SMED30012356

Overview
NameSMED30012356
Smed IDSMED30012356
Length (bp)1719
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012356

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30012356SMESG000035313.1 SmedASXL_009679SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30012356SMESG000035313.1 SmedASXL_009679SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30012356SMESG000035313.1 dd_Smed_v4_2506_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012356SMESG000035313.1 Contig19969uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012356SMESG000035313.1 Contig19969newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012356SMESG000035313.1 SMESG000035312.1 Contig7310uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012356SMESG000035313.1 SMESG000035312.1 Contig7310newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30012356SMESG000035312.1 SMESG000035313.1 dd_131dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parapharyngeal regionSMED30012356SMESG000035313.1 dd_Smed_v6_2506_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
goblet cellSMED30012356SMESG000035313.1 SMESG000035312.1 dd_Smed_v6_131_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30012356SMESG000035313.1 SMESG000035312.1 dd_Smed_v6_131_0dd_Smed_v6PMID:29674432
Plass et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30012356 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.006101:3161..7772 +8283
v31.006101:11909..15402 +2803
Homology
BLAST of SMED30012356 vs. Planmine SMEST
Match: SMESG000035313.1 (SMESG000035313.1)

HSP 1 Score: 957.592 bits (2474), Expect = 0.000e+0
Identity = 497/498 (99.80%), Postives = 498/498 (100.00%), Query Frame = -1
Query:   70 MISYFILALTISLVSCDTFEARSLEFEERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILDHLGPLSRKIADGIINQFRELIEKIDEATKETQTNEKRSESSXXXXXXXXXXXXKAYNKGGEYVAQVINDPNVKAILDHLGPLSRRVAESIINNFRELIKKIDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELTTEKPKSERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKESTF 1563
            MISYFILALTISLVSCDTFEARSLEFEERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGIL+HLGPLSRKIADGIINQFRELIEKIDEATKETQTNEKRSESSIELLKKLNEILLKAYNKGGEYVAQVINDPNVKAILDHLGPLSRRVAESIINNFRELIKKIDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELTTEKPKSERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKESTF
Sbjct:    1 MISYFILALTISLVSCDTFEARSLEFEERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELIEKIDEATKETQTNEKRSESSIELLKKLNEILLKAYNKGGEYVAQVINDPNVKAILDHLGPLSRRVAESIINNFRELIKKIDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELTTEKPKSERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKESTF 498          
BLAST of SMED30012356 vs. Planmine SMEST
Match: SMESG000035313.1 (SMESG000035313.1)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 330/397 (83.12%), Postives = 362/397 (91.18%), Query Frame = -1
Query:   70 EPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILDHLGPLSRKIADGIINQFRELIEKIDEATKETQTNEKRS--ESSXXXXXXXXXXXXKAYNKGGEYVAQVINDPNVKAILDHLGPLSRRVAESIINNFRELIKKIDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELTTEKPKSERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKESTF 1254
            E  +R  KE S+ L+  L++ L  AY++G E FDRV+NDSD++GILDH+  L+R++A+ IIN+F+ELI+KIDEATK      KR+  ESS +L+K+L +ILL AY +G EY  +V+ND +V+ IL+HLGPLSR++A+ IIN FRELIKKIDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELTTEKPKSERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKESTF
Sbjct:   25 EFEERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELIKKIDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELTTEKPKSERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKESTF 421          

HSP 2 Score: 493.812 bits (1270), Expect = 8.200e-172
Identity = 281/421 (66.75%), Postives = 326/421 (77.43%), Query Frame = -1
Query:  316 MISYFILALTISLVSCDTFEARSLEFEERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILDHLGPLSRKIADGIINQFRELIEKIDEATKETQTNEKRS--ESSXXXXXXXXXXXXKAYNKGGEYVAQVINDPNVKAILDHLGPLSRRVAESIINNFRELIKKIDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELT---TEKPKSERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNS 1563
            MISYFILALTISLVSCDTFEARSLEFEERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGIL+HLGPLSRKIADGIINQFRELI+KIDEATKE    EKR   ESS+ LLKKL  IL+KA+ KG E   + INDP+VK IL+ L  LSRR A  II  F+EL+ K+DE T EK + E R   E S    KKL+ IL+ A  KG+E F   I+DPD   I  +L+S+ ++  N IIEKF ++  K+D+ T   ++ P +     ED+    KKL QIL+ A R+G EYF  +I+D D   I ++L  + ++I  S+I+ F ++ +KID ATK ++
Sbjct:    1 MISYFILALTISLVSCDTFEARSLEFEERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILEHLGPLSRKIADGIINQFRELIKKIDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELTTEKPKSE-RGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKEST 420          
BLAST of SMED30012356 vs. Planmine SMEST
Match: SMESG000035312.1 (SMESG000035312.1)

HSP 1 Score: 513.072 bits (1320), Expect = 2.138e-179
Identity = 258/390 (66.15%), Postives = 331/390 (84.87%), Query Frame = -1
Query:   79 RNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILDHLGPLSRKIADGIINQFRELIEKIDEATKETQTNEKRS--ESSXXXXXXXXXXXXKAYNKGGEYVAQVINDPNVKAILDHLGPLSRRVAESIINNFRELIKKIDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELTTEKPKSERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKE 1242
            R  KE S+ L+  L++ L  AY++G E FDRV+NDSD++GILDH+  L+R++A+ IIN+F+ELI+KIDEATK      KR+  ESS +L+K+L +ILL AY +G EY  +V+ND +V+ ILDHLGPLSR++A+ IIN FREL++K+DEATKEKTE++KRDFKESS+ LLKKL +IL +AF+KGS AF +A+ DPDVKEILNSL  +SRRTANF+IEKFKELVIK+DE T EK K+ERGLI+++  N K LIQILI AS++G+EYF  I++DPD +AI+E+LN +EQ+II+SII+KF++IFDKID+ATKP SD P+AVSDW+EDA  QLK+LTQILLKAYR+GGEYF+KV+ND DVQNILQHLGPLTR++A S+I+NFRELIEKIDNATKE
Sbjct:   29 RYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILDHLGPLSRKIADGIINQFRELLEKLDEATKEKTEIQKRDFKESSISLLKKLTHILTQAFQKGSAAFNEALEDPDVKEILNSLSGISRRTANFMIEKFKELVIKIDEATNEKQKTERGLIDNTTKNVKNLIQILIKASKQGSEYFRTILNDPDVIAIREHLNILEQRIIDSIIKKFIEIFDKIDQATKPESDYPYAVSDWKEDAKDQLKRLTQILLKAYRKGGEYFDKVVNDPDVQNILQHLGPLTRKVANSIIENFRELIEKIDNATKE 418          

HSP 2 Score: 475.707 bits (1223), Expect = 1.019e-164
Identity = 266/418 (63.64%), Postives = 319/418 (76.32%), Query Frame = -1
Query:  325 MISYFILALTISLVSCDTFEARSLEFEERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILDHLGPLSRKIADGIINQFRELIEKIDEATKETQTNEKRS--ESSXXXXXXXXXXXXKAYNKGGEYVAQVINDPNVKAILDHLGPLSRRVAESIINNFRELIKKIDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELT---TEKPKSERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATK 1563
            MI+YF+L LTISLVS    E    + +ERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILDHLGPLSRKIADGIINQFREL+EK+DEATKE    +KR   ESSI LLKKL  IL +A+ KG     + + DP+VK IL+ L  +SRR A  +I  F+EL+ KIDEAT EK + E R   +++ + +K L+ IL+KA ++GSE F   +NDPDV  I   L+ L +R  + II+KF E+  K+D+ T   ++ P +     ED+K+  K+L QIL+ A RKG EYF  +++DPD   I ++L  + +K+ NSIIE F ++ +KID ATK
Sbjct:    1 MIAYFLLFLTISLVSSTPLEQNEFKLQERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILDHLGPLSRKIADGIINQFRELLEKLDEATKEKTEIQKRDFKESSISLLKKLTHILTQAFQKGSAAFNEALEDPDVKEILNSLSGISRRTANFMIEKFKELVIKIDEATNEKQKTE-RGLIDNTTKNVKNLIQILIKASKQGSEYFRTILNDPDVIAIREHLNILEQRIIDSIIKKFIEIFDKIDQATKPESDYPYAVSDWKEDAKDQLKRLTQILLKAYRKGGEYFDKVVNDPDVQNILQHLGPLTRKVANSIIENFRELIEKIDNATK 417          

HSP 3 Score: 139.043 bits (349), Expect = 1.054e-35
Identity = 76/157 (48.41%), Postives = 110/157 (70.06%), Query Frame = -1
Query:   73 ERGLIEDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKEST 543
            ER   E S +   +LI+ L  A  KGAE F  +I+D D   I ++++++ +++  SII KF ++  KID+ATKP S+ P +  + +E +T  +K+L QILL AY+QG EYF++V+NDSDVQ IL HLGPL+R+IA  +I+ FREL+EK+D ATKE T
Sbjct:   28 ERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISE-P-SKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILDHLGPLSRKIADGIINQFRELLEKLDEATKEKT 182          
BLAST of SMED30012356 vs. Planmine SMEST
Match: SMESG000035252.1 (SMESG000035252.1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.718e-20
Identity = 40/76 (52.63%), Postives = 58/76 (76.32%), Query Frame = -1
Query: 1015 RNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILDHLGPLSRKIADGIINQFRELIEKIDEATKETQT 1242
            +  KESS  L+K+L +IL +AY +G E F +V+ND DV+ IL+ LGPLS+K+A+ II  F+EL++KID+AT +T T
Sbjct:   27 KEFKESSVNLIKKLTKILKDAYSKGSESFHKVLNDPDVKAILERLGPLSKKVANSIIKSFKELVQKIDKATGKTST 102          

HSP 2 Score: 82.4185 bits (202), Expect = 7.888e-19
Identity = 43/99 (43.43%), Postives = 67/99 (67.68%), Query Frame = -1
Query: 1267 MISYFILALTISLVSCDTFEARSLEFEERYFKEKSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEAT 1563
            MI YFI    +SLV  D  + ++ +   + FKE S +L+ +L + L+ AY KG+E F +V+ND D+K IL+ +  L++++A SII  FKEL++KID+AT
Sbjct:    1 MIKYFIFLALLSLVLSD--DKKTDDSTVKEFKESSVNLIKKLTKILKDAYSKGSESFHKVLNDPDVKAILERLGPLSKKVANSIIKSFKELVQKIDKAT 97          

HSP 3 Score: 82.0333 bits (201), Expect = 9.963e-19
Identity = 42/71 (59.15%), Postives = 54/71 (76.06%), Query Frame = -1
Query:  562 RDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELT 774
            ++FKESSV L+KKL  IL  A+ KGSE+F+K +NDPDVK IL  L  LS++ AN II+ FKELV K+D+ T
Sbjct:   27 KEFKESSVNLIKKLTKILKDAYSKGSESFHKVLNDPDVKAILERLGPLSKKVANSIIKSFKELVQKIDKAT 97          

HSP 4 Score: 80.1073 bits (196), Expect = 3.891e-18
Identity = 36/77 (46.75%), Postives = 58/77 (75.32%), Query Frame = -1
Query:   73 AVSDWQEDATVQLKKLTQILLKAYRQGGEYFEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKEST 303
             V +++E +   +KKLT+IL  AY +G E F KV+ND DV+ IL+ LGPL++++A S+I +F+EL++KID AT +++
Sbjct:   25 TVKEFKESSVNLIKKLTKILKDAYSKGSESFHKVLNDPDVKAILERLGPLSKKVANSIIKSFKELVQKIDKATGKTS 101          

HSP 5 Score: 73.1738 bits (178), Expect = 1.109e-15
Identity = 32/51 (62.75%), Postives = 44/51 (86.27%), Query Frame = -1
Query:  799 AYNKGGEYVAQVINDPNVKAILDHLGPLSRRVAESIINNFRELIKKIDEAT 951
            AY+KG E   +V+NDP+VKAIL+ LGPLS++VA SII +F+EL++KID+AT
Sbjct:   47 AYSKGSESFHKVLNDPDVKAILERLGPLSKKVANSIIKSFKELVQKIDKAT 97          

HSP 6 Score: 59.3066 bits (142), Expect = 1.036e-10
Identity = 33/71 (46.48%), Postives = 45/71 (63.38%), Query Frame = -1
Query:  316 EDSKNNFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEKFLQIFDKIDKATKPNS 528
            E S N  KKL +IL +A  KG+E F  +++DPD  AI E L  + +K+ NSII+ F ++  KIDKAT   S
Sbjct:   31 ESSVNLIKKLTKILKDAYSKGSESFHKVLNDPDVKAILERLGPLSKKVANSIIKSFKELVQKIDKATGKTS 101          
BLAST of SMED30012356 vs. Planmine SMEST
Match: SMESG000035316.1 (SMESG000035316.1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.713e-14
Identity = 69/270 (25.56%), Postives = 120/270 (44.44%), Query Frame = -1
Query:  796 MISYFILALTISLVSCDTFEARSLEFEERYFKE----KSSSLLVELIRTLRTAYEKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATKPISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILDHLGPLSRKIADGIINQFRELIEKIDEATKETQTNEKRSESSXXXXXXXXXXXXKAYNKGGEYVAQVINDPNVKA----ILDHLGPLSRRVAE------SIINNFRELIKKIDEATK 1563
            M  Y    L+ SL  C+ ++      +    K     KSS LL + I  L   YEKG  E++ +  D  I+ +++ MD  T+ +AES++ +F++ I   D       +  KR   ++S  L      I  N  + G             + I ++   LSR+  + ++ + RE++++IDEATK    NEKR+         +    +  Y +         + P+ K     ++D L   S+R +E       +I NF++LI+ +DE  K
Sbjct:    1 MTFYLTFVLSFSLAFCNPYKGGQFSNQPETIKRQEIGKSSQLLSKFIVELAKLYEKGIYEYNEIFQDPKIRKLIEKMDEFTKLVAESLVIQFEDEIISRDSPKSEFDDFEKRYTYKTSKSLSLIQRSIKGNGIRSG------------EKEITNNFEQLSRRRTEFLVRKLREIVDQIDEATKLKAANEKRN---------IKLYKVNVYKRN--------SSPDQKGYIQDLIDILSEASKRGSEYLIIFDKVIANFKQLIELVDEKMK 241          

HSP 2 Score: 60.077 bits (144), Expect = 7.279e-10
Identity = 53/181 (29.28%), Postives = 90/181 (49.72%), Query Frame = -1
Query:  451 YNKGGEYVAQVINDPNVKAILDHLGPLSRRVAESIINNFRELIKKIDEATKEKTEVEKR-DFKES-SVRLLKKLVNILVKAFEKGSEAFYKAINDPDVKEILNSLDSLSRRTANFIIEKFKELVIKLDELTTEKPKSERGLIE-------------DSKNNFKKLIQILINASRKGAEYFI 948
            Y KG     ++  DP ++ +++ +   ++ VAES++  F + I   D    E  + EKR  +K S S+ L+++ +        KG+      I   + KEI N+ + LSRR   F++ K +E+V ++DE T  K  +E+  I+             D K   + LI IL  AS++G+EY I
Sbjct:   54 YEKGIYEYNEIFQDPKIRKLIEKMDEFTKLVAESLVIQFEDEIISRDSPKSEFDDFEKRYTYKTSKSLSLIQRSI--------KGN-----GIRSGE-KEITNNFEQLSRRRTEFLVRKLREIVDQIDEATKLKAANEKRNIKLYKVNVYKRNSSPDQKGYIQDLIDILSEASKRGSEYLI 220          

HSP 3 Score: 53.1434 bits (126), Expect = 1.548e-7
Identity = 51/200 (25.50%), Postives = 93/200 (46.50%), Query Frame = -1
Query:  694 EPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILDHLGPLSRKIADGIINQFRELIEKIDEATKETQTNEKRSESSXXXXXXXXXXXXKAYN-KGGEYVAQVINDPNVKAILDHLGPLSRRVAESIINNFRELIKKIDEATKEKTEVEKRDFKESSVRLLKK------------LVNILVKAFEKGSE 1254
            E  KR     S++L+ + +  L   Y++G+  ++ +  D  ++ +++ +   ++ +A+ ++ QF + I   D    E    EKR          L +  +K    + GE           K I ++   LSRR  E ++   RE++ +IDEATK K   EKR+ K   V + K+            L++IL +A ++GSE
Sbjct:   29 ETIKRQEIGKSSQLLSKFIVELAKLYEKGIYEYNEIFQDPKIRKLIEKMDEFTKLVAESLVIQFEDEIISRDSPKSEFDDFEKRYTYKTSKSLSLIQRSIKGNGIRSGE-----------KEITNNFEQLSRRRTEFLVRKLREIVDQIDEATKLKAANEKRNIKLYKVNVYKRNSSPDQKGYIQDLIDILSEASKRGSE 217          
The following BLAST results are available for this feature:
BLAST of SMED30012356 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012356 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012356 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012356 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012356 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012356 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012356 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012356 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012356 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012356 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012356 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012356 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012356 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012356 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035313.10.000e+099.80SMESG000035313.1[more]
SMESG000035313.18.200e-17283.12SMESG000035313.1[more]
SMESG000035312.12.138e-17966.15SMESG000035312.1[more]
SMESG000035252.11.718e-2052.63SMESG000035252.1[more]
SMESG000035316.14.713e-1425.56SMESG000035316.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012356 ID=SMED30012356|Name=SMED30012356|organism=Schmidtea mediterranea sexual|type=transcript|length=1719bp
ATATAGGCAATTTGTATTTATACAAAGTCGATTTCATATTTTGTTTCATT
ACCCACTAAAGCTTGATTAAAAAGTGCTCTCTTTGGTTGCGTTGTCAATT
TTTTCAATTAACTCTCTAAAATTGTCGATTAAGGAAGTGGCAATTCTTCT
CGTCAATGGGCCAAGATGTTGAAGGATATTTTGTACGTCCGAGTCGTTGA
TGACCTTTTCAAAATATTCTCCGCCTTGTCTATAGGCCTTCAATAAAATT
TGTGTCAATTTTTTGAGTTGAACTGTTGCATCTTCTTGCCAATCTGATAC
AGCAAATGGGACATCTGAATTCGGTTTTGTAGCTTTGTCGATTTTATCAA
AAATTTGTAAAAACTTTTCAATAATTGAATTAATAATTTTCTGCTCGATC
GAATTTAGATTTTCTTGGATGGCTACGAAATCTGGATCACTGATGATATT
AATGAAATATTCTGCTCCTTTCCTGGAAGCATTTATGAGAATTTGAATCA
ATTTCTTGAAATTATTTTTCGAATCTTCAATTAATCCTCTTTCGGACTTC
GGCTTTTCAGTTGTCAACTCATCAAGCTTGATTACCAACTCTTTAAATTT
TTCGATAATAAAATTGGCTGTTCTTCTACTTAGGCTGTCGAGGCTATTAA
GAATTTCTTTAACGTCCGGGTCATTGATGGCCTTGTAAAATGCTTCGGAA
CCTTTTTCAAATGCTTTTACGAGAATATTTACCAATTTTTTCAAAAGTCT
GACTGAACTTTCCTTGAAATCTCGTTTCTCAACTTCAGTTTTCTCTTTCG
TAGCTTCGTCGATTTTTTTAATCAATTCTCGGAAATTGTTTATTATTGAC
TCGGCTACTCTTCTTGAAAGGGGACCAAGATGATCAAGAATGGCCTTAAC
GTTTGGGTCGTTGATTACTTGAGCTACGTATTCTCCTCCTTTATTGTAAG
CTTTGAGTAAAATTTCATTCAGTTTTTTCAACAACTCAATAGAAGATTCT
GATCTTTTTTCGTTTGTCTGAGTTTCTTTTGTAGCTTCATCAATTTTTTC
TATTAACTCTCTGAATTGGTTGATAATTCCATCTGCGATCTTTCTTGACA
GAGGTCCAAGATGATCGAGAATTCCTTGAACATCAGAATCATTGACAACT
CTGTCAAAATATTCCAATCCTTGTTTGTAGGCATTCAATAAAATCTGGAC
CAATCTCTTCATGAGCTTTGTTGAGCTTTCTTTTAGGTTTCGCTTGGATG
GTTCGGAAATCGGTTTTGTTGCTTCGTCGATTTTTTTGATCAGCTCTTTG
AATTTATTGATGATAGACTCCGCCAGTCGTCGGGTCAGTGCGTCCATATG
ATCTAAAATTCCTTTGATATCAGAATCATTGATAACTCTGTCGAATTCTT
CAGCACCTTTCTCATACGCAGTTCGGAGAGTTCGGATCAGTTCTACCAAT
AAGCTTGATGACTTCTCTTTAAAATATCTTTCCTCAAATTCTAGACTTCT
CGCTTCAAAAGTATCGCAGGATACCAGAGAAATAGTCAAAGCTAAAATGA
AATATGAAATCATTTTGGAAATATTAAATTCTAATTATTTTTCAATTTCA
CAATTATTTATATAACTTTCAGAATTTTACAGATCTTAGAAACTCTATTA
TATCGCTGCCATATTGGGTATTCACGAGTCATTAACACCGAACGAGTGTC
AAAGATCGCTGACCCGTCA
back to top

protein sequence of SMED30012356-orf-1

>SMED30012356-orf-1 ID=SMED30012356-orf-1|Name=SMED30012356-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MISYFILALTISLVSCDTFEARSLEFEERYFKEKSSSLLVELIRTLRTAY
EKGAEEFDRVINDSDIKGILDHMDALTRRLAESIINKFKELIKKIDEATK
PISEPSKRNLKESSTKLMKRLVQILLNAYKQGLEYFDRVVNDSDVQGILD
HLGPLSRKIADGIINQFRELIEKIDEATKETQTNEKRSESSIELLKKLNE
ILLKAYNKGGEYVAQVINDPNVKAILDHLGPLSRRVAESIINNFRELIKK
IDEATKEKTEVEKRDFKESSVRLLKKLVNILVKAFEKGSEAFYKAINDPD
VKEILNSLDSLSRRTANFIIEKFKELVIKLDELTTEKPKSERGLIEDSKN
NFKKLIQILINASRKGAEYFINIISDPDFVAIQENLNSIEQKIINSIIEK
FLQIFDKIDKATKPNSDVPFAVSDWQEDATVQLKKLTQILLKAYRQGGEY
FEKVINDSDVQNILQHLGPLTRRIATSLIDNFRELIEKIDNATKESTF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000067goblet cell
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 160..187
NoneNo IPR availableCOILSCoilCoilcoord: 237..264
NoneNo IPR availableCOILSCoilCoilcoord: 475..495
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.775
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 29..368