Palmitoyltransferase

Overview
NamePalmitoyltransferase
Smed IDSMED30012350
Length (bp)1245
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Palmitoyltransferase (SMED30012350) t-SNE clustered cells

Violin plots show distribution of expression levels for Palmitoyltransferase (SMED30012350) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Palmitoyltransferase (SMED30012350) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Palmitoyltransferase (SMED30012350) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012350

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30012350h1SMcG0005549 dd_Smed_v4_6073_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ZDHHC23 (zinc finger DHHC-type containing 23 [Source:HGNC Symbol;Acc:HGNC:28654])

HSP 1 Score: 57.3806 bits (137), Expect = 8.608e-9
Identity = 44/180 (24.44%), Postives = 84/180 (46.67%), Query Frame = 3
Query:  534 SKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCISFPNCI-------------NKGFIYNWLEF 1034
            SK P+ +      +  ++C KCQ   P R  HC IC  C     +H  WIN+C+ + N + + +  L+  +T++Y I +++ ++C  R     F  +  C  +Y++   +  F    +++I T+ +    L +++ IS N+T  E +  +                   N+GF+ NW +F
Sbjct:   47 SKMPAGS---PTKAKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILALLIFLLTSVYGITLTLDTICRDRSV---FTALFYCPGVYANYSSALSFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQALRQKTGRRLLCGLIVDTGQYNRGFLRNWHQF 220          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ZDHHC23 (zinc finger DHHC-type containing 23 [Source:HGNC Symbol;Acc:HGNC:28654])

HSP 1 Score: 55.4546 bits (132), Expect = 9.367e-8
Identity = 38/150 (25.33%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  534 SKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCI 983
            SK P+ +      +  ++C KCQ   P R  HC IC  C     +H  WIN+C+ + N + + +  L+  +T++Y I +++ ++C  R     F  +  C  +Y++   +  F    +++I T+ +    L +++ IS N+T  E +  +
Sbjct:  240 SKMPAGS---PTKAKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILALLIFLLTSVYGITLTLDTICRDRSV---FTALFYCPGVYANYSSALSFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQAL 383          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ZDHHC23 (zinc finger DHHC-type containing 23 [Source:HGNC Symbol;Acc:HGNC:28654])

HSP 1 Score: 55.0694 bits (131), Expect = 1.134e-7
Identity = 38/150 (25.33%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  534 SKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCI 983
            SK P+ +      +  ++C KCQ   P R  HC IC  C     +H  WIN+C+ + N + + +  L+  +T++Y I +++ ++C  R     F  +  C  +Y++   +  F    +++I T+ +    L +++ IS N+T  E +  +
Sbjct:  246 SKMPAGS---PTKAKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILALLIFLLTSVYGITLTLDTICRDRSV---FTALFYCPGVYANYSSALSFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQAL 389          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ZDHHC23 (zinc finger DHHC-type containing 23 [Source:HGNC Symbol;Acc:HGNC:28654])

HSP 1 Score: 55.0694 bits (131), Expect = 1.293e-7
Identity = 38/150 (25.33%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  534 SKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCI 983
            SK P+ +      +  ++C KCQ   P R  HC IC  C     +H  WIN+C+ + N + + +  L+  +T++Y I +++ ++C  R     F  +  C  +Y++   +  F    +++I T+ +    L +++ IS N+T  E +  +
Sbjct:  246 SKMPAGS---PTKAKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILALLIFLLTSVYGITLTLDTICRDRSV---FTALFYCPGVYANYSSALSFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQAL 389          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ZDHHC23 (zinc finger DHHC-type containing 23 [Source:HGNC Symbol;Acc:HGNC:28654])

HSP 1 Score: 55.0694 bits (131), Expect = 1.293e-7
Identity = 38/150 (25.33%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  534 SKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCI 983
            SK P+ +      +  ++C KCQ   P R  HC IC  C     +H  WIN+C+ + N + + +  L+  +T++Y I +++ ++C  R     F  +  C  +Y++   +  F    +++I T+ +    L +++ IS N+T  E +  +
Sbjct:  246 SKMPAGS---PTKAKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILALLIFLLTSVYGITLTLDTICRDRSV---FTALFYCPGVYANYSSALSFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQAL 389          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: dhhc-3 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q95X59])

HSP 1 Score: 48.521 bits (114), Expect = 3.644e-6
Identity = 17/60 (28.33%), Postives = 33/60 (55.00%), Query Frame = 3
Query:  588 CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIH 767
            C KC    P R  HCS+C RC     +H  W+N C+ + N++ + +  +  A+ +++ ++
Sbjct:   86 CQKCASIKPDRAHHCSVCERCIRRMDHHCPWVNNCVGEGNQKFFVLFTMYIALLSMHALY 145          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: dhhc-3 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:Q95X59])

HSP 1 Score: 48.521 bits (114), Expect = 3.644e-6
Identity = 17/60 (28.33%), Postives = 33/60 (55.00%), Query Frame = 3
Query:  588 CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIH 767
            C KC    P R  HCS+C RC     +H  W+N C+ + N++ + +  +  A+ +++ ++
Sbjct:   86 CQKCASIKPDRAHHCSVCERCIRRMDHHCPWVNNCVGEGNQKFFVLFTMYIALLSMHALY 145          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: GABPI (gene:FBgn0031495 transcript:FBtr0344734)

HSP 1 Score: 55.0694 bits (131), Expect = 4.920e-8
Identity = 29/110 (26.36%), Postives = 51/110 (46.36%), Query Frame = 3
Query:  588 CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTP----RMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTS 905
            C  C++  P R  HC +C  C     +H+ W+N CI + N   Y V   ++ I  +   ++++TS+C P    R      L+ DDC  ++        FV   + ++ +S
Sbjct:  191 CEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISS 300          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: GABPI (gene:FBgn0031495 transcript:FBtr0344735)

HSP 1 Score: 55.0694 bits (131), Expect = 4.920e-8
Identity = 29/110 (26.36%), Postives = 51/110 (46.36%), Query Frame = 3
Query:  588 CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTP----RMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTS 905
            C  C++  P R  HC +C  C     +H+ W+N CI + N   Y V   ++ I  +   ++++TS+C P    R      L+ DDC  ++        FV   + ++ +S
Sbjct:  191 CEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISS 300          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: GABPI (gene:FBgn0031495 transcript:FBtr0077651)

HSP 1 Score: 54.6842 bits (130), Expect = 7.071e-8
Identity = 29/110 (26.36%), Postives = 51/110 (46.36%), Query Frame = 3
Query:  588 CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTP----RMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTS 905
            C  C++  P R  HC +C  C     +H+ W+N CI + N   Y V   ++ I  +   ++++TS+C P    R      L+ DDC  ++        FV   + ++ +S
Sbjct:  268 CEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISS 377          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: GABPI (gene:FBgn0031495 transcript:FBtr0077652)

HSP 1 Score: 54.6842 bits (130), Expect = 7.071e-8
Identity = 29/110 (26.36%), Postives = 51/110 (46.36%), Query Frame = 3
Query:  588 CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTP----RMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTS 905
            C  C++  P R  HC +C  C     +H+ W+N CI + N   Y V   ++ I  +   ++++TS+C P    R      L+ DDC  ++        FV   + ++ +S
Sbjct:  268 CEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISS 377          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Dnz1 (gene:FBgn0027453 transcript:FBtr0080181)

HSP 1 Score: 53.5286 bits (127), Expect = 1.053e-7
Identity = 33/132 (25.00%), Postives = 60/132 (45.45%), Query Frame = 3
Query:  510 LYFGVVDISKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTS 905
            L F  +  + K +    +  SS    C +C+   P R  HC IC RC     +H  WIN C+ + N++ +    +  A+ ++Y I + + S   P       ++    R I+S ++   + VS +F +  T+
Sbjct:   78 LDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHSVIL---MLVSALFGLFVTA 206          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: zdhhc23a (zinc finger DHHC-type containing 23a [Source:ZFIN;Acc:ZDB-GENE-060526-38])

HSP 1 Score: 56.225 bits (134), Expect = 3.142e-8
Identity = 48/191 (25.13%), Postives = 84/191 (43.98%), Query Frame = 3
Query:  525 VDISKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCISFPNCIN---------------KGFIYNWLEFLVWK*D 1052
            +D   +   +    +   ++ C  CQ   P R  HC IC  C     +H  WIN+C+ + N R + +  L+  +T+ Y I + + S+C P+     F  +  C  +Y+    +  F    +++I T  LL   + +I+ +S N+T  E E  I+  N                  +GF+ NW++FL    D
Sbjct:  166 LDTDLRNGVSHLKGEKDVKKKCPVCQLVRPPRAGHCRICGACVLRMDHHCVWINSCVGQANHRQFILTLLLFLLTSFYGISLVLRSIC-PK--QSLFTAMLYCPGVYNQYSTALCFTCVWYSVIITGGLLHLFILQIINVSCNVT--EREAQIALRNKTGRRRFCGLVVETGDHSRGFLQNWIQFLTMNMD 351          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: zdhhc16b (zinc finger DHHC-type containing 16b [Source:NCBI gene;Acc:393316])

HSP 1 Score: 55.0694 bits (131), Expect = 7.335e-8
Identity = 33/111 (29.73%), Postives = 47/111 (42.34%), Query Frame = 3
Query:  588 CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDC------------RYIYSDVIYSWIFVSCV 884
            C KC    P R  HCSICNRC     +H  W+N C+   N R +F  CL   +  +Y       S+    MF D +  I+              R ++  ++Y W+  S V
Sbjct:  155 CKKCIVPKPARTHHCSICNRCILKMDHHCPWLNNCVGHFNHRYFFSFCLFMTMGCVY------CSISAKDMFLDAYNAIESSYQTPPPAFTHQERMVHKSLVYLWVLTSSV 259          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: zdhhc23a (zinc finger DHHC-type containing 23a [Source:ZFIN;Acc:ZDB-GENE-060526-38])

HSP 1 Score: 54.299 bits (129), Expect = 1.459e-7
Identity = 46/173 (26.59%), Postives = 79/173 (45.66%), Query Frame = 3
Query:  579 REYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCISFPNCIN---------------KGFIYNWLEFLVWK*D 1052
            ++ C  CQ   P R  HC IC  C     +H  WIN+C+ + N R + +  L+  +T+ Y I + + S+C P+     F  +  C  +Y+    +  F    +++I T  LL   + +I+ +S N+T  E +  I+  N                  +GF+ NW++FL    D
Sbjct:  224 KKKCPVCQLVRPPRAGHCRICGACVLRMDHHCVWINSCVGQANHRQFILTLLLFLLTSFYGISLVLRSIC-PK--QSLFTAMLYCPGVYNQYSTALCFTCVWYSVIITGGLLHLFILQIINVSCNVTEREAQ--IALRNKTGRRRFCGLVVETGDHSRGFLQNWIQFLTMNMD 391          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: zdhhc23b (zinc finger DHHC-type containing 23b [Source:ZFIN;Acc:ZDB-GENE-040808-13])

HSP 1 Score: 51.6026 bits (122), Expect = 1.045e-6
Identity = 54/180 (30.00%), Postives = 77/180 (42.78%), Query Frame = 3
Query:  573 SNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTP-RMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFE-------------NCISFPNCINKGFIYNWLEFLVWK*DICTMPS 1070
              R +C  C+   P R  HC IC  C     +H  WIN+C+   N R + +  L   +T+IY I + + SVC   R+ +  F     C  +YS    +  F    ++ I T  LL  LL +I+ IS N+T  E                 I      ++GF  NW EFL    D  T P+
Sbjct:  247 QKRNWCAVCKVVRPQRAGHCRICGVCVLRLDHHCVWINSCVGLANHRTFLLTLLFFLLTSIYGISLVLASVCPDQRVLTALFY----CPDVYSQYSSALCFTCAWYSSIVTGGLLHLLLLQILNISLNVTEREARLALREKSAQRRLWGLIVHTGHYSRGFWSNWTEFLTMTED--TQPA 420          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: zdhhc23b (zinc finger DHHC-type containing 23b [Source:ZFIN;Acc:ZDB-GENE-040808-13])

HSP 1 Score: 49.6766 bits (117), Expect = 4.224e-6
Identity = 53/180 (29.44%), Postives = 77/180 (42.78%), Query Frame = 3
Query:  573 SNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTP-RMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFE-------------NCISFPNCINKGFIYNWLEFLVWK*DICTMPS 1070
              R +C  C+   P R  HC IC  C     +H  WIN+C+   N R + +  L   +T+I+ I + + SVC   R+ +  F     C  +YS    +  F    ++ I T  LL  LL +I+ IS N+T  E                 I      ++GF  NW EFL    D  T P+
Sbjct:  244 QKRNWCAVCKVVRPRRAGHCRICGVCVLRLDHHCVWINSCVGLANHRTFLLTLLFFLLTSIFGISLVLASVCPDQRVLTALFY----CPDVYSQYSSALCFTCAWYSSIVTGGLLHLLLLQILNISLNVTEREARLALREKSAQRRLWGLIVHTGHYSRGFWSNWTEFLTMTED--TQPA 417          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: ZDHHC23 (zinc finger, DHHC-type containing 23 [Source:NCBI gene;Acc:100379670])

HSP 1 Score: 51.9878 bits (123), Expect = 9.584e-7
Identity = 49/174 (28.16%), Postives = 78/174 (44.83%), Query Frame = 3
Query:  561 DDDS--SNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFE-------------FENCISFPNCINKGFIYNWLEFL 1037
            D DS  + + +C  CQ   P R  HC IC  C     +H  WIN CI   N R + +L L    T++Y I V++  +C  R   + F+ +  C  +Y++   ++ +    +  I T+ +   LL +++ IS N+T  E             F   +      N+GF  NW  FL
Sbjct:  229 DGDSLVAEKNWCKMCQLVRPPRSGHCMICGFCVRRLDHHCVWINNCIGSHNHRFFILLLLFFLFTSVYGITVTLNLLCRGR---NAFVALLYCPGVYTEYSTAFNYTCVWYCAIVTAGMAYILLIQLINISYNVTEREARIALRNKTARRMFCGLVVDTGAYNQGFFQNWQNFL 399          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: acp6 (acid phosphatase 6, lysophosphatidic [Source:Xenbase;Acc:XB-GENE-994568])

HSP 1 Score: 51.2174 bits (121), Expect = 1.531e-6
Identity = 24/66 (36.36%), Postives = 32/66 (48.48%), Query Frame = 3
Query:  561 DDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIY 758
            + D  +   C KC    P R  HCSIC+RC     +H  W+N C+   N R +F  CL   +  IY
Sbjct:  139 ETDIPSVSICRKCIAHKPARTHHCSICSRCVLKMDHHCPWLNNCVGHYNHRYFFSFCLFMTMGCIY 204          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: zdhhc7 (zinc finger DHHC-type containing 7 [Source:NCBI gene;Acc:100485887])

HSP 1 Score: 51.2174 bits (121), Expect = 1.581e-6
Identity = 28/106 (26.42%), Postives = 44/106 (41.51%), Query Frame = 3
Query:  471 VMLVFTGHLFCMWLYFGVVDISKKPSANCCDDDSSNREY--------CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQI 764
             +L  T HL  M     + D    P  N   +   + +         C KC    P R  HCSIC RC     +H  W+N C+ + N+R + +  +  A+ + Y +
Sbjct:   87 AVLALTSHLRTM-----LTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCSIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALISTYAL 187          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Zdhhc23 (zinc finger, DHHC domain containing 23 [Source:MGI Symbol;Acc:MGI:2685625])

HSP 1 Score: 62.3882 bits (150), Expect = 4.091e-10
Identity = 41/166 (24.70%), Postives = 78/166 (46.99%), Query Frame = 3
Query:  576 NREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCISFPNC-------------INKGFIYNWLEF 1034
              ++C KCQ   P R  HC IC  C     +H  WIN+C+ + N + + +   +  +T++Y I +++ ++C  R     F  +  C  +Y++   +  F    +++I T+ +    L +++ IS N+T  E +  +                   N+GF+ NWL+F
Sbjct:  247 KEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILALSIFLLTSVYGISLTLNTICRDRSL---FTALFYCPGVYANYSSALSFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQALRQKTGRRLLCGLIVDTGQYNRGFLRNWLQF 409          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Zdhhc23 (zinc finger, DHHC domain containing 23 [Source:MGI Symbol;Acc:MGI:2685625])

HSP 1 Score: 62.3882 bits (150), Expect = 4.091e-10
Identity = 41/166 (24.70%), Postives = 78/166 (46.99%), Query Frame = 3
Query:  576 NREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCISFPNC-------------INKGFIYNWLEF 1034
              ++C KCQ   P R  HC IC  C     +H  WIN+C+ + N + + +   +  +T++Y I +++ ++C  R     F  +  C  +Y++   +  F    +++I T+ +    L +++ IS N+T  E +  +                   N+GF+ NWL+F
Sbjct:  247 KEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILALSIFLLTSVYGISLTLNTICRDRSL---FTALFYCPGVYANYSSALSFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQALRQKTGRRLLCGLIVDTGQYNRGFLRNWLQF 409          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Zdhhc16 (zinc finger, DHHC domain containing 16 [Source:MGI Symbol;Acc:MGI:1921418])

HSP 1 Score: 50.8322 bits (120), Expect = 9.841e-8
Identity = 23/65 (35.38%), Postives = 31/65 (47.69%), Query Frame = 3
Query:  564 DDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIY 758
            +D +    C KC    P R  HCSICNRC     +H  W+N C+   N R +F  C    +  +Y
Sbjct:   24 NDIATVSICKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVY 88          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Zdhhc25 (zinc finger, DHHC domain containing 25 [Source:MGI Symbol;Acc:MGI:1917323])

HSP 1 Score: 52.7582 bits (125), Expect = 2.541e-7
Identity = 25/94 (26.60%), Postives = 40/94 (42.55%), Query Frame = 3
Query:  477 LVFTGHLFCMWLYFGVVDISKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIY 758
            L    HL  M    G V +   P  +          YC  C  +IP    HC++C RC     +H  WIN CI + N++ + +  +   +T+ +
Sbjct:   81 LALASHLRTMLTDPGSVPLGNPPGPD-------TVSYCTDCHSAIPRTACHCTVCQRCIRKNDHHCPWINNCIGEDNQKYFLLFTMYIGLTSTH 167          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Zdhhc16 (zinc finger, DHHC domain containing 16 [Source:MGI Symbol;Acc:MGI:1921418])

HSP 1 Score: 50.447 bits (119), Expect = 2.084e-6
Identity = 23/65 (35.38%), Postives = 31/65 (47.69%), Query Frame = 3
Query:  564 DDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIY 758
            +D +    C KC    P R  HCSICNRC     +H  W+N C+   N R +F  C    +  +Y
Sbjct:  149 NDIATVSICKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVY 213          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q76IC6|ZDH23_RAT (Palmitoyltransferase ZDHHC23 OS=Rattus norvegicus OX=10116 GN=Zdhhc23 PE=1 SV=2)

HSP 1 Score: 65.0846 bits (157), Expect = 3.715e-10
Identity = 46/183 (25.14%), Postives = 86/183 (46.99%), Query Frame = 3
Query:  528 DISKKPSANCCDDDSSNRE-YCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCISFPNC-------------INKGFIYNWLEF 1034
            D +K  S    D  + ++E +C KCQ   P R  HC IC  C     +H  WIN+C+ + N + + +   +  +T++Y I +++ ++C  R     F  +  C  +Y++   +  F    +++I T+ +    L +++ IS N+T  E +  +                   N+GF+ NWL+F
Sbjct:  234 DDAKGSSRVGLDSPAKSKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILALSIFLLTSVYGISLTLNTICRDRSL---FTALFYCPGVYANYSSALSFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQALRQKTGRRLLCGLIVDTGQYNRGFLRNWLQF 413          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q5Y5T3|ZDH23_MOUSE (Palmitoyltransferase ZDHHC23 OS=Mus musculus OX=10090 GN=Zdhhc23 PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.861e-9
Identity = 41/166 (24.70%), Postives = 78/166 (46.99%), Query Frame = 3
Query:  576 NREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCISFPNC-------------INKGFIYNWLEF 1034
              ++C KCQ   P R  HC IC  C     +H  WIN+C+ + N + + +   +  +T++Y I +++ ++C  R     F  +  C  +Y++   +  F    +++I T+ +    L +++ IS N+T  E +  +                   N+GF+ NWL+F
Sbjct:  247 KEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILALSIFLLTSVYGISLTLNTICRDRSL---FTALFYCPGVYANYSSALSFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQALRQKTGRRLLCGLIVDTGQYNRGFLRNWLQF 409          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|A0A0R4IF99|ZD16B_DANRE (Palmitoyltransferase ZDHHC16B OS=Danio rerio OX=7955 GN=zdhhc16b PE=3 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 4.997e-7
Identity = 30/84 (35.71%), Postives = 39/84 (46.43%), Query Frame = 3
Query:  588 CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRY 839
            C KC    P R  HCSICNRC     +H  W+N C+   N R +F  CL   +  +Y       S+    MF D +  I+  RY
Sbjct:  155 CKKCIVPKPARTHHCSICNRCILKMDHHCPWLNNCVGHFNHRYFFSFCLFMTMGCVY------CSISAKDMFLDAYNAIESGRY 232          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q8IYP9|ZDH23_HUMAN (Palmitoyltransferase ZDHHC23 OS=Homo sapiens OX=9606 GN=ZDHHC23 PE=1 SV=3)

HSP 1 Score: 55.0694 bits (131), Expect = 5.448e-7
Identity = 38/150 (25.33%), Postives = 75/150 (50.00%), Query Frame = 3
Query:  534 SKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCI 983
            SK P+ +      +  ++C KCQ   P R  HC IC  C     +H  WIN+C+ + N + + +  L+  +T++Y I +++ ++C  R     F  +  C  +Y++   +  F    +++I T+ +    L +++ IS N+T  E +  +
Sbjct:  246 SKMPAGS---PTKAKEDWCAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILALLIFLLTSVYGITLTLDTICRDRSV---FTALFYCPGVYANYSSALSFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQAL 389          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q3EBC2|ZDHC5_ARATH (Probable protein S-acyltransferase 17 OS=Arabidopsis thaliana OX=3702 GN=PAT17 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.562e-6
Identity = 27/81 (33.33%), Postives = 42/81 (51.85%), Query Frame = 3
Query:  528 DISKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMY-------FVLCLMAAIT 749
            ++S+  SA   DD   +++ C  C+   P R +HCSICNRC     +H  W+N CI + N + +       F+LCL   + 
Sbjct:  142 NVSRYISAYPYDDIIYSKKECSTCKIPKPARSKHCSICNRCVARFDHHCGWMNNCIGERNTKYFMAFLLWHFLLCLYGTVA 222          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A0B7A792 (Palmitoyltransferase OS=Arion vulgaris OX=1028688 GN=ORF101825 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 2.462e-19
Identity = 57/157 (36.31%), Postives = 95/157 (60.51%), Query Frame = 3
Query:  600 QRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFEN--------CISF----PNCINKGFIYNWLEF 1034
            +  +P R  +C IC     +  +H  WI++C+   N R + +  ++  +T +Y IH++ T++CTP+M+ DWFL+ +DCR++Y+D + S  FV+ ++ +I TSL+ + L+Y+ +LISQN+T  E           CI F    PN  N+G + NWLEF
Sbjct:  262 KSDLPARTGYCKICESYIAVRDHHCVWIDSCVGASNHRSFLLAMILFVLTGMYSIHLTFTTICTPKMYFDWFLLPNDCRWLYNDFLTSICFVTGIYCIIVTSLMYLGLVYQSILISQNVTSHELAQARRQGLTKCIFFVPNNPN--NQGILRNWLEF 416          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A0L8HL13 (Palmitoyltransferase OS=Octopus bimaculoides OX=37653 GN=OCBIM_22012382mg PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 8.362e-19
Identity = 58/161 (36.02%), Postives = 91/161 (56.52%), Query Frame = 3
Query:  585 YCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCI----------SFPNCINKGFIYNWLEFL 1037
            +C  C    P R  HC +C+ C ++  +H  WI+ CI   N R++ V  +      +Y  H++ T+VCTP M+ +W L  +DCR+IYSD   S  FV+  +  I T+++L+  L +I+LISQNIT  E    +          ++ N  NKGF++NW+EF+
Sbjct:  128 WCGFCNNRKPPRSGHCYVCSSCVSVRDHHCVWIDNCIGANNHRIFIVCMIFFLFCGLYGSHLTFTTVCTPEMYFNWILFPNDCRFIYSDFQTSISFVTACYVSISTAVMLLAFLQQILLISQNITSQELHQALVRKKTFCGIYAYNNVHNKGFLHNWMEFI 288          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: V4BIG1 (Palmitoyltransferase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_125973 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 4.999e-18
Identity = 57/196 (29.08%), Postives = 103/196 (52.55%), Query Frame = 3
Query:  489 GHLFCMWLYFGVVDISKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCI----------SFPNCINKGFIYNWLEFLVWK 1046
            GHL     +    D+ +  S +   +D  +   C +C+ + P R  HC+IC+ C  +  +H  WI+ C+   N R +    ++      Y  H+++T++CTP M  DW L+  DCR++Y++   S  FV+  + +I +S++   L+++++LISQN+T  E  N            +  N  N+G + NW+EFL ++
Sbjct:  202 GHLKNGSDFTNDKDLHEIQSFDIDIEDKRSINECNQCKLNRPPRSGHCNICDICIEVRDHHCVWIDNCVGANNHRPFLAAMILFIFCGFYGAHLTLTTICTPDMVFDWILLPSDCRWLYAEFSTSLCFVTTCYTLIGSSIMSFGLIHQLLLISQNLTSQELHNATVRGLTKCCFFAENNIHNQGVLRNWIEFLFYR 397          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A433TF17 (Palmitoyltransferase OS=Elysia chlorotica OX=188477 GN=EGW08_012073 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.279e-17
Identity = 56/152 (36.84%), Postives = 82/152 (53.95%), Query Frame = 3
Query:  612 PHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFE-----------FENCISFPNCINKGFIYNWLEF 1034
            P R   C IC+   T+  +H  WIN CI   N R + +  LM  IT  Y  H++ T++CTP M+ DWFL+ +DCR++Y+D + S  FV+ ++  I  S + V  +Y+  LISQN+T  E           F    +  N  N G I NW++F
Sbjct:  252 PPRSGFCKICDAYITVRDHHCVWINACIGASNHRYFLLAMLMFIITGSYACHLTFTTICTPTMYFDWFLLPNDCRWLYADFLTSICFVTALYAAIGVSCMCVAFIYQFALISQNVTAHELARARGLGLVSFGGLFAQDNPNNHGLIRNWVDF 403          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: T1FSF3 (Palmitoyltransferase OS=Helobdella robusta OX=6412 GN=20211750 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.994e-17
Identity = 90/313 (28.75%), Postives = 147/313 (46.96%), Query Frame = 3
Query:  216 KVNSYNITSAIIIIANYWIGTINGYFTILALISS-TIMIFSLITMQNNRQSRYISVLGQWFKIYYFLQLAIFXXXXXXXXXXXXWEVMLVFTGHLFCMWLYFGV------VDISKKPSANCCDDDSSNRE---------------------YCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENC-----------ISFPNCINKGFIYNWLEFL 1037
            K+N      AI +     +     Y+T  +L+S  T++I S    +  +++R          IY F   A+F+V+V    K+LLWE++L+ T +L  ++L F V      + + +K   N     S  R+                     +C +C+   P R  HC+ C+ C     +H  W++ CI K N R +F+   M   T +Y +H++ T++CTP ++ DWFLV  DCR++Y+D        S V + I  S +L  L+ + VLISQN+T  E+              ++  N  +KGF+ NW  FL
Sbjct:   78 KMNFELAYPAITLPFTLCLAAYGPYWTFFSLLSFFTVLIISSRLCRYRKRNRLFFATTLSSSIYLF---AVFIVVVVGFRKILLWEILLMATLYLITLYLMFQVKHNSNLLRVDRKNYRNPEKLSSDGRQLNVRQVSWIDSRPIIDDNLQLFCGQCKVDRPPRSGHCTRCDCCIFGRDHHCIWLDVCIGKHNHRSFFLFLFMFFTTGVYGVHLTTTTLCTPVIYLDWFLVPADCRFLYTDFPSGLCVCSVVLSCIGLSFILCLLVQQFVLISQNLTSQEYHRARQRGWLKCWGLLALHNSNDKGFLKNWYNFL 387          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: zdhhc16a (zinc finger DHHC-type containing 16 [Source:NCBI gene;Acc:103039258])

HSP 1 Score: 52.7582 bits (125), Expect = 3.466e-7
Identity = 34/110 (30.91%), Postives = 44/110 (40.00%), Query Frame = 3
Query:  588 CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVID-----------DCRYIYSDVIYSWIFVSCV 884
            C KC    P R  HC ICN C     +H  W+N C+   N R +F  CL   +  +Y       SV    +F D +  ID             R  +  VIY W+  S V
Sbjct:  152 CKKCVIPKPPRTHHCGICNTCILKMDHHCPWLNNCVGHFNHRYFFSFCLYMTLGCLY------CSVSGRTLFIDAYNAIDSYHTSSTPYTFKDRMFHKSVIYMWVLTSTV 255          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: zdhhc16b (probable palmitoyltransferase ZDHHC16 [Source:NCBI gene;Acc:103038698])

HSP 1 Score: 50.8322 bits (120), Expect = 1.363e-6
Identity = 33/111 (29.73%), Postives = 45/111 (40.54%), Query Frame = 3
Query:  588 CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDC------------RYIYSDVIYSWIFVSCV 884
            C KC    P R  HCSICN C     +H  W+N C+   N R +F  CL   +  IY       S+    MF D +  I+              R  +  ++Y W+  S V
Sbjct:  156 CKKCIVPKPARTHHCSICNTCVLKMDHHCPWLNNCVGHFNHRYFFSFCLYMTMGCIY------CSISAKDMFLDAYNAIESYYQTPPPPFTSHERLFHKSLLYLWVLTSSV 260          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: zdhhc16b (probable palmitoyltransferase ZDHHC16 [Source:NCBI gene;Acc:103038698])

HSP 1 Score: 50.8322 bits (120), Expect = 1.363e-6
Identity = 33/111 (29.73%), Postives = 45/111 (40.54%), Query Frame = 3
Query:  588 CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDC------------RYIYSDVIYSWIFVSCV 884
            C KC    P R  HCSICN C     +H  W+N C+   N R +F  CL   +  IY       S+    MF D +  I+              R  +  ++Y W+  S V
Sbjct:  156 CKKCIVPKPARTHHCSICNTCVLKMDHHCPWLNNCVGHFNHRYFFSFCLYMTMGCIY------CSISAKDMFLDAYNAIESYYQTPPPPFTSHERLFHKSLLYLWVLTSSV 260          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: zdhhc23b (zinc finger DHHC-type containing 23 [Source:NCBI gene;Acc:103042788])

HSP 1 Score: 50.0618 bits (118), Expect = 2.374e-6
Identity = 47/182 (25.82%), Postives = 78/182 (42.86%), Query Frame = 3
Query:  534 SKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVC-TPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCISFP-------------NCINKGFIYNWLEFL 1037
            S          D+  + +C  C+   P R  HC IC  C     +H  WIN+C+ + N R + +  L+   T++Y I++ + SVC T  + +  F     C  +YS    +  F    ++ I T  LL  L+ +++ +S N+T  E    +                   ++GF  NW EFL
Sbjct:  192 SGADPGGSLQKDTVKKNWCPVCRVVKPLRAGHCRICGVCVLRLDHHCVWINSCVGQANHRSFLLTLLLFLSTSVYGINLVLRSVCPTQSILTALFY----CPDVYSQYSSALCFTCAWYSSIVTGGLLHLLVLQLINVSYNVTEREARIALREKTGRSLYWGFVIDTGVYSRGFRGNWTEFL 369          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: zdhhc23b (zinc finger DHHC-type containing 23 [Source:NCBI gene;Acc:103042788])

HSP 1 Score: 49.6766 bits (117), Expect = 3.963e-6
Identity = 47/183 (25.68%), Postives = 78/183 (42.62%), Query Frame = 3
Query:  534 SKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVC-TPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCISFP-------------NCINKGFIYNWLEFLV 1040
            S          D+  + +C  C+   P R  HC IC  C     +H  WIN+C+ + N R + +  L+   T++Y I++ + SVC T  + +  F     C  +YS    +  F    ++ I T  LL  L+ +++ +S N+T  E    +                   ++GF  NW EFL 
Sbjct:  234 SGADPGGSLQKDTVKKNWCPVCRVVKPLRAGHCRICGVCVLRLDHHCVWINSCVGQANHRSFLLTLLLFLSTSVYGINLVLRSVCPTQSILTALFY----CPDVYSQYSSALCFTCAWYSSIVTGGLLHLLVLQLINVSYNVTEREARIALREKTGRSLYWGFVIDTGVYSRGFRGNWTEFLT 412          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: zdhhc16a (zinc finger DHHC-type containing 16a [Source:NCBI gene;Acc:394017])

HSP 1 Score: 50.447 bits (119), Expect = 3.406e-7
Identity = 25/74 (33.78%), Postives = 33/74 (44.59%), Query Frame = 3
Query:  513 YFGVVDISKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCL 734
            Y G+      P     D  + +   C +C    P R  HCSICNRC     +H  W+N C+   N R +F  CL
Sbjct:  102 YKGLTTSPGYPPPGQVDLPAVS--ICKRCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGNYNHRYFFSFCL 173          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003931.1 (pep scaffold:Pmarinus_7.0:GL482317:448:5011:-1 gene:ENSPMAG00000003595.1 transcript:ENSPMAT00000003931.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 5.874e-7
Identity = 27/99 (27.27%), Postives = 43/99 (43.43%), Query Frame = 3
Query:  471 VMLVFTGHLFCMWLYFGVVDISKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNR-CSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQI 764
            V  + T +L  ++   G V +  +P  +   ++S    YC KCQ   P R  HC  C R C     +H  WIN C+   NR  +    L+     ++ +
Sbjct:   54 VPTLLTPYLHAVFAGAGFVSVGWRPERS---EESRLLPYCEKCQSFKPLRSHHCRQCQRWCVLKMDHHCPWINACVGLRNRASFVAFLLLTPTAGLHSL 149          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: zdhhc3a (zinc finger DHHC-type containing 3a [Source:ZFIN;Acc:ZDB-GENE-040718-484])

HSP 1 Score: 46.2098 bits (108), Expect = 3.106e-6
Identity = 21/50 (42.00%), Postives = 28/50 (56.00%), Query Frame = 3
Query:  588 CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLM 737
            C KC    P R  HCS+C RC     +H  W+N C+ + N++ YFVL  M
Sbjct:   27 CPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGESNQK-YFVLFTM 75          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: zdhhc21 (zinc finger DHHC-type containing 21 [Source:ZFIN;Acc:ZDB-GENE-080401-2])

HSP 1 Score: 45.8246 bits (107), Expect = 7.061e-6
Identity = 22/74 (29.73%), Postives = 34/74 (45.95%), Query Frame = 3
Query:  561 DDDSSNREY------CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQI 764
            + D S+ E+      C KC    P R  HCS C  C     +H  WIN C+ + N+ ++  LC    + + Y +
Sbjct:   78 ERDMSSEEFSVQSHVCQKCSIVKPARAHHCSRCGHCVRRMDHHCPWINNCVGEGNQWLFIQLCFYTQLLSTYAL 151          
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Match: SWF1 (Palmitoyltransferase that acts on transmembrane proteins; including the SNAREs Snc1p, Syn8p, Tlg1p and likely all SNAREs; contains an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; may have a role in vacuole fusion [Source:SGD;Acc:S000002533])

HSP 1 Score: 50.0618 bits (118), Expect = 2.729e-7
Identity = 29/79 (36.71%), Postives = 42/79 (53.16%), Query Frame = 3
Query:  588 CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQI--------HVSITSVCT-PR 797
            C  C+   P R +HCSICNRC  +A +H  WIN CI K N   +++      I+NI+ +        ++S+ S  T PR
Sbjct:  136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL----ISNIFSMCYAFLRLWYISLNSTSTLPR 210          
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Match: ERF2 (Subunit of a palmitoyltransferase; this complex adds a palmitoyl lipid moiety to heterolipidated substrates such as Ras1p and Ras2p through a thioester linkage; mutants partially mislocalize Ras2p to the vacuole; palmitoyltransferase is composed of Erf2p and Shr5p [Source:SGD;Acc:S000004236])

HSP 1 Score: 48.9062 bits (115), Expect = 7.299e-7
Identity = 21/58 (36.21%), Postives = 32/58 (55.17%), Query Frame = 3
Query:  582 EYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNI 755
            +YC  C+   P R  HCS CN C  +  +H  W+N CI K N R + +  L A ++++
Sbjct:  173 KYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSV 230          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO46304 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7RQK1])

HSP 1 Score: 56.9954 bits (136), Expect = 5.494e-9
Identity = 23/73 (31.51%), Postives = 34/73 (46.58%), Query Frame = 3
Query:  540 KPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIY 758
             P  +       N   C KC ++ P R  HCSIC RC     +H  WIN C+   N R + + C+   + ++Y
Sbjct:  114 PPEGDKLPGKPENYLICRKCSQAKPPRTHHCSICKRCILKMDHHCPWINNCVGHFNHRYFILFCIYMTLGSLY 186          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO36348 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7SIV7])

HSP 1 Score: 55.8398 bits (133), Expect = 1.250e-8
Identity = 44/170 (25.88%), Postives = 73/170 (42.94%), Query Frame = 3
Query:  567 DSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCISFPNCIN--------KGFIYNWLEFLVWK*D 1052
             S  R  C  C     HR +HC IC  C   + +H  W N CI   N+  + +  L   +T  + IH+S++++C P                 ++   + +FV   + ++F   + + L  ++V IS NIT  E+       + +         KGF+ NW +FL  K D
Sbjct:  203 KSYERLTCCFCTYGPFHRSKHCRICGYCVPRSDHHCVWTNCCIGHHNQGKFLLAILSFVMTGGWGIHLSLSTICKP----------------VTNAWAALMFVCTFYGVVFVLAMSMLLAQQLVFISLNITGDEWRRSPRSKSLLQVLRTNPHYKGFLQNWKDFLFLKRD 356          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO46319 (Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc:A7RQ92])

HSP 1 Score: 48.521 bits (114), Expect = 2.787e-6
Identity = 25/81 (30.86%), Postives = 37/81 (45.68%), Query Frame = 3
Query:  477 LVFTGHLFCMWLYFGVVDISKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMY 719
            L+    L  +WL  G V    +P+    + D+   ++C  CQ     R  HCS CNRC     +H  WIN C+   N + +
Sbjct:   53 LILYNFLRGIWLGPGYVPFKWRPAK---ESDTECLQFCHVCQGYKAPRAHHCSKCNRCVMKMDHHCPWINNCVGHYNMKSF 130          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: zdhhc23a (palmitoyltransferase ZDHHC23-like [Source:NCBI gene;Acc:101160931])

HSP 1 Score: 54.6842 bits (130), Expect = 8.833e-8
Identity = 52/201 (25.87%), Postives = 85/201 (42.29%), Query Frame = 3
Query:  540 KPSANCC----------DDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCIS-------------FPNCINKGFIYNWLEFLVWK*DICTMPST 1073
            +P+A+C           +  S+    C  C+   P R  HC  C  C     +H  WIN+C+ + N R + +   +  +T +Y I + + S+C PR +      +  C  +YS    +  F    ++ I T  LL  LL +I+ IS N+T  E +  +                   ++GF  NW+EFL     +C  P T
Sbjct:  196 QPAASCSMTSSELLKKEEAPSTKWSLCPVCKIIRPPRAGHCRSCGACVLRLDHHCIWINSCVGQANHRSFLLTLCVFVLTAVYGISLVLRSLC-PRQY--LMTALFYCPGVYSQSSTALCFTCSWYSSIITGGLLYLLLAQILNISFNVTEREVQQALRSKKDQRGVLGLRIHSGEHSRGFFQNWVEFLTM--SLCHCPRT 391          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: zdhhc16a (palmitoyltransferase ZDHHC16A-like [Source:NCBI gene;Acc:101164249])

HSP 1 Score: 53.5286 bits (127), Expect = 2.134e-7
Identity = 34/124 (27.42%), Postives = 56/124 (45.16%), Query Frame = 3
Query:  534 SKKPSANCCDDDSSNREY---CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMI 896
            + K S      + ++R +   C KC    P R  HC ICNRC     +H  W+N CI   N R +F  CL   +  +Y       S+    +F D +  ++  R+ ++D+    I V+ +  +I
Sbjct:  133 AAKTSPGYPPTEKNDRPFVAVCKKCIIPKPARTHHCGICNRCILKMDHHCPWLNNCIGHFNHRYFFSFCLFMTLGCVY------CSISGRNLFLDAYHALE--RFKHTDLEKPGIPVTGMGPLI 248          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: zdhhc16a (palmitoyltransferase ZDHHC16A-like [Source:NCBI gene;Acc:101164249])

HSP 1 Score: 53.5286 bits (127), Expect = 2.201e-7
Identity = 34/124 (27.42%), Postives = 56/124 (45.16%), Query Frame = 3
Query:  534 SKKPSANCCDDDSSNREY---CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMI 896
            + K S      + ++R +   C KC    P R  HC ICNRC     +H  W+N CI   N R +F  CL   +  +Y       S+    +F D +  ++  R+ ++D+    I V+ +  +I
Sbjct:  133 AAKTSPGYPPTEKNDRPFVAVCKKCIIPKPARTHHCGICNRCILKMDHHCPWLNNCIGHFNHRYFFSFCLFMTLGCVY------CSISGRNLFLDAYHALE--RFKHTDLEKPGIPVTGMGPLI 248          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: zdhhc16b (palmitoyltransferase ZDHHC16B [Source:NCBI gene;Acc:101163962])

HSP 1 Score: 50.0618 bits (118), Expect = 2.072e-6
Identity = 29/100 (29.00%), Postives = 40/100 (40.00%), Query Frame = 3
Query:  465 WEVMLVFTGHLFCMWLYFGVVDISKKPSANCCDDDSS--NREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIY 758
            W V     GH   + L F     +  P  +   +     +   C KC    P R  HCSICN C     +H  W+N C+   N R +F  CL   +  +Y
Sbjct:  118 WTVWHFGCGHWLLVMLAFHYYKATVTPPGHPPKNQQGLPSVSICKKCIVPKPARTHHCSICNTCVLKMDHHCPWLNNCVGHFNHRYFFSFCLYMTLGCVY 217          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: zdhhc23b (zinc finger DHHC-type containing 23 [Source:NCBI gene;Acc:101162717])

HSP 1 Score: 50.447 bits (119), Expect = 2.236e-6
Identity = 26/79 (32.91%), Postives = 42/79 (53.16%), Query Frame = 3
Query:  567 DSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMF 803
              SNR +C  CQ   P R  HC IC  C     +H  WIN+C+ + N R + +  ++  +T++Y I + + SVC  ++ 
Sbjct:  241 KESNRNWCSVCQVVRPPRAGHCRICGVCVLRLDHHCVWINSCVGQANHRSFLLTLVLFLLTSLYGIGLVLRSVCPQQLL 319          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000024957.1 (SMESG000024957.1)

HSP 1 Score: 343.584 bits (880), Expect = 9.758e-119
Identity = 179/181 (98.90%), Postives = 179/181 (98.90%), Query Frame = 3
Query:  504 MWLYFGVVDISKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSXXXXXXXXXXXXXSQNITHFEFENCISFPNCINKGFIYNWLEFLVWK 1046
            MWLYFGVVD SKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHN WINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSLLLVTLLYEIVLISQNITHFEFENCISFPNCINKGFIYNWLEFLVWK
Sbjct:    1 MWLYFGVVDNSKKPSANCCDDDSSNREYCIKCQRSIPHRGQHCSICNRCSTIAQYHNVWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSLLLVTLLYEIVLISQNITHFEFENCISFPNCINKGFIYNWLEFLVWK 181          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000028446.1 (SMESG000028446.1)

HSP 1 Score: 52.7582 bits (125), Expect = 2.458e-7
Identity = 28/85 (32.94%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  513 YFGVVDISKKPSANCCD-DDSSNR-EYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQ 761
            YFG+    K  SA   + + +S R ++C+ C+   P R  HCS+CN C     +H  W+N CI + N R +F+  L  ++  +Y 
Sbjct:   81 YFGIQSDGKPASAIVVEIEGTSVRMKWCVTCEFYRPPRCSHCSVCNHCVDSFDHHCPWVNNCIGRRNYRYFFLFLLSLSVHLLYD 165          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000033660.1 (SMESG000033660.1)

HSP 1 Score: 50.447 bits (119), Expect = 1.634e-6
Identity = 25/53 (47.17%), Postives = 32/53 (60.38%), Query Frame = 3
Query:  582 EYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMA 740
            ++C  CQ   P R  HCSICN+C     +H  W+N CI K N R YFVL L++
Sbjct:  102 KWCSTCQFYRPPRSSHCSICNKCIVAFDHHCPWVNNCIGKRNYR-YFVLFLLS 153          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000062891.1 (SMESG000062891.1)

HSP 1 Score: 50.0618 bits (118), Expect = 1.920e-6
Identity = 27/112 (24.11%), Postives = 56/112 (50.00%), Query Frame = 3
Query:  561 DDDSSNR-EYCIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSI------TSVCTPRMFSDWFLVIDDCRYIYSDVIYSWIFV 875
            +++S  R  +C+ CQ   P R  HC +CN+C     +H      CI  CN+R ++ LCL A I ++  +          +++ +  M+   F++     ++++  + S++F+
Sbjct:  171 EEESGLRWRFCVICQCDAPPRAHHCVVCNKCILKRDHHCFITGRCIGYCNQRYFYFLCLFAFINSVIGVVAGAYYIIYHSAIGSQSMWGSLFIIKSVYMWLWTKELESFLFI 282          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000041123.1 (SMESG000041123.1)

HSP 1 Score: 49.6766 bits (117), Expect = 2.260e-6
Identity = 32/121 (26.45%), Postives = 53/121 (43.80%), Query Frame = 3
Query:  471 VMLVFTGHLFCMWLYFGVVDISKKPSANCCDDDSSNREY--CIKCQRSIPHRGQHCSICNRCSTIAQYHNAWINTCIDKCNRRMY----FVLCLMAAITNIYQIHVSITSVCTPRMFSDWF 815
             ++    H+  ++   G V+       N      S+R    C+KC    P R  HCS+C RC     +H  WIN C+ + N++ +    F + LM+A      +H  I  +C    + D+F
Sbjct:  116 AIMAMLSHIKSVFTDPGTVEKGNATEENIEKLQISDRPMVRCVKCNSIKPSRAHHCSVCQRCVRKMDHHCPWINNCVGEDNQKYFIMFTFYIFLMSAFALYICVHFFI--LCVKDEWKDFF 234          
The following BLAST results are available for this feature:
BLAST of Palmitoyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZDHHC238.608e-924.44zinc finger DHHC-type containing 23 [Source:HGNC S... [more]
ZDHHC239.367e-825.33zinc finger DHHC-type containing 23 [Source:HGNC S... [more]
ZDHHC231.134e-725.33zinc finger DHHC-type containing 23 [Source:HGNC S... [more]
ZDHHC231.293e-725.33zinc finger DHHC-type containing 23 [Source:HGNC S... [more]
ZDHHC231.293e-725.33zinc finger DHHC-type containing 23 [Source:HGNC S... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dhhc-33.644e-628.33Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
dhhc-33.644e-628.33Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABPI4.920e-826.36gene:FBgn0031495 transcript:FBtr0344734[more]
GABPI4.920e-826.36gene:FBgn0031495 transcript:FBtr0344735[more]
GABPI7.071e-826.36gene:FBgn0031495 transcript:FBtr0077651[more]
GABPI7.071e-826.36gene:FBgn0031495 transcript:FBtr0077652[more]
Dnz11.053e-725.00gene:FBgn0027453 transcript:FBtr0080181[more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc23a3.142e-825.13zinc finger DHHC-type containing 23a [Source:ZFIN;... [more]
zdhhc16b7.335e-829.73zinc finger DHHC-type containing 16b [Source:NCBI ... [more]
zdhhc23a1.459e-726.59zinc finger DHHC-type containing 23a [Source:ZFIN;... [more]
zdhhc23b1.045e-630.00zinc finger DHHC-type containing 23b [Source:ZFIN;... [more]
zdhhc23b4.224e-629.44zinc finger DHHC-type containing 23b [Source:ZFIN;... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ZDHHC239.584e-728.16zinc finger, DHHC-type containing 23 [Source:NCBI ... [more]
acp61.531e-636.36acid phosphatase 6, lysophosphatidic [Source:Xenba... [more]
zdhhc71.581e-626.42zinc finger DHHC-type containing 7 [Source:NCBI ge... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zdhhc234.091e-1024.70zinc finger, DHHC domain containing 23 [Source:MGI... [more]
Zdhhc234.091e-1024.70zinc finger, DHHC domain containing 23 [Source:MGI... [more]
Zdhhc169.841e-835.38zinc finger, DHHC domain containing 16 [Source:MGI... [more]
Zdhhc252.541e-726.60zinc finger, DHHC domain containing 25 [Source:MGI... [more]
Zdhhc162.084e-635.38zinc finger, DHHC domain containing 16 [Source:MGI... [more]
back to top
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q76IC6|ZDH23_RAT3.715e-1025.14Palmitoyltransferase ZDHHC23 OS=Rattus norvegicus ... [more]
sp|Q5Y5T3|ZDH23_MOUSE2.861e-924.70Palmitoyltransferase ZDHHC23 OS=Mus musculus OX=10... [more]
sp|A0A0R4IF99|ZD16B_DANRE4.997e-735.71Palmitoyltransferase ZDHHC16B OS=Danio rerio OX=79... [more]
sp|Q8IYP9|ZDH23_HUMAN5.448e-725.33Palmitoyltransferase ZDHHC23 OS=Homo sapiens OX=96... [more]
sp|Q3EBC2|ZDHC5_ARATH1.562e-633.33Probable protein S-acyltransferase 17 OS=Arabidops... [more]
back to top
BLAST of Palmitoyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7A7922.462e-1936.31Palmitoyltransferase OS=Arion vulgaris OX=1028688 ... [more]
A0A0L8HL138.362e-1936.02Palmitoyltransferase OS=Octopus bimaculoides OX=37... [more]
V4BIG14.999e-1829.08Palmitoyltransferase OS=Lottia gigantea OX=225164 ... [more]
A0A433TF171.279e-1736.84Palmitoyltransferase OS=Elysia chlorotica OX=18847... [more]
T1FSF31.994e-1728.75Palmitoyltransferase OS=Helobdella robusta OX=6412... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc16a3.466e-730.91zinc finger DHHC-type containing 16 [Source:NCBI g... [more]
zdhhc16b1.363e-629.73probable palmitoyltransferase ZDHHC16 [Source:NCBI... [more]
zdhhc16b1.363e-629.73probable palmitoyltransferase ZDHHC16 [Source:NCBI... [more]
zdhhc23b2.374e-625.82zinc finger DHHC-type containing 23 [Source:NCBI g... [more]
zdhhc23b3.963e-625.68zinc finger DHHC-type containing 23 [Source:NCBI g... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zdhhc16a3.406e-733.78zinc finger DHHC-type containing 16a [Source:NCBI ... [more]
ENSPMAT00000003931.15.874e-727.27pep scaffold:Pmarinus_7.0:GL482317:448:5011:-1 gen... [more]
zdhhc3a3.106e-642.00zinc finger DHHC-type containing 3a [Source:ZFIN;A... [more]
zdhhc217.061e-629.73zinc finger DHHC-type containing 21 [Source:ZFIN;A... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SWF12.729e-736.71Palmitoyltransferase that acts on transmembrane pr... [more]
ERF27.299e-736.21Subunit of a palmitoyltransferase; this complex ad... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO463045.494e-931.51Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO363481.250e-825.88Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO463192.787e-630.86Palmitoyltransferase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc23a8.833e-825.87palmitoyltransferase ZDHHC23-like [Source:NCBI gen... [more]
zdhhc16a2.134e-727.42palmitoyltransferase ZDHHC16A-like [Source:NCBI ge... [more]
zdhhc16a2.201e-727.42palmitoyltransferase ZDHHC16A-like [Source:NCBI ge... [more]
zdhhc16b2.072e-629.00palmitoyltransferase ZDHHC16B [Source:NCBI gene;Ac... [more]
zdhhc23b2.236e-632.91zinc finger DHHC-type containing 23 [Source:NCBI g... [more]
back to top
BLAST of Palmitoyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024957.19.758e-11998.90SMESG000024957.1[more]
SMESG000028446.12.458e-732.94SMESG000028446.1[more]
SMESG000033660.11.634e-647.17SMESG000033660.1[more]
SMESG000062891.11.920e-624.11SMESG000062891.1[more]
SMESG000041123.12.260e-626.45SMESG000041123.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012350 ID=SMED30012350|Name=Palmitoyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1245bp
TAAATTGTATTAATTATTAATTATAAAAATCAATGATAAATTTTTCAAGT
AAAAGTTCAGGACATATTTTTGTTGAACAATCAAAAATTAAATGTAGAAA
GTTTATTTACATACTCTCAATATTCATTAAATTATTCTGCGTTTGCAGAA
ATATCAGTATTTTTTCCAATTTTTCTGTATTAATAATAATCGGTGAATTT
CTTTACAAATGCTGCAAAGTAAATTCGTATAACATCACTTCTGCAATCAT
AATAATAGCCAACTATTGGATCGGTACAATAAATGGATATTTTACTATTC
TAGCATTGATTTCGTCGACAATTATGATTTTTTCGTTAATAACGATGCAG
AATAATCGCCAAAGTCGTTATATTTCAGTATTAGGACAATGGTTCAAGAT
TTATTATTTTTTACAGTTGGCAATATTTTTAGTTCTTGTTAATGTTGTTC
ATAAGTTATTGCTATGGGAGGTAATGCTGGTTTTCACGGGTCATTTGTTT
TGTATGTGGCTGTATTTTGGTGTAGTTGATATTTCCAAAAAACCTAGTGC
AAATTGTTGCGATGACGATTCCAGCAATCGAGAGTATTGTATCAAATGCC
AGAGAAGTATTCCGCATCGAGGGCAGCACTGTTCTATTTGCAACCGCTGC
TCAACCATCGCTCAATACCACAACGCATGGATCAACACGTGCATCGACAA
GTGTAACAGGCGCATGTATTTTGTGCTCTGTCTAATGGCAGCTATTACAA
ATATTTACCAAATACATGTCTCCATCACCAGTGTTTGTACACCAAGGATG
TTCAGTGATTGGTTCCTTGTCATTGATGATTGTCGGTACATCTATTCTGA
TGTCATATACTCGTGGATATTTGTCAGTTGCGTGTTCAACATGATTTTTA
CGAGTTTGCTTCTGGTAACTCTGTTATATGAAATAGTATTAATAAGTCAA
AATATAACGCATTTTGAGTTTGAAAATTGTATCTCATTTCCTAATTGTAT
TAACAAGGGTTTCATTTACAACTGGCTGGAGTTCCTGGTTTGGAAATAGG
ATATTTGCACAATGCCTTCAACCGTTAGTCTGTTCACTATCCTTTTGAGG
GTTTATTGGATCGAGTCCAGATTATTTATTAATTTCTGTATGTCAATTTG
AGATATCAAGTGGTATTGTAATTTTTATTTCAACTTTTATTTCTGTTTAT
TGTAAGATTTATTTTGATTATATGTTATCATTTGTTAAAAAAGAA
back to top

protein sequence of SMED30012350-orf-1

>SMED30012350-orf-1 ID=SMED30012350-orf-1|Name=SMED30012350-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=339bp
MINFSSKSSGHIFVEQSKIKCRKFIYILSIFIKLFCVCRNISIFSNFSVL
IIIGEFLYKCCKVNSYNITSAIIIIANYWIGTINGYFTILALISSTIMIF
SLITMQNNRQSRYISVLGQWFKIYYFLQLAIFLVLVNVVHKLLLWEVMLV
FTGHLFCMWLYFGVVDISKKPSANCCDDDSSNREYCIKCQRSIPHRGQHC
SICNRCSTIAQYHNAWINTCIDKCNRRMYFVLCLMAAITNIYQIHVSITS
VCTPRMFSDWFLVIDDCRYIYSDVIYSWIFVSCVFNMIFTSLLLVTLLYE
IVLISQNITHFEFENCISFPNCINKGFIYNWLEFLVWK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016409palmitoyltransferase activity
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
GO:0019706protein-cysteine S-palmitoyltransferase activity
Vocabulary: INTERPRO
TermDefinition
IPR001594Palmitoyltrfase_DHHC
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001594Palmitoyltransferase, DHHC domainPFAMPF01529DHHCcoord: 181..314
e-value: 8.4E-14
score: 51.8
NoneNo IPR availablePANTHERPTHR22883:SF99PALMITOYLTRANSFERASE ZDHHC23coord: 180..313
NoneNo IPR availablePANTHERPTHR22883ZINC FINGER DHHC DOMAIN CONTAINING PROTEINcoord: 180..313
NoneNo IPR availablePROSITEPS50216DHHCcoord: 184..234
score: 15.996
NoneNo IPR availableTMHMMTMhelixcoord: 35..57
NoneNo IPR availableTMHMMTMhelixcoord: 116..138
NoneNo IPR availableTMHMMTMhelixcoord: 275..297
NoneNo IPR availableTMHMMTMhelixcoord: 229..251
NoneNo IPR availableTMHMMTMhelixcoord: 143..165
NoneNo IPR availableTMHMMTMhelixcoord: 72..103