNFEKVSDNDVSSMGLALDLESRY----QEAKKEMLFRRTCKLVELEAANRNSERAKPNKKAIMEGVQKATQK--EFNLISSVAKKEIEQYHRARVSVLRDFLVSWCEKQLSTAQ 347          
BLAST of Sorting nexin vs. Ensembl Sea Lamprey
Match: snx6 (sorting nexin 6 [Source:ZFIN;Acc:ZDB-GENE-050913-152])

HSP 1 Score: 408.297 bits (1048), Expect = 3.655e-138
Identity = 221/382 (57.85%), Postives = 291/382 (76.18%), Query Frame = 1
Query:  226 NSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKE 1368
            +SD  L V+ISDA+SER+KV FTVHTKTTL  FK  EFSV RQHEEF+WLHD  EE E+YAG+I PPAPP+PDFD SR+KL KL E E  M K++F KMK ELEAEYLA FKKTVAMHEVFL RLAAHP+L+ D NF +FLEYD +LSVRGK++KEKF GF+K +  T DE L+ +  K+ D FF +EK ++++Y+  ++D+T+KADKMTR HK++++ YI +S+ +     Q  T   +LS  FL  +++ E+ RKLE R+A+DEDLKLSD LRYY  DSQAAK LLYRR+R+L DYE+A K ++KAR+K K+V  AE  Q     KF+K+S+SAK +++DFK RR+  F+KNL E+T++++KHA+ ++Q LR  L +LKE
Sbjct:   30 HSDATLQVDISDALSERDKVKFTVHTKTTLPYFKQGEFSVVRQHEEFIWLHDAYEENEEYAGIIIPPAPPRPDFDASREKLQKLGEGEGTMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRLAAHPLLRKDHNFHVFLEYDQDLSVRGKNKKEKFGGFLKNMVKTADEVLI-AGTKDVDEFFDHEKTFILEYHGRIKDATMKADKMTRAHKNVAEDYIRISSGVYTLGTQEPT---NLSRIFLKFTELLEKTRKLEGRVASDEDLKLSDLLRYYMKDSQAAKDLLYRRARSLIDYENANKALDKARAKNKDVQQAEAHQQICCHKFEKLSESAKHELIDFKTRRVVAFRKNLVEMTEMEIKHAKANLQFLRNCLVTLKE 407          
BLAST of Sorting nexin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009855.1 (pep scaffold:Pmarinus_7.0:GL476399:593532:610067:1 gene:ENSPMAG00000008881.1 transcript:ENSPMAT00000009855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 383.259 bits (983), Expect = 1.752e-128
Identity = 213/395 (53.92%), Postives = 284/395 (71.90%), Query Frame = 1
Query:  184 SESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSK-VFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLK 1365
            S   PS E  +  ++SD  L VEISDA+SE++KV FTV T T+L  FK  + SV RQHEEF+WLHD   E EDY G++ PPAPP+PDFD SR+KL +L E E  M K++F KMK ELEAEYLA FKKTVAMHEVFL RLAAHPIL  D NF IFLEYD  LSVRGK+ KE   GF+K +  + DE L+ S  K+ D FF +EK++L++Y++ V++S +KADKMTR HK++S+ YIG+ST L +  +     L   S FL LS  +FE+ RK + R+A+D+DLKL+D LRYY  ++QAAK LLYRR+R+L D E+  + ++KAR+KGK+V  AE  Q  A  KF  +S SA+ +++DFK RR+A F+KNL E+ +L+LKHA+  +Q+L  +L +L+
Sbjct:   15 SGKGPSGEAED-EDSSDSPLQVEISDALSEKDKVKFTVQTTTSLPTFKKGKLSVSRQHEEFIWLHDSYVENEDYGGIVIPPAPPRPDFDSSREKLQRLGEGEATMTKEEFSKMKQELEAEYLAIFKKTVAMHEVFLCRLAAHPILSQDRNFHIFLEYDQELSVRGKNTKEILGGFLKSMMKSADEVLV-SGAKDSDEFFEHEKIFLLEYHMRVKESALKADKMTRAHKNVSEDYIGISTWLYNIGEQEYSKL---SRFLQLSSDMFEKYRKQQGRVASDQDLKLTDLLRYYVRETQAAKDLLYRRARSLVDAENTGRALDKARAKGKDVQQAEMQQKLAMHKFDSLSTSARQELMDFKMRRVAAFRKNLVEMAELELKHAKASLQMLNNSLTALQ 404          
BLAST of Sorting nexin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000227.1 (pep scaffold:Pmarinus_7.0:GL480786:1217:16989:1 gene:ENSPMAG00000000197.1 transcript:ENSPMAT00000000227.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 355.91 bits (912), Expect = 7.566e-118
Identity = 190/378 (50.26%), Postives = 266/378 (70.37%), Query Frame = 1
Query:  241 LNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKESS 1374
            L V I+DA+SER++V+FTV TKT L  FKN +  V RQHE+FVWLHD   E   YAG I PPAP +PDF  SRDKL +L ++E  M K++F +MK E+EAEYL  FKKTVAMHE FL RLA HP+L  D N  +FLEY   L+VRGK++KE   GF + V  + DE L+ S  ++ D F  +EKV+LVDY+L ++D+T KADKMT+ HK++++ Y+ +S +        +   +LS  +L ++ V E+ RKLE R A+D+DLKLSD  RYY  DSQAAK LLYRR+RAL DYE+A K +++AR++ K+VAA E+ Q  +  +F+K+S + K ++ DF+ RR+  F+K L ELT+LQLKH + ++QVL+  L  +++++
Sbjct:   31 LRVSITDAVSERDRVLFTVCTKTILPAFKNSKVCVSRQHEDFVWLHDSYVENGTYAGFIIPPAPLRPDFSASRDKLHRLGQSEGTMTKEEFSRMKQEVEAEYLVVFKKTVAMHEGFLVRLATHPVLSQDSNLQVFLEYTHELNVRGKNKKEMLGGFFRNVVKSADE-LVVSGVEDIDEFMEHEKVFLVDYHLRIKDATTKADKMTKAHKNIAEDYLHISASFTSLATQDSR--NLSKLYLCIADVLEKTRKLEGRAASDQDLKLSDLFRYYMKDSQAAKDLLYRRTRALVDYENANKALDRARTRNKDVAATESQQQTSLQRFEKLSSTGKQELKDFRCRRVLAFRKGLVELTELQLKHCKANLQVLQICLGQIQDAN 405          
BLAST of Sorting nexin vs. Ensembl Sea Lamprey
Match: snx1a (sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-3])

HSP 1 Score: 49.6766 bits (117), Expect = 1.626e-6
Identity = 77/289 (26.64%), Postives = 121/289 (41.87%), Query Frame = 1
Query:  253 ISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDET-LLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADY 1116
            + D M+    + + V T T+L  FK KEF+VKR+  +F+ L+++L E   ++G I PPAP K     ++ K+ K             D    E         ++  A  E +LQR + HP L  D +F  FLE D  L     ++     G ++ VT   D    +     E DS+F  +++   +    +R      + +    K MS     ++TA   A       L  S    ALS+   ++ ++E +I         D L   Q     A A LY  +  LADY
Sbjct:  179 VGDGMNAY--MAYNVTTTTSLPMFKRKEFTVKRRFSDFLGLYEKLTEKFSHSGFIVPPAPEKSVLGMTKVKVGK------------DDPSSVEF-------VERRRAALERYLQRTSKHPTLMQDPDFRDFLERD-ELPRAVNTQALSGAGILRMVTKAADAVNKMTIKMNESDSWFEEKQLEFENLETQLRKLHGNFEGLVNHRKEMS-----LNTA---AFAKSAAMLGNSEDNTALSRALSQLAEVEEKI---------DALHQEQ-----ANADLYVFAELLADY 423          
BLAST of Sorting nexin vs. Ensembl Nematostella
Match: EDO46810 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP73])

HSP 1 Score: 370.163 bits (949), Expect = 2.789e-123
Identity = 207/376 (55.05%), Postives = 271/376 (72.07%), Query Frame = 1
Query:  244 NVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKE 1368
            NV+ISDA+SER++V FTVHTKTTL  FK  +FSV R+HEEFVWLHD+  E E+YAG+I PPAPPKPDFD SR+KL KL E E NM K++F KMK ELEAEYLATFKKTVAMHEVFL RLA+HP L+ D NF +FLEY + L+VRGK++KEK  G  K +   +DE LL S QK+ D FF +EK +LV+Y+  ++DS  K D MTR HK+ +D YI +ST +       +TG   L          FE  RKLE R+A+DEDLK+ D LRYY  D++AAK LL+RR++ LA+YE+A K ++KAR K KE+A +        +KF+ +S+ A+ ++ DFK RR+  F+KNLTEL +L+LKHA+ H Q+L+  +A+L+E
Sbjct:   21 NVDISDALSERDRVKFTVHTKTTLPDFKESDFSVVREHEEFVWLHDRCVENEEYAGIIIPPAPPKPDFDVSREKLQKLGEGEGNMTKEEFQKMKQELEAEYLATFKKTVAMHEVFLTRLASHPSLRKDSNFKVFLEYKAELNVRGKNKKEKLGGLFKGLAKGVDEVLL-SGQKDVDEFFESEKKFLVEYHNKLKDSVRKGDVMTRSHKNCADVYIKISTGIASMGTSEYTG---LDKFLNKTGDYFERARKLEGRVASDEDLKMVDLLRYYMRDTEAAKNLLHRRAKCLAEYENANKALDKARMKNKEIAESAQQNAS--EKFEHMSEIARQELTDFKARRVQQFRKNLTELVELELKHAKAHHQLLKNTIAALEE 390          
BLAST of Sorting nexin vs. Ensembl Nematostella
Match: EDO33479 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS20])

HSP 1 Score: 83.5741 bits (205), Expect = 4.163e-17
Identity = 99/403 (24.57%), Postives = 181/403 (44.91%), Query Frame = 1
Query:  193 NPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIX----XXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKV--YLVDYYLAVRDSTIKADKMT----RQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKES 1371
            N + +  E  NN D   NV++ DA  + E + FTV TKT     + K   V R++++F WL+  L    +   V+               +S+ K  +L +   NM  D+F K    LE                F+Q + AHP L+ND +   FL  +     R K +K    G    ++ T+ E   +S++   D F   +K+  ++  + LA ++  +   KM     R   S+ +    VSTA   AV       +L  TF   S+     ++    ++ +++  L  T+  Y     +AK +L+RR+  L ++E+A K +EKA+ + K+       + +  D + +I+D A T++  F ++R+   +  + +  + ++K+ R    VL   L  +K++
Sbjct:   50 NQNGQAEEGENNGDVSWNVKVLDASKDGEILKFTVQTKTMENDEEEKGVIVLREYDDFEWLYHCLVTHNNIDAVVVPPLPARPLVTATAAESKSK-KQLGKNAKNMIGDEFFKDCRNLEK---------------FIQLVLAHPALKNDGDLEKFLT-EEQAQTRTKIKK----GLFGSLSKTVGEVRYQSHKDINDEF---QKLRDFVEKFSLANKECCMNFTKMVNAQQRVGLSLGELSASVSTA---AVLDEVSSQNLKRTFTLFSEALTSSKESYEVMSANDENTLGFTIDLYSKYMDSAKDMLFRRTCKLVEFENASKALEKAKPQKKDQCEQAKKEAE--DAYTEITDLASTEMSRFNRQRVLSLQSAMVQYAESRIKNGRDTYAVLLKLLNYVKKA 423          
BLAST of Sorting nexin vs. Ensembl Nematostella
Match: EDO32102 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW17])

HSP 1 Score: 67.3958 bits (163), Expect = 5.396e-12
Identity = 80/291 (27.49%), Postives = 133/291 (45.70%), Query Frame = 1
Query:  289 FTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETL--LRSNQKEEDSFF--LNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKAR 1149
            + V TKT++ +F + E +VKR+  +F+ LH+++     + G I PPAP K     S+ K  K    E++   D   K +A LE                FL R+AAHP L+ D +F  FLE D     R K       G +K++  +M +T+  L +   E D +F    +++  +D  L      ++   M R+  S+S +    S A+    + HT    LS     L++V E++  L    +  +    S+ L+ Y     + KA    R RA + ++ A +T+ K R
Sbjct:   34 YRVITKTSMPEFNSPETTVKRRFSDFLGLHERINAKYLHLGRIVPPAPEKSVIGMSKVKFSK----EDSNSTDFIGKRRAVLER---------------FLNRVAAHPELRKDPDFRQFLEADE--LPRAKDTAALSGGGLKRLVKSMGDTMFSLTTKMSESDQWFEEKQQQIETLDQQLKKLHHNVEILVMHRKELSISTASFAKSAAMLSNAEEHTS---LSRALTQLAEVEEKIEALHVEQSETDFFVFSELLKDYIGLISSVKACFQERVRAYSVWQHAQQTLTKKR 300          
BLAST of Sorting nexin vs. Ensembl Medaka
Match: snx6 (sorting nexin 6 [Source:NCBI gene;Acc:101159712])

HSP 1 Score: 387.882 bits (995), Expect = 1.738e-129
Identity = 216/403 (53.60%), Postives = 289/403 (71.71%), Query Frame = 1
Query:  169 APNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALED-AVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKESS 1374
             P+  SE +       +    D  L V+ISDA+SER+KV FTVHTK+TL  FK  EFSV RQHEEF+WLHD   E EDYAG I PPAPP+PDFD SR+KL KL E E +M K++F KMK ELEAEYLA FKKTVAMHEVFL R+AAHP+L+ D+NF +FLEY+ +LSVRGK++KEK   F K V  + D  L+ +  K+ D FF +EK +L++Y+  V+DS+ K D+M R HK+ +D    ++++L     Q  T   DL   FL +S++FE+ RK+E R+A DEDLKL+D L+YY  +SQAAK LLYRRSR+L DYE+A K ++KAR+K ++V  AE  Q     KF+KIS+SAK +++DFK RR+A F+KNL EL +L+LKHA+G++Q+L++ L  LK ++
Sbjct:    9 GPDFLSEEDRGPRAVNVDLEMDATLQVDISDALSERDKVKFTVHTKSTLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPVLRKDLNFHVFLEYNQDLSVRGKNKKEKLEDFFKNVVKSADGVLV-AGVKDVDDFFEHEKTFLLEYHNRVKDSSAKCDRMIRSHKNAADDMNRIASSLYTLGTQDST---DLCKFFLKVSELFEKTRKIEARVAADEDLKLADLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNRDVMQAENNQQLCCHKFEKISESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQSCLGVLKGNT 407          
BLAST of Sorting nexin vs. Ensembl Medaka
Match: snx5 (sorting nexin 5 [Source:NCBI gene;Acc:101164746])

HSP 1 Score: 350.903 bits (899), Expect = 1.520e-115
Identity = 194/378 (51.32%), Postives = 266/378 (70.37%), Query Frame = 1
Query:  250 EISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGD-------LDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASL 1362
            +I DA+ ER+KV FTVHTKTTL  F+  +FSV RQHE+F+WLHD L ETEDYAG+I PPAPPKPDF+  R+K+ KL E E  M K+++ KMK ELEAEYLA FKKTV +HEVFLQRL++HP+L  D NF IFLEYD +LSVR K+ KE F GF K +  + DE L+ +  KE D FF  EK +L+DY+  ++++T KA+KMTR HK+++D YI +S  L       + +       L L   FL +      ++K+E R+A+DE+LKL++ LRYY  D QAAK LLYRR+RALADYE++ K ++KAR KGK+V+ AE  Q +   KF  +S+S K ++ +FK RR+  F+KNL E+ +L++KHA+ ++ +L+  +  L
Sbjct:    1 DIPDALCERDKVKFTVHTKTTLSSFQKPDFSVPRQHEDFIWLHDTLVETEDYAGLIIPPAPPKPDFESPREKMHKLGEGEATMTKEEYTKMKQELEAEYLAVFKKTVQVHEVFLQRLSSHPVLSKDRNFQIFLEYDQDLSVRRKNAKEMFGGFFKNMVKSADEVLI-AGVKEVDDFFEQEKTFLLDYFSKIKEATAKAEKMTRSHKNIADDYIRLSATLNSLSAEESTNYYFIKFCLKLFQNFLCVC-----LKKVEGRVASDEELKLTELLRYYMRDIQAAKDLLYRRARALADYENSNKALDKARLKGKDVSQAEEHQKRCLQKFDTLSESGKKELTNFKARRVVAFRKNLVEMAELEVKHAKNNMTLLQGCIELL 372          
BLAST of Sorting nexin vs. Ensembl Medaka
Match: si:dkey-28n18.9 (sorting nexin-6 [Source:NCBI gene;Acc:101168453])

HSP 1 Score: 67.0106 bits (162), Expect = 1.637e-11
Identity = 84/378 (22.22%), Postives = 159/378 (42.06%), Query Frame = 1
Query:  244 NVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGV--IXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEK--VYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLK 1365
            N+++++ + E + + F +    + K     EF V R +E+F WL   L   ED  G+  +  P  P     ++  K++K                   L    L  ++      E FL+++AAH IL  +    IFL   S+   R K++K  F    + V     E + +   K+ D FF  ++   +L+  Y  +         +T Q  +++  +   S  L    + +    D S   + LS+VF  ++K     A ++   L   L       +A K +L+RR+  L + ++A K  +KA+   K         T+   +F++I + AK +I+  + + +   ++ L +  + QL  A+   +V    L + K
Sbjct:   18 NIKVTEVLQEGDSLTFII---VSQKLSGTGEFHVDRTYEDFEWLQQHLYSMEDVPGIQGVIFPPLPARPQVNASSKVLK------------------HLGVLGLGEWQPYCRALETFLRQVAAHGILGKNKGVEIFL-TSSDPPGRQKAKKNIFNRLSQAV-----EEMRKEGHKDVDDFFQTKRDHNFLLTGYTKMAAEKFLDVVLTEQKIAVACGHFSASLHLCMEPEENPEKHDFSQVCVKLSEVFNSMKKSMTSAAMNDMNTLGLGLDLESRYQEAEKEMLFRRTCKLVELQNATKNADKAKPLKKTAMEEAKKATET--EFRQICEVAKKEIIQLESKHVETLQQALVQWCEKQLLTAKESAEVYSQHLQTFK 366          
BLAST of Sorting nexin vs. Ensembl Medaka
Match: snx1a (sorting nexin-1 [Source:NCBI gene;Acc:101163736])

HSP 1 Score: 52.7582 bits (125), Expect = 1.034e-6
Identity = 79/365 (21.64%), Postives = 162/365 (44.38%), Query Frame = 1
Query:  253 ISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDE-TLLRSNQKEEDSFFLN--EKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKAR---------------SKGKXXXXXXXXXXXXYDK-FKKISDSAKTQILDFKQRRIAYFKKNLT 1290
            + D M+    + + V T+TTL  F+NK F+V+R+  +F+ L+ +L E     G+I PP P K     ++ K+ K    E++   D  ++ +  LE                +LQR+  HP+L  D +   FLE D  L     ++     GF+K +    D  + +     E D++F    ++V   D +     + +++  + R+  S++ +    S A+  + + +T    LS     L++V +++ +L    A  +    ++ +  Y     A +     R +A   ++ A   ++K R                + KE      A+   +++ F+++S + + ++L F+++R   FK+ +T
Sbjct:  301 VGDGMNAY--MAYKVSTETTLPMFRNKLFTVRRRFSDFLGLYQKLSEKHGPNGLIVPPPPEKSILGMTKVKVGK----EDSSSADFLERRRGALER---------------YLQRVVNHPLLLQDPDVREFLEKD-ELPRAVSTQTLSGAGFLKMINKATDAVSKMTIKMNESDAWFEEKLQEVESADQHFRKLHALVESLVVHRKELSLNTANFAKSAAMLGSAEDNTA---LSRALSQLAEVEDKIEQLHQDQAAYDTFSFAELIADYIRLLGAVRGSFDHRIKAWQRWQDAQAMLQKKREMEAKLLWANKPDKLQQAKEEIVEWEARVTQFERDFERVSATVRKEVLRFEKQRTKNFKRQIT 640          
BLAST of Sorting nexin vs. Planmine SMEST
Match: SMESG000066985.1 (SMESG000066985.1)

HSP 1 Score: 803.512 bits (2074), Expect = 0.000e+0
Identity = 422/423 (99.76%), Postives = 422/423 (99.76%), Query Frame = 1
Query:  112 MMSPVDEIHGDDEDLFQSIAPNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKESSNH 1380
            MMSPVDEIHGDDEDLFQSIAPNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIFPPAPPKPDFDDSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKEVAAAETAQTQAYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTAL SLKESSNH
Sbjct:    1 MMSPVDEIHGDDEDLFQSIAPNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIFPPAPPKPDFDDSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKEVAAAETAQTQAYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALTSLKESSNH 423          
BLAST of Sorting nexin vs. Planmine SMEST
Match: SMESG000066985.1 (SMESG000066985.1)

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 421/422 (99.76%), Postives = 421/422 (99.76%), Query Frame = 1
Query:  115 MSPVDEIHGDDEDLFQSIAPNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKXXXXXXXXXXXXYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALASLKESSNH 1380
            MSPVDEIHGDDEDLFQSIAPNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIFPPAPPKPDFDDSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKEVAAAETAQTQAYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTAL SLKESSNH
Sbjct:    1 MSPVDEIHGDDEDLFQSIAPNNASESNPSQEKNELTNNSDKLLNVEISDAMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIFPPAPPKPDFDDSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFIKQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQHKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGKEVAAAETAQTQAYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQLKHARGHIQVLRTALTSLKESSNH 422          
BLAST of Sorting nexin vs. Planmine SMEST
Match: SMESG000016192.1 (SMESG000016192.1)

HSP 1 Score: 58.5362 bits (140), Expect = 8.155e-9
Identity = 94/368 (25.54%), Postives = 169/368 (45.92%), Query Frame = 1
Query:  286 VFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIXXXXXXXXXXXXSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLS-------VRGKSRKEKFTGF---IKQVTATMDETLLRSNQKEEDSFFLNEKVYL--VDYYLAVRDSTIKADKMTRQHKSMSDSYIGV---STALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIATDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKAR-SKGKXXXXXXXXXXXXYD---------------KFKKISDSAKTQILDFKQRRIAYFKKNLTEL 1296
            ++ ++TKT    F ++E +V+R+  +F+ LH++L+    +AG I PPAP K  F +++ KL K         +DQ +       +E+L   ++  A  E +LQR+A HP+L  D +F  FLE D  L        + G + K+ F      + ++T  MD+          D +F +++V +  +D +L+    +   + +  Q K ++ S I V   + +    V+ H G   L+     LS   EE+  +E R A  E   L + L+ Y     A K +L  R R    ++ A   + K R  K +   + +  +  A+D                F+KIS + KT++  F   ++  FK+ + ++
Sbjct:   82 IYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSK---------EDQTN-------SEFL---ERRRAALERYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDC---------DQWFDDKQVEMDNLDRHLSQIHCSF--EHLISQRKELA-SQIKVFAQNCSQLSHVEEHNG---LARALAQLSAAKEEISAIEERQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCELSGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKV 415          
The following BLAST results are available for this feature:
BLAST of Sorting nexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNX321.965e-13153.65sorting nexin 32 [Source:HGNC Symbol;Acc:HGNC:2642... [more]
SNX67.292e-13054.39sorting nexin 6 [Source:HGNC Symbol;Acc:HGNC:14970... [more]
SNX67.862e-13054.39sorting nexin 6 [Source:HGNC Symbol;Acc:HGNC:14970... [more]
SNX55.570e-12252.79sorting nexin 5 [Source:HGNC Symbol;Acc:HGNC:14969... [more]
SNX55.570e-12252.79sorting nexin 5 [Source:HGNC Symbol;Acc:HGNC:14969... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx-62.882e-10648.95Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8... [more]
snx-62.882e-10648.95Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8... [more]
snx-63.853e-10548.95Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8... [more]
snx-63.853e-10548.95Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8... [more]
snx-62.177e-9247.98Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Snx66.265e-12052.79gene:FBgn0032005 transcript:FBtr0079631[more]
Snx62.066e-11751.96gene:FBgn0032005 transcript:FBtr0306170[more]
Snx11.557e-1324.22gene:FBgn0031534 transcript:FBtr0343238[more]
Snx12.911e-1324.34gene:FBgn0031534 transcript:FBtr0077517[more]
back to top
BLAST of Sorting nexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
snx66.078e-13054.50sorting nexin 6 [Source:ZFIN;Acc:ZDB-GENE-050913-1... [more]
snx66.926e-13054.50sorting nexin 6 [Source:ZFIN;Acc:ZDB-GENE-050913-1... [more]
snx53.476e-11952.86sorting nexin 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
si:dkey-28n18.95.757e-621.96si:dkey-28n18.9 [Source:ZFIN;Acc:ZDB-GENE-131127-2... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx64.942e-13054.39sorting nexin 6 [Source:NCBI gene;Acc:394595][more]
snx61.144e-12955.10sorting nexin 6 [Source:NCBI gene;Acc:394595][more]
snx61.493e-12956.46sorting nexin 6 [Source:NCBI gene;Acc:394595][more]
snx62.996e-12755.58sorting nexin 6 [Source:NCBI gene;Acc:394595][more]
snx62.617e-12553.77sorting nexin 6 [Source:NCBI gene;Acc:394595][more]
back to top
BLAST of Sorting nexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snx61.163e-12954.14sorting nexin 6 [Source:MGI Symbol;Acc:MGI:1919433... [more]
Snx321.425e-12853.65sorting nexin 32 [Source:MGI Symbol;Acc:MGI:244470... [more]
Snx324.954e-12654.57sorting nexin 32 [Source:MGI Symbol;Acc:MGI:244470... [more]
Snx53.702e-12253.32sorting nexin 5 [Source:MGI Symbol;Acc:MGI:1916428... [more]
Snx53.702e-12253.32sorting nexin 5 [Source:MGI Symbol;Acc:MGI:1916428... [more]
back to top
BLAST of Sorting nexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86XE0|SNX32_HUMAN9.436e-13153.65Sorting nexin-32 OS=Homo sapiens OX=9606 GN=SNX32 ... [more]
sp|Q5R613|SNX6_PONAB3.076e-12954.39Sorting nexin-6 OS=Pongo abelii OX=9601 GN=SNX6 PE... [more]
sp|Q9UNH7|SNX6_HUMAN3.502e-12954.39Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6 PE... [more]
sp|Q6P8X1|SNX6_MOUSE8.136e-12954.14Sorting nexin-6 OS=Mus musculus OX=10090 GN=Snx6 P... [more]
sp|Q80ZJ7|SNX32_MOUSE9.965e-12853.65Sorting nexin-32 OS=Mus musculus OX=10090 GN=Snx32... [more]
back to top
BLAST of Sorting nexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JVG73.496e-14357.52Sorting nexin OS=Lingula unguis OX=7574 GN=LOC1061... [more]
A0A0L8H0E11.185e-14059.38Sorting nexin OS=Octopus bimaculoides OX=37653 GN=... [more]
V4AW126.050e-13958.66Sorting nexin OS=Lottia gigantea OX=225164 GN=LOTG... [more]
R7TJM99.852e-13656.36PX domain-containing protein (Fragment) OS=Capitel... [more]
K1PEW12.353e-13559.27Sorting nexin OS=Crassostrea gigas OX=29159 GN=CGI... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx67.944e-13054.25sorting nexin 6 [Source:NCBI gene;Acc:103040510][more]
snx61.833e-12654.16sorting nexin 6 [Source:NCBI gene;Acc:103040510][more]
snx56.278e-11851.44sorting nexin 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
snx51.703e-11452.43sorting nexin 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
si:dkey-28n18.95.169e-824.30si:dkey-28n18.9 [Source:ZFIN;Acc:ZDB-GENE-131127-2... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
snx63.655e-13857.85sorting nexin 6 [Source:ZFIN;Acc:ZDB-GENE-050913-1... [more]
ENSPMAT00000009855.11.752e-12853.92pep scaffold:Pmarinus_7.0:GL476399:593532:610067:1... [more]
ENSPMAT00000000227.17.566e-11850.26pep scaffold:Pmarinus_7.0:GL480786:1217:16989:1 ge... [more]
snx1a1.626e-626.64sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sorting nexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO468102.789e-12355.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334794.163e-1724.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321025.396e-1227.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sorting nexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
snx61.738e-12953.60sorting nexin 6 [Source:NCBI gene;Acc:101159712][more]
snx51.520e-11551.32sorting nexin 5 [Source:NCBI gene;Acc:101164746][more]
si:dkey-28n18.91.637e-1122.22sorting nexin-6 [Source:NCBI gene;Acc:101168453][more]
snx1a1.034e-621.64sorting nexin-1 [Source:NCBI gene;Acc:101163736][more]
back to top
BLAST of Sorting nexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000066985.10.000e+099.76SMESG000066985.1[more]
SMESG000066985.10.000e+099.76SMESG000066985.1[more]
SMESG000016192.18.155e-925.54SMESG000016192.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012364 ID=SMED30012364|Name=Sorting nexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1899bp
ATCTAAAATAAAATTCGTTTGTTTTATTAACTTATACAATCTTGTTAAAT
TTAAATATTTTTAAATTAAATTCCTTTTTGTATATTTTTGTAGAATCTAG
TTGTCTTAAAAATGATGAGCCCTGTTGATGAAATCCATGGTGATGATGAG
GACTTATTTCAATCAATCGCACCAAACAATGCCAGTGAATCAAATCCAAG
CCAAGAAAAAAATGAATTAACTAATAATTCGGATAAATTGTTGAATGTGG
AAATATCAGACGCTATGAGTGAACGAGAAAAAGTAGTTTTCACAGTTCAT
ACGAAGACTACTTTGAAACAATTTAAAAATAAAGAATTCTCTGTAAAACG
ACAACACGAAGAATTTGTATGGCTTCATGATCAATTGGAAGAAACGGAAG
ATTATGCCGGTGTAATTTTTCCCCCAGCTCCTCCAAAACCAGATTTCGAT
GATTCCCGAGATAAACTGATGAAGTTATCCGAGGCGGAAAATAACATGCC
GAAAGATCAATTTGATAAAATGAAAGCAGAATTAGAAGCAGAATATCTGG
CAACATTCAAAAAAACTGTGGCAATGCATGAAGTGTTCCTCCAGAGATTA
GCCGCCCATCCGATCCTCCAGAACGATGTGAATTTCTCCATCTTCCTCGA
GTACGATTCGAATTTATCGGTCCGAGGAAAGAGCAGGAAGGAGAAATTTA
CGGGATTTATCAAGCAAGTTACAGCTACAATGGATGAAACTTTGTTGCGG
TCGAATCAGAAAGAGGAGGATAGTTTCTTTCTCAATGAGAAAGTTTACTT
GGTGGACTATTATCTGGCAGTGCGGGATAGCACAATCAAGGCCGACAAAA
TGACAAGGCAGCACAAATCGATGTCGGATAGTTATATCGGAGTTTCCACC
GCCCTCGAGGATGCCGTTCAGCCGCATACCGGTGATCTCGATCTGTCGAG
CACATTCCTGGCATTATCAAAAGTATTTGAAGAAGTTCGAAAACTGGAGA
ATCGTATTGCTACTGATGAAGACTTGAAACTTTCTGACACATTGAGATAT
TATCAAAATGACAGTCAGGCAGCCAAAGCGTTATTGTATCGACGCAGTCG
AGCTTTGGCTGATTATGAGTCTGCTTGCAAAACTGTCGAGAAGGCTAGGT
CGAAAGGAAAAGAGGTAGCCGCCGCTGAAACTGCACAGACACAAGCATAT
GATAAATTTAAAAAAATATCAGATTCAGCTAAAACTCAAATTCTCGATTT
CAAACAAAGAAGAATCGCGTATTTCAAAAAGAACCTGACGGAATTGACGA
AATTGCAATTGAAACATGCACGGGGTCACATCCAAGTTTTGAGAACGGCT
CTCGCAAGCTTGAAGGAGTCATCCAATCATTGATAAGATAGAATTATTTC
TGTTGTCATTATTATTATAATAATTATTATTATTATTTCGTTGGAGTATG
GAAATAGTGAAAATTAATTTTTGATTTGTCTGTTTTTATTAGAATTTTAT
TGATTTTCTGATCTGTTGTTTGTGATCCTTATTAAATTTGATTGATATCA
ATGATAATAATAATTAACATTATTATTATTAATAATTTCACGCTGATAAC
TTACCGTTGCTTGGCTGGACATGTAATAATGGAGAATAAATCGCCTTGTG
ATTATTTCCCTTCGGTTTCATGAAGCTTTAATTGAAATTTGCAAGAATAC
GTTCACATTTCATGTTCAGCAATATTCAATTTATATTTGTCGTTTTTTTA
TAATAATTTCAATGATTTTGTTATTTTTATTTCTTTTAGATTCATAGAAT
TATTGGAATAATGGATTTCTGTTTCAAATTGACGATCAAGGGAATTATTT
CTTATTAAATTTGGAAATAAATCCACAACATTTCATTAAATATTTTTAC
back to top

protein sequence of SMED30012364-orf-1

>SMED30012364-orf-1 ID=SMED30012364-orf-1|Name=SMED30012364-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=424bp
MMSPVDEIHGDDEDLFQSIAPNNASESNPSQEKNELTNNSDKLLNVEISD
AMSEREKVVFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAG
VIFPPAPPKPDFDDSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFK
KTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLSVRGKSRKEKFTGFI
KQVTATMDETLLRSNQKEEDSFFLNEKVYLVDYYLAVRDSTIKADKMTRQ
HKSMSDSYIGVSTALEDAVQPHTGDLDLSSTFLALSKVFEEVRKLENRIA
TDEDLKLSDTLRYYQNDSQAAKALLYRRSRALADYESACKTVEKARSKGK
EVAAAETAQTQAYDKFKKISDSAKTQILDFKQRRIAYFKKNLTELTKLQL
KHARGHIQVLRTALASLKESSNH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015404Vps5_C
IPR036871PX_dom_sf
IPR001683Phox
IPR027267AH/BAR_dom_sf
IPR014637SNX5/SNX6/SNX32
Vocabulary: molecular function
TermDefinition
GO:0035091phosphatidylinositol binding
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0015031protein transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001683Phox homologous domainSMARTSM00312PX_2coord: 41..182
e-value: 8.1E-5
score: 32.0
IPR001683Phox homologous domainPFAMPF00787PXcoord: 42..181
e-value: 1.3E-19
score: 70.2
IPR001683Phox homologous domainPROSITEPS50195PXcoord: 38..185
score: 12.392
IPR015404Sorting nexin Vps5-like, C-terminalPFAMPF09325Vps5coord: 201..412
e-value: 1.0E-8
score: 35.0
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 215..419
e-value: 4.6E-32
score: 113.6
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 246..420
IPR014637Sorting nexin-5/6/32PIRSFPIRSF036924Snx5_Snx6coord: 13..421
e-value: 1.3E-163
score: 542.3
IPR036871PX domain superfamilyGENE3DG3DSA:3.30.1520.10coord: 35..193
e-value: 1.8E-53
score: 182.6
IPR036871PX domain superfamilySUPERFAMILYSSF64268PX domaincoord: 39..183
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..40
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 18..40
NoneNo IPR availablePANTHERPTHR45850FAMILY NOT NAMEDcoord: 21..419
NoneNo IPR availablePANTHERPTHR45850:SF1SORTING NEXIN 6, ISOFORM Bcoord: 21..419