SMED30012347

Overview
NameSMED30012347
Smed IDSMED30012347
Length (bp)526
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30012347 (SMED30012347) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30012347 (SMED30012347) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30012347 (SMED30012347) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30012347 (SMED30012347) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012347

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30012347h1SMcG0010381 dd_Smed_v4_13179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012347h1SMcG0010381 dd_Smed_v6_13179_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30012347h1SMcG0010381 dd_Smed_v4_13179_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30012347 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.009798:3206..3707 -2378
Homology
BLAST of SMED30012347 vs. Ensembl Human
Match: KISS1R (KISS1 receptor [Source:HGNC Symbol;Acc:HGNC:4510])

HSP 1 Score: 51.9878 bits (123), Expect = 5.471e-8
Identity = 37/87 (42.53%), Postives = 53/87 (60.92%), Query Frame = -3
Query:    3 LIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 260
            L+G+VGNS VI V  R+K    V   +   LA TD++FLL  VP T L Y L  WV G+F+C+FVN+I   S+ ++   L +++  R
Sbjct:   54 LLGLVGNSLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDR 140          
BLAST of SMED30012347 vs. Ensembl Human
Match: KISS1R (KISS1 receptor [Source:HGNC Symbol;Acc:HGNC:4510])

HSP 1 Score: 51.9878 bits (123), Expect = 1.123e-7
Identity = 37/87 (42.53%), Postives = 53/87 (60.92%), Query Frame = -3
Query:    3 LIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 260
            L+G+VGNS VI V  R+K    V   +   LA TD++FLL  VP T L Y L  WV G+F+C+FVN+I   S+ ++   L +++  R
Sbjct:   54 LLGLVGNSLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDR 140          
BLAST of SMED30012347 vs. Ensembl Human
Match: BRS3 (bombesin receptor subtype 3 [Source:HGNC Symbol;Acc:HGNC:1113])

HSP 1 Score: 50.8322 bits (120), Expect = 2.642e-7
Identity = 37/98 (37.76%), Postives = 55/98 (56.12%), Query Frame = -3
Query:    3 SIWITLWTMICLIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 293
            +I+IT + +I  +GI+GN+ +I VF++ K    V  IF   LA  DL  LL  VP+   HYL + W+FG   C+ ++FI   S+  S   L  L+  R
Sbjct:   49 AIYIT-YAVIISVGILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCKVLSFIRLTSVGVSVFTLTILSADR 145          
BLAST of SMED30012347 vs. Ensembl Human
Match: GALR2 (galanin receptor 2 [Source:HGNC Symbol;Acc:HGNC:4133])

HSP 1 Score: 47.7506 bits (112), Expect = 3.192e-6
Identity = 34/93 (36.56%), Postives = 55/93 (59.14%), Query Frame = -3
Query:    3 LWTMICLIGIVGNSFVIAVFYRNKQHV-VYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 278
            L+ +I L+G VGN+ V+AV  R  Q V    +F + L + DL F+L  VP     Y L  WVFG+ LC+ V+F+ + ++ +S+  L +++  R
Sbjct:   31 LFALIFLVGTVGNTLVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDR 123          
BLAST of SMED30012347 vs. Ensembl Fly
Match: SIFaR (gene:FBgn0038880 transcript:FBtr0084098)

HSP 1 Score: 50.0618 bits (118), Expect = 2.853e-7
Identity = 28/102 (27.45%), Postives = 59/102 (57.84%), Query Frame = -3
Query:    3 VSQTSIWITLWTMICLIGIVGNSFVIAVFYRN-KQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 305
            ++ + ++   + ++ L+G++GNSFVIAV  R  +   V   F + LA+ D+  ++  +P T++  +   W+ G  +C+FV +I   S+ +S   L++++  R
Sbjct:  205 LAMSMVYCVAYIVVFLVGLIGNSFVIAVVLRAPRMRTVTNYFIVNLAIADILVIVFCLPATLIGNIFVPWMLGWLMCKFVPYIQGVSVAASVYSLIAVSLDR 306          
BLAST of SMED30012347 vs. Ensembl Fly
Match: SIFaR (gene:FBgn0038880 transcript:FBtr0301815)

HSP 1 Score: 50.0618 bits (118), Expect = 2.853e-7
Identity = 28/102 (27.45%), Postives = 59/102 (57.84%), Query Frame = -3
Query:    3 VSQTSIWITLWTMICLIGIVGNSFVIAVFYRN-KQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 305
            ++ + ++   + ++ L+G++GNSFVIAV  R  +   V   F + LA+ D+  ++  +P T++  +   W+ G  +C+FV +I   S+ +S   L++++  R
Sbjct:  205 LAMSMVYCVAYIVVFLVGLIGNSFVIAVVLRAPRMRTVTNYFIVNLAIADILVIVFCLPATLIGNIFVPWMLGWLMCKFVPYIQGVSVAASVYSLIAVSLDR 306          
BLAST of SMED30012347 vs. Ensembl Fly
Match: CCKLR-17D3 (gene:FBgn0030954 transcript:FBtr0113003)

HSP 1 Score: 49.6766 bits (117), Expect = 3.617e-7
Identity = 29/98 (29.59%), Postives = 60/98 (61.22%), Query Frame = -3
Query:    3 IW-ITLWTMICLIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 290
            +W I  ++MI L  ++GN  VI+   +N++   +  +F + LA++D+   +L +P+T++  LL++++FG FLC+   F    S+  S+  L++++  R
Sbjct:  112 VWLIPSYSMILLFAVLGNLLVISTLVQNRRMRTITNVFLLNLAISDMLLGVLCMPVTLVGTLLRNFIFGEFLCKLFQFSQAASVAVSSWTLVAISCER 209          
BLAST of SMED30012347 vs. Ensembl Fly
Match: CCKLR-17D1 (gene:FBgn0259231 transcript:FBtr0299681)

HSP 1 Score: 47.7506 bits (112), Expect = 1.535e-6
Identity = 26/98 (26.53%), Postives = 56/98 (57.14%), Query Frame = -3
Query:    3 IWIT-LWTMICLIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 290
            IW+   ++ I L  +VGN  V+    +N++   +  +F + LA++D+   +  +P+T++  LL+ ++FG  LC+ + F    S+  S+  L++++  R
Sbjct:  176 IWVVPCYSAILLCAVVGNLLVVLTLVQNRRMRTITNVFLLNLAISDILLGVFCMPVTLVGTLLRHFIFGELLCKLIQFAQAASVAVSSWTLVAISCER 273          
BLAST of SMED30012347 vs. Ensembl Zebrafish
Match: kiss1rb (KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-54])

HSP 1 Score: 56.225 bits (134), Expect = 1.967e-9
Identity = 38/104 (36.54%), Postives = 62/104 (59.62%), Query Frame = -3
Query:    3 VSQTSIWIT--LWTMICLIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 305
            V  T  W+    +T+I  +G+VGN  VI V  +N+Q   V  ++ + LA TD+ FL+  VP T   Y+L SW+FG+F+CR VN++   +  ++ I L +++  R
Sbjct:   37 VPLTDTWLVPLFFTLIMFVGLVGNLIVIYVVIKNQQMKTVTNLYIVNLATTDILFLVCCVPFTATVYVLPSWIFGDFMCRLVNYLQQVTAQATCITLSAMSVDR 140          
BLAST of SMED30012347 vs. Ensembl Zebrafish
Match: kiss1rb (KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-54])

HSP 1 Score: 55.4546 bits (132), Expect = 2.543e-9
Identity = 38/94 (40.43%), Postives = 58/94 (61.70%), Query Frame = -3
Query:   33 VSQTSIWIT--LWTMICLIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSA 305
            V  T  W+    +T+I  +G+VGN  VI V  +N+Q   V  ++ + LA TD+ FL+  VP T   Y+L SW+FG+F+CR VN++   SL +S+
Sbjct:   37 VPLTDTWLVPLFFTLIMFVGLVGNLIVIYVVIKNQQMKTVTNLYIVNLATTDILFLVCCVPFTATVYVLPSWIFGDFMCRLVNYLQQISLQTSS 130          
BLAST of SMED30012347 vs. Ensembl Zebrafish
Match: kiss1ra (KISS1 receptor a [Source:ZFIN;Acc:ZDB-GENE-070912-521])

HSP 1 Score: 54.299 bits (129), Expect = 8.668e-9
Identity = 38/113 (33.63%), Postives = 65/113 (57.52%), Query Frame = -3
Query:    3 MIQNEYNKKKFVSQTSIWITLWTMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIG-XXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 338
            M  +E  +  F++   +    +++I L+G++GNS VI V  +++Q      F I  LA TD+ FLL  VP T   Y L  W+FG+F+C+FV F+   ++ ++ I L +++  R
Sbjct:   22 MEDSEDGEHPFLTDAWLVPLFFSLIMLVGLIGNSLVIYVISKHRQMRTATNFYIANLAATDIIFLLCCVPFTATLYPLPGWIFGDFMCKFVAFLQQVTVQATCITLTAMSGDR 134          
BLAST of SMED30012347 vs. Ensembl Zebrafish
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 51.2174 bits (121), Expect = 1.231e-7
Identity = 35/94 (37.23%), Postives = 56/94 (59.57%), Query Frame = -3
Query:    3 LWTMICLIGIVGNSFVIAVFYRNKQHVVYE--IFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 278
            +++MI L+G VGN  V+AV  RN Q       +F + L L DL F++  VP+    Y +  WVFG F+C+ V+FI Y ++++S   L +++  R
Sbjct:   24 IFSMIFLVGTVGNCLVLAVLIRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDEWVFGAFVCKAVHFIIYLTMYASIFTLAAVSLDR 117          
BLAST of SMED30012347 vs. Ensembl Zebrafish
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 51.2174 bits (121), Expect = 1.231e-7
Identity = 35/94 (37.23%), Postives = 56/94 (59.57%), Query Frame = -3
Query:    3 LWTMICLIGIVGNSFVIAVFYRNKQHVVYE--IFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 278
            +++MI L+G VGN  V+AV  RN Q       +F + L L DL F++  VP+    Y +  WVFG F+C+ V+FI Y ++++S   L +++  R
Sbjct:   24 IFSMIFLVGTVGNCLVLAVLIRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDEWVFGAFVCKAVHFIIYLTMYASIFTLAAVSLDR 117          
BLAST of SMED30012347 vs. Ensembl Xenopus
Match: gpc2 (glypican 2 [Source:Xenbase;Acc:XB-GENE-6258957])

HSP 1 Score: 55.4546 bits (132), Expect = 5.353e-9
Identity = 37/111 (33.33%), Postives = 63/111 (56.76%), Query Frame = -3
Query:    3 QNEYNKKKFVSQTSIWITLWTMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIG-XXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 332
            + E     F++   +    + +I L+G++GNS VI V  +++Q      F I  LA TD+ FL+  VP T   Y L SWVFG+F+C+FV ++   ++ ++ I L +++  R
Sbjct:   27 RTETGPPPFLTDAWLVPLFFALIMLVGLIGNSLVIYVISKHRQMRTATNFYIANLASTDIMFLVCCVPFTATLYPLPSWVFGDFMCKFVAYLQQVTVQATCITLTAMSADR 137          
BLAST of SMED30012347 vs. Ensembl Xenopus
Match: kiss1r (KISS1 receptor [Source:NCBI gene;Acc:100316929])

HSP 1 Score: 55.4546 bits (132), Expect = 6.454e-9
Identity = 35/91 (38.46%), Postives = 54/91 (59.34%), Query Frame = -3
Query:    3 TMICLIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 272
             M+ L+G+ GNS VI V  ++KQ   V   +   LA TD+ FL+  VP T   Y L  W+FG F+C+FVN+I   S+ ++ + L +++  R
Sbjct:   50 AMLMLVGLTGNSLVIYVISKHKQMRTVTNFYIANLAATDIIFLVSCVPFTAALYPLPGWIFGEFMCKFVNYIQQVSVQATCVTLTAMSVDR 140          
BLAST of SMED30012347 vs. Ensembl Xenopus
Match: sp3 (Sp3 transcription factor [Source:Xenbase;Acc:XB-GENE-977158])

HSP 1 Score: 54.299 bits (129), Expect = 1.501e-8
Identity = 37/103 (35.92%), Postives = 64/103 (62.14%), Query Frame = -3
Query:    3 SQTSIWIT-LWTMICLIGIVGNSFVIAVFYRNKQ--HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 302
            S  SI +  ++++I L+G VGNS V+AV  R+ Q  H    +F + L++ D+SF++  VP     Y L+ WVFG F+C+ V+F  Y ++++S+  L +++  R
Sbjct:   23 SPASIVVPVIFSLIFLLGTVGNSLVLAVLLRSGQRTHNTTNLFILNLSVADVSFIIFCVPFQATIYSLEDWVFGAFMCKAVHFFIYLTMYASSFTLAAVSVDR 125          
BLAST of SMED30012347 vs. Ensembl Xenopus
Match: fnbp4 (formin binding protein 4 [Source:Xenbase;Acc:XB-GENE-6088480])

HSP 1 Score: 54.299 bits (129), Expect = 1.526e-8
Identity = 36/92 (39.13%), Postives = 57/92 (61.96%), Query Frame = -3
Query:    3 WTMICLIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 275
            + +I L+G+VGNS VI V  +++Q   V   +   LA TD++FL+  VP T   Y L SWVFG+F+CR VN++   +  ++ I L +++  R
Sbjct:   52 FALIMLVGLVGNSLVIYVISKHRQMRTVTNFYIANLATTDITFLVCCVPFTATLYPLPSWVFGDFMCRCVNYLQQVTAQATCITLTAMSVDR 143          
BLAST of SMED30012347 vs. Ensembl Xenopus
Match: sp3 (Sp3 transcription factor [Source:Xenbase;Acc:XB-GENE-977158])

HSP 1 Score: 53.9138 bits (128), Expect = 2.107e-8
Identity = 36/111 (32.43%), Postives = 65/111 (58.56%), Query Frame = -3
Query:    3 NEYNKKKFVSQTSIWITLWTMICLIGIVGNSFVIAVFYRNKQ--HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 329
            N  +   F   + +   ++++I L+G VGNS V+AV  R+ Q  H    +F + L++ D+SF++  VP     Y L+ WVFG F+C+ V+F  Y ++++S+  L +++  R
Sbjct:   38 NSSDLSLFSPASIVVPVIFSLIFLLGTVGNSLVLAVLLRSGQRTHNTTNLFILNLSVADVSFIIFCVPFQATIYSLEDWVFGAFMCKAVHFFIYLTMYASSFTLAAVSVDR 148          
BLAST of SMED30012347 vs. Ensembl Mouse
Match: Kiss1r (KISS1 receptor [Source:MGI Symbol;Acc:MGI:2148793])

HSP 1 Score: 53.1434 bits (126), Expect = 2.530e-8
Identity = 37/87 (42.53%), Postives = 54/87 (62.07%), Query Frame = -3
Query:    3 LIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 260
            L+G+VGNS VI V  R+K    V   +   LA TD++FLL  VP T L Y L +WV G+F+C+FVN+I   S+ ++   L +++  R
Sbjct:   54 LLGLVGNSLVIYVICRHKHMQTVTNFYIANLAATDVTFLLCCVPFTALLYPLPAWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDR 140          
BLAST of SMED30012347 vs. Ensembl Mouse
Match: Kiss1r (KISS1 receptor [Source:MGI Symbol;Acc:MGI:2148793])

HSP 1 Score: 52.7582 bits (125), Expect = 3.891e-8
Identity = 37/87 (42.53%), Postives = 54/87 (62.07%), Query Frame = -3
Query:    3 LIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 260
            L+G+VGNS VI V  R+K    V   +   LA TD++FLL  VP T L Y L +WV G+F+C+FVN+I   S+ ++   L +++  R
Sbjct:   54 LLGLVGNSLVIYVICRHKHMQTVTNFYIANLAATDVTFLLCCVPFTALLYPLPAWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDR 140          
BLAST of SMED30012347 vs. Ensembl Mouse
Match: Brs3 (bombesin-like receptor 3 [Source:MGI Symbol;Acc:MGI:1100501])

HSP 1 Score: 50.0618 bits (118), Expect = 3.206e-7
Identity = 37/98 (37.76%), Postives = 54/98 (55.10%), Query Frame = -3
Query:    3 SIWITLWTMICLIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 293
            +I+IT +  I  +GI+GN+ +I VF++ K    V  IF   LA  DL  LL  VP+   HYL + W+FG   C+ ++FI   S+  S   L  L+  R
Sbjct:   49 AIYIT-YAGIISVGILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGKVGCKVLSFIRLTSVGVSVFTLTILSADR 145          
BLAST of SMED30012347 vs. Ensembl Mouse
Match: Oprm1 (opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:97441])

HSP 1 Score: 48.521 bits (114), Expect = 1.170e-6
Identity = 28/95 (29.47%), Postives = 51/95 (53.68%), Query Frame = -3
Query:    3 ITLWTMICLIGIVGNSFVIAVFYR-NKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 284
            + L++++C++G+ GN  V+ V  R  K      I+ I       +    T+P   ++YL+ +W FGN LC+ V  I Y ++F+S   L +++  R
Sbjct:    8 MALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIY-IFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDR 101          
BLAST of SMED30012347 vs. Ensembl Mouse
Match: Oprm1 (opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:97441])

HSP 1 Score: 48.1358 bits (113), Expect = 1.209e-6
Identity = 28/95 (29.47%), Postives = 51/95 (53.68%), Query Frame = -3
Query:    3 ITLWTMICLIGIVGNSFVIAVFYR-NKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 284
            + L++++C++G+ GN  V+ V  R  K      I+ I       +    T+P   ++YL+ +W FGN LC+ V  I Y ++F+S   L +++  R
Sbjct:    8 MALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIY-IFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDR 101          
BLAST of SMED30012347 vs. UniProt/SwissProt
Match: sp|Q6BD04|GPR54_ORENI (G-protein coupled receptor 54 OS=Oreochromis niloticus OX=8128 GN=gpr54 PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 3.925e-8
Identity = 38/107 (35.51%), Postives = 62/107 (57.94%), Query Frame = -3
Query:    3 NKKKFVSQTSIWITLWTMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIG-XXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 320
            +K  F +   +    +++I L+G+VGNS VI V  +++Q      F I  LA TD+ FL+  VP T   Y L  W+FGNF+C+FV F+   ++ ++ I L +++  R
Sbjct:   37 DKHPFFTDAWLVPLFFSLIMLVGLVGNSLVIYVISKHRQMRTATNFYIANLAATDIIFLVCCVPFTATLYPLPGWIFGNFMCKFVAFLQQVTVQATCITLTAMSGDR 143          
BLAST of SMED30012347 vs. UniProt/SwissProt
Match: sp|Q91V45|KISSR_MOUSE (KiSS-1 receptor OS=Mus musculus OX=10090 GN=Kiss1r PE=1 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.770e-7
Identity = 37/87 (42.53%), Postives = 54/87 (62.07%), Query Frame = -3
Query:    3 LIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 260
            L+G+VGNS VI V  R+K    V   +   LA TD++FLL  VP T L Y L +WV G+F+C+FVN+I   S+ ++   L +++  R
Sbjct:   54 LLGLVGNSLVIYVICRHKHMQTVTNFYIANLAATDVTFLLCCVPFTALLYPLPAWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDR 140          
BLAST of SMED30012347 vs. UniProt/SwissProt
Match: sp|Q924U1|KISSR_RAT (KiSS-1 receptor OS=Rattus norvegicus OX=10116 GN=Kiss1r PE=2 SV=2)

HSP 1 Score: 52.373 bits (124), Expect = 3.131e-7
Identity = 37/87 (42.53%), Postives = 54/87 (62.07%), Query Frame = -3
Query:    3 LIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 260
            L+G+VGNS VI V  R+K    V   +   LA TD++FLL  VP T L Y L +WV G+F+C+FVN+I   S+ ++   L +++  R
Sbjct:   54 LLGLVGNSLVIFVICRHKHMQTVTNFYIANLAATDVTFLLCCVPFTALLYPLPTWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDR 140          
BLAST of SMED30012347 vs. UniProt/SwissProt
Match: sp|O97967|BRS3_SHEEP (Bombesin receptor subtype-3 OS=Ovis aries OX=9940 GN=BRS3 PE=2 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 3.140e-7
Identity = 37/98 (37.76%), Postives = 56/98 (57.14%), Query Frame = -3
Query:    3 SIWITLWTMICLIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 293
            +I+IT + +I  +GI+GN+ +I VF++ K    V  IF   LA  DL  LL  VP+ + HYL + W+FG   C+ ++FI   S+  S   L  L+  R
Sbjct:   49 AIYIT-YAVIISVGILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDVTHYLAEGWLFGRIGCKVLSFIRLTSVGVSVFTLTILSADR 145          
BLAST of SMED30012347 vs. UniProt/SwissProt
Match: sp|Q969F8|KISSR_HUMAN (KiSS-1 receptor OS=Homo sapiens OX=9606 GN=KISS1R PE=1 SV=2)

HSP 1 Score: 51.9878 bits (123), Expect = 5.393e-7
Identity = 37/87 (42.53%), Postives = 53/87 (60.92%), Query Frame = -3
Query:    3 LIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 260
            L+G+VGNS VI V  R+K    V   +   LA TD++FLL  VP T L Y L  WV G+F+C+FVN+I   S+ ++   L +++  R
Sbjct:   54 LLGLVGNSLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDR 140          
BLAST of SMED30012347 vs. TrEMBL
Match: A0A193KUA9 (GCR080 OS=Schmidtea mediterranea OX=79327 GN=gcr080 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.898e-17
Identity = 56/157 (35.67%), Postives = 94/157 (59.87%), Query Frame = -3
Query:    3 KNMNLFRSGKVNQTTFEYLYQIIIHYLVKDNSEYSLELIK-MIQNEYNKK----KFVSQTSIWITLWTMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 458
            +N  +  +   N +     Y  ++ +L  D+     E +K ++ ++Y  K    K  +Q    + +W +IC+ G+V N  VI   +RN   ++YEIFCIGLA TD+ FLLL VP+T +HYLL +W+ G+F+C+ +N++    +FSS+++L+ LT SR
Sbjct:   10 RNFQIIFNPDSNISILTRAYNELMKHLNDDSIRNESEKLKALLHSKYESKVGAFKLSNQVYYLVAIWILICVTGVVSNLVVIITLWRNPCKLIYEIFCIGLAFTDIGFLLLAVPLTSVHYLLLNWILGSFMCKLINYLIQSVVFSSSLILVGLTFSR 166          
BLAST of SMED30012347 vs. TrEMBL
Match: A0A4Z2CYY8 (Allatostatin-A receptor OS=Schistosoma japonicum OX=6182 GN=EWB00_006475 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.154e-16
Identity = 55/124 (44.35%), Postives = 78/124 (62.90%), Query Frame = -3
Query:    3 NSEYSLELIKMIQNEYNKKKFVSQTSIWITLWTMICLI--GIVGNSFVIAVFYRNKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 368
            N+  S+EL  +I+ +        + S+ I    + C++  GI+GN  VI V   N+  +VYE FC+GLA+TDL +L +T PIT++ Y L SW+FG F C+  NFI   ++FSSA MLL LTTSR
Sbjct:   30 NNNISMELHSIIRPDI-------EISVIIMACVVCCIVTVGIIGNVLVICVLTCNQTRMVYETFCVGLAVTDLIYLTMTSPITVMQYFLNSWIFGIFWCKVFNFIVQVTVFSSAFMLLGLTTSR 146          
BLAST of SMED30012347 vs. TrEMBL
Match: A0A504Y8V1 (Protein trapped in endoderm-1 OS=Fasciola gigantica OX=46835 GN=FGIG_04549 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.091e-14
Identity = 50/116 (43.10%), Postives = 71/116 (61.21%), Query Frame = -3
Query:    3 QNEYNKKKFVSQTSIWITLWTMIC------LIGIVGNSFVIAVFYRNKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 332
            QN     K +SQ+   I++    C      +IG++GN  VI V   +   +VYE FC+GLA+TDL++L  T PIT++ Y  + W+FG F C+  NF+   ++FSSA MLL LTTSR
Sbjct:   48 QNSNMTSKSLSQSKPRISVLVTSCVCIAIAIIGVLGNMLVICVLTGSHTRLVYETFCVGLAVTDLTYLTFTTPITVVQYFFRGWIFGLFWCKVFNFVVQVTVFSSAFMLLGLTTSR 163          
BLAST of SMED30012347 vs. TrEMBL
Match: A0A4E0RIC8 (Protein trapped in endoderm-1 OS=Fasciola hepatica OX=6192 GN=D915_001998 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.725e-14
Identity = 44/88 (50.00%), Postives = 61/88 (69.32%), Query Frame = -3
Query:    3 ICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 266
            I +IG++GN  VI V   +   +VYE FC+GLA+TDL++L  T PIT++ Y  + W+FG F C+  NF+   ++FSSA MLL LTTSR
Sbjct:   76 IAIIGVLGNMLVICVLTGSHTRLVYETFCVGLAVTDLTYLTFTTPITVVQYFFRGWIFGLFWCKVFNFVVQVTVFSSAFMLLGLTTSR 163          
BLAST of SMED30012347 vs. TrEMBL
Match: A0A183A994 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3529 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 5.345e-14
Identity = 47/102 (46.08%), Postives = 68/102 (66.67%), Query Frame = -3
Query:    3 SQTSIWIT--LWTMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 302
             +TS+ +T  +   I ++G++GN  VI V   +   +VYE FC+GLA+TDL++L  T PITI+ Y  + W+FG F C+  NF+   ++FSSA MLL LTTSR
Sbjct:   65 PRTSVLVTSCVCIAIAIVGVLGNLLVICVLIGSHTRLVYETFCVGLAVTDLTYLTFTTPITIVQYYFRGWIFGLFWCKVFNFVVQVTVFSSAFMLLGLTTSR 166          
BLAST of SMED30012347 vs. Ensembl Cavefish
Match: kiss1rb (G-protein coupled receptor 54-like [Source:NCBI gene;Acc:103024304])

HSP 1 Score: 52.7582 bits (125), Expect = 2.781e-8
Identity = 35/90 (38.89%), Postives = 58/90 (64.44%), Query Frame = -3
Query:    3 MICLIGIVGNSFVIAVFYRNKQHVVYEIFCIG-XXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 269
            +I ++G+ GNS V+ V Y++K+      F I  LA+TD++FL+  VP T + Y L SW+FGNF+C+FV++I   S  ++ + L  ++  R
Sbjct:   37 LIMVMGLAGNSLVLCVIYKHKKMWTATNFYIANLAMTDITFLVCCVPFTAVLYPLPSWIFGNFMCKFVSYIQQMSAQATCMTLTVMSVDR 126          
BLAST of SMED30012347 vs. Ensembl Cavefish
Match: ENSAMXT00000053361.1 (G-protein coupled receptor 54 [Source:NCBI gene;Acc:103023540])

HSP 1 Score: 52.373 bits (124), Expect = 4.216e-8
Identity = 36/101 (35.64%), Postives = 60/101 (59.41%), Query Frame = -3
Query:    3 TSIWIT--LWTMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIG-XXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 296
            T  W+    +++I L+G++GNS VI V  +++Q      F I  LA TD+ FL+  VP T   Y L  W+FG+F+C+FV F+   ++ ++ I L +++  R
Sbjct:   37 TDAWLVPLFFSLIMLVGLIGNSLVIYVISKHRQMRTATNFYIANLAATDIIFLVCCVPFTATLYPLPGWIFGDFMCKFVAFLQQVTVQATCITLTAMSGDR 137          
BLAST of SMED30012347 vs. Ensembl Cavefish
Match: ENSAMXT00000033000.1 (G-protein coupled receptor 54 [Source:NCBI gene;Acc:103023540])

HSP 1 Score: 52.373 bits (124), Expect = 4.375e-8
Identity = 36/101 (35.64%), Postives = 60/101 (59.41%), Query Frame = -3
Query:    3 TSIWIT--LWTMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIG-XXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 296
            T  W+    +++I L+G++GNS VI V  +++Q      F I  LA TD+ FL+  VP T   Y L  W+FG+F+C+FV F+   ++ ++ I L +++  R
Sbjct:   36 TDAWLVPLFFSLIMLVGLIGNSLVIYVISKHRQMRTATNFYIANLAATDIIFLVCCVPFTATLYPLPGWIFGDFMCKFVAFLQQVTVQATCITLTAMSGDR 136          
BLAST of SMED30012347 vs. Ensembl Cavefish
Match: ENSAMXT00000034462.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:14671751:14677875:1 gene:ENSAMXG00000041227.1 transcript:ENSAMXT00000034462.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 1.499e-7
Identity = 30/91 (32.97%), Postives = 54/91 (59.34%), Query Frame = -3
Query:   36 SQTSIWITL-WTMICLIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSS 302
            S+ SIW +L +++IC++G+ GN+ VI V  R  +   V  +F I          +L +P +I+ ++L+ W FG+ +C+ V  I + ++FSS
Sbjct:   41 SEVSIWPSLVYSLICVVGLAGNTAVICVIARTPRMRSVTNVF-ILNLAIADDLFVLVLPASIVEHVLRRWPFGDLVCKAVLSIDHYNIFSS 130          
BLAST of SMED30012347 vs. Ensembl Cavefish
Match: galr2b (galanin receptor type 2-like [Source:NCBI gene;Acc:103040671])

HSP 1 Score: 47.7506 bits (112), Expect = 1.360e-6
Identity = 31/94 (32.98%), Postives = 58/94 (61.70%), Query Frame = -3
Query:    3 LWTMICLIGIVGNSFVIAVFYRNKQ--HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 278
            ++++I L+G VGNS V+AV  R+ Q  +    +F + L++ D  F++  VP     Y L+ WVFG+F+C+ V+F    ++++S+  L +++  R
Sbjct:   32 VFSLIFLLGTVGNSLVLAVLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDR 125          
BLAST of SMED30012347 vs. Ensembl Sea Lamprey
Match: kiss1rb (KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-54])

HSP 1 Score: 61.6178 bits (148), Expect = 4.581e-12
Identity = 40/101 (39.60%), Postives = 63/101 (62.38%), Query Frame = -3
Query:    3 TSIWIT--LWTMICLIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 296
            T  W+   L+ +I L+G+VGNS VI V  +N+Q   V   F + LA TD+ FL+  VP T   Y L SWVFG+F+C+FVN++   ++ ++ + L +++  R
Sbjct:   34 TDAWLVPLLFALIMLVGLVGNSLVIFVITKNRQMRTVTNFFIVNLAGTDIIFLVCCVPFTATLYPLPSWVFGDFMCKFVNYLQQVTVQATCMTLTAMSVDR 134          
BLAST of SMED30012347 vs. Ensembl Sea Lamprey
Match: galr1a (galanin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-290])

HSP 1 Score: 53.1434 bits (126), Expect = 4.449e-9
Identity = 36/92 (39.13%), Postives = 53/92 (57.61%), Query Frame = -3
Query:    3 MICLIGIVGNSFVIAVFYR---NKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 269
            +I L+GIVGNS VI V  R    K H +  +F + L++ DL+FL   VP    +Y L  WVFG FLC+ V ++   S+  S   L++++  R
Sbjct:   48 VIFLLGIVGNSLVILVLVRIKFGKSHSITNVFVLTLSVADLTFLFFCVPSEATYYFLPDWVFGAFLCKGVPYVFTASMLVSIFTLVAMSVDR 139          
BLAST of SMED30012347 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010013.1 (pep scaffold:Pmarinus_7.0:GL489109:1257:2844:-1 gene:ENSPMAG00000009062.1 transcript:ENSPMAT00000010013.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 1.533e-7
Identity = 33/82 (40.24%), Postives = 49/82 (59.76%), Query Frame = -3
Query:   60 TSIWIT--LWTMICLIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFI 296
            T  W+   ++ +I  +G+ GN  V+ V  RN++   V   +   LA TD+ FL+  VP T   Y L SWVFG+F+C+FVNF+
Sbjct:   22 TDAWLVPLVFALIMALGLTGNLLVVIVVGRNRRMRTVTNFYIANLACTDVIFLVSCVPFTATLYSLPSWVFGDFMCKFVNFL 103          
BLAST of SMED30012347 vs. Ensembl Sea Lamprey
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 46.595 bits (109), Expect = 8.153e-7
Identity = 34/93 (36.56%), Postives = 53/93 (56.99%), Query Frame = -3
Query:    3 MICLIGIVGNSFVIAVFY----RNKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 269
            +I L+G  GNS VI V      R   +    IF + L++ DL F+L  VP     Y L  W+FG+FLC+ V+FI + ++F+S+  L +++  R
Sbjct:   34 LIFLLGAFGNSLVIIVLLCSGQRGSSNTTTNIFILNLSVADLCFILFCVPFQATIYTLDGWIFGSFLCKAVHFIIFLTMFASSFTLAAVSVDR 126          
BLAST of SMED30012347 vs. Ensembl Sea Lamprey
Match: NPBWR1 (neuropeptides B and W receptor 1 [Source:HGNC Symbol;Acc:HGNC:4522])

HSP 1 Score: 45.0542 bits (105), Expect = 2.367e-6
Identity = 37/114 (32.46%), Postives = 61/114 (53.51%), Query Frame = -3
Query:    3 QNEYNKKKFVSQTSIWITL---WTMICLIGIVGNSFVIAVFYR-NKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 332
             N  N+ +    +  +ITL   +++IC IG+ GN+ VI V  R  K   V  +F + LA+ D  F L  +PI I ++LL+ W FG  +C+ +  I   ++F+S   L  ++  R
Sbjct:   24 ANGTNRTQVDYSSDFYITLPIIYSVICAIGLTGNTAVIYVILRAPKMKTVTNMFILNLAIADELFTL-VLPINIANHLLQDWPFGKTMCKVILSIDQYNMFTSIYFLTVMSADR 136          
BLAST of SMED30012347 vs. Ensembl Medaka
Match: ENSORLT00000043055.1 (G-protein coupled receptor 54 [Source:NCBI gene;Acc:101162001])

HSP 1 Score: 54.6842 bits (130), Expect = 5.767e-9
Identity = 32/111 (28.83%), Postives = 58/111 (52.25%), Query Frame = -3
Query:    3 QNEYNKKKFVSQTSIWITLWTMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGXXXXXXXX-XXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 332
            + E ++  F++   +    +++I L+G+VGNS VI V  +++Q      F I          L+  VP T   Y L  W+FG F+C+FV F+   ++ ++ I L +++  R
Sbjct:   35 EEEGDQHPFLTDAWLVPLFFSLIMLVGLVGNSLVIYVISKHRQMRTATNFYIANLAATDIIFLVCCVPFTATLYPLPGWIFGTFMCKFVAFLQQVTVQATCITLTAMSGDR 145          
BLAST of SMED30012347 vs. Ensembl Medaka
Match: ENSORLT00000002103.2 (G-protein coupled receptor 54-like [Source:NCBI gene;Acc:101172085])

HSP 1 Score: 54.299 bits (129), Expect = 8.824e-9
Identity = 36/94 (38.30%), Postives = 57/94 (60.64%), Query Frame = -3
Query:    3 TLWTMICLIGIVGNSFVIAVFYRNKQ-HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 281
            T + +I L+G+VGNS VI V  +++Q   V   + + LA TD+ FL+  VP T   Y L SW+FG F+CR VN++   +  ++ I L +++  R
Sbjct:   37 TFFCLIMLVGLVGNSLVIHVITKHQQMKTVTNFYIVNLATTDILFLVCCVPFTATLYPLPSWIFGEFMCRLVNYLQQVTAQATCITLSAMSVDR 130          
BLAST of SMED30012347 vs. Ensembl Medaka
Match: oprm1 (delta-type opioid receptor [Source:NCBI gene;Acc:101161184])

HSP 1 Score: 50.447 bits (119), Expect = 1.541e-7
Identity = 28/94 (29.79%), Postives = 52/94 (55.32%), Query Frame = -3
Query:    3 TLWTMICLIGIVGNSFVIAVFYR-NKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 281
             L++++C++G+VGN  V+ +  R  K      I+ I       + +  T+P   ++YL+ SW FG+ LC+ V  I Y ++F+S   L +++  R
Sbjct:   50 ALYSIVCMVGLVGNLLVMYIIVRYTKMKTATNIY-IFNLALADALVTSTLPFQSVNYLMGSWPFGDLLCKMVMSIDYYNMFTSIFTLTTMSIDR 142          
BLAST of SMED30012347 vs. Ensembl Medaka
Match: galr2a (galanin receptor type 2 [Source:NCBI gene;Acc:101155603])

HSP 1 Score: 48.1358 bits (113), Expect = 1.174e-6
Identity = 32/104 (30.77%), Postives = 65/104 (62.50%), Query Frame = -3
Query:    3 VSQTSIWITL-WTMICLIGIVGNSFVIAVFYRNKQ--HVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 305
            ++ TS+ +++ +++I L+G +GNS V+AV  R+ Q  +    +F + L++ D  F++  VP     Y L+ WVFG+F+C+ V+F    ++++S+  L +++  R
Sbjct:   22 INPTSVIVSVVFSLIFLLGTIGNSLVLAVLLRSGQVGYNTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDR 125          
BLAST of SMED30012347 vs. Ensembl Medaka
Match: npy4r (neuropeptide Y receptor type 1-like [Source:NCBI gene;Acc:101168234])

HSP 1 Score: 47.3654 bits (111), Expect = 2.153e-6
Identity = 31/99 (31.31%), Postives = 56/99 (56.57%), Query Frame = -3
Query:    3 TSIWITLWTMICLIGIVGNSFVIAVFYRNKQHV-VYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 296
            T+  ++L++   ++G+VGN  +I +    ++ V V  IF   L+ +D+   +  +P TI++ L+  WVFG+ LCR V FI   S+  S + L+ +   R
Sbjct:   57 TACLVSLYSATMVLGLVGNIGLICIIAHRREKVNVTSIFICNLSFSDILVCVFCLPFTIIYTLMDHWVFGSLLCRLVPFIQCVSVTVSVLSLVFIALER 155          
BLAST of SMED30012347 vs. Planmine SMEST
Match: SMESG000003338.1 (SMESG000003338.1)

HSP 1 Score: 312.383 bits (799), Expect = 6.000e-107
Identity = 165/166 (99.40%), Postives = 166/166 (100.00%), Query Frame = -3
Query:    3 MNLGNYSFEQIEFFKNMNLFRSGKVNQTTFEYLYQIIIHYLVKDNSEYSLELIKMIQNEYNKKKFVSQTSIWITLWTMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 500
            MNLGNYSFEQIEFFKNMNLFRSGKVNQTTFEYLYQIIIHYLVKDNSEYSLELIKMIQNEYNKKKFVSQTSIWITLW+MICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGLALTDLSFLLLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR
Sbjct:    1 MNLGNYSFEQIEFFKNMNLFRSGKVNQTTFEYLYQIIIHYLVKDNSEYSLELIKMIQNEYNKKKFVSQTSIWITLWSMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGLALTDLSFLLLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 166          
BLAST of SMED30012347 vs. Planmine SMEST
Match: SMESG000003338.1 (SMESG000003338.1)

HSP 1 Score: 278.87 bits (712), Expect = 1.799e-97
Identity = 149/151 (98.68%), Postives = 150/151 (99.34%), Query Frame = -3
Query:   48 MNLGNYSFEQIEFFKNMNLFRSGKVNQTTFEYLYQIIIHYLVKDNSEYSLELIKMIQNEYNKKKFVSQTSIWITLWTMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGS 500
            MNLGNYSFEQIEFFKNMNLFRSGKVNQTTFEYLYQIIIHYLVKDNSEYSLELIKMIQNEYNKKKFVSQTSIWITLW+MICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGLALTDLSFLLLTVPITILHYLLKSWVFGNFLCRFVNFISY S
Sbjct:    1 MNLGNYSFEQIEFFKNMNLFRSGKVNQTTFEYLYQIIIHYLVKDNSEYSLELIKMIQNEYNKKKFVSQTSIWITLWSMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGLALTDLSFLLLTVPITILHYLLKSWVFGNFLCRFVNFISYVS 151          
BLAST of SMED30012347 vs. Planmine SMEST
Match: SMESG000003338.1 (SMESG000003338.1)

HSP 1 Score: 279.641 bits (714), Expect = 2.827e-94
Identity = 149/150 (99.33%), Postives = 150/150 (100.00%), Query Frame = -3
Query:    3 MNLFRSGKVNQTTFEYLYQIIIHYLVKDNSEYSLELIKMIQNEYNKKKFVSQTSIWITLWTMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 452
            MNLFRSGKVNQTTFEYLYQIIIHYLVKDNSEYSLELIKMIQNEYNKKKFVSQTSIWITLW+MICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGLALTDLSFLLLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR
Sbjct:    1 MNLFRSGKVNQTTFEYLYQIIIHYLVKDNSEYSLELIKMIQNEYNKKKFVSQTSIWITLWSMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGLALTDLSFLLLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 150          
BLAST of SMED30012347 vs. Planmine SMEST
Match: SMESG000036226.1 (SMESG000036226.1)

HSP 1 Score: 122.865 bits (307), Expect = 2.683e-33
Identity = 75/177 (42.37%), Postives = 115/177 (64.97%), Query Frame = -3
Query:    3 NITNAINMNLGNYSFEQIEFFKNMNLFRSGKVNQTTFEYLYQIIIHYLVKDNSEYSLELIKMIQNEYNKK----KFVSQTSIWITLWTMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 521
            N T+ ++ N+     +QI F +N NL        TT++Y+Y+ ++  +  DN+  ++E + MI N Y  +     F ++    I++W +ICLIG+V N +VI V  + +Q +VYEIFCIGLA+TDLS L+  VPIT LHY +K W+FG+F+C+ VNF+ Y ++FSS +MLL LT +R
Sbjct:   11 NFTSDLHSNINR--LQQIFFDRNTNL--------TTYKYVYKQLLEAIPVDNT--TVEFLDMISNLYKSRMGEESFYNEVKYLISVWVLICLIGVVSNIYVITVLSKVRQKIVYEIFCIGLAVTDLSILVFAVPITTLHYGMKIWIFGDFICKMVNFLVYMAVFSSTMMLLILTITR 175          
BLAST of SMED30012347 vs. Planmine SMEST
Match: SMESG000065496.1 (SMESG000065496.1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.183e-21
Identity = 56/157 (35.67%), Postives = 94/157 (59.87%), Query Frame = -3
Query:    3 KNMNLFRSGKVNQTTFEYLYQIIIHYLVKDNSEYSLELIK-MIQNEYNKK----KFVSQTSIWITLWTMICLIGIVGNSFVIAVFYRNKQHVVYEIFCIGXXXXXXXXXXLTVPITILHYLLKSWVFGNFLCRFVNFISYGSLFSSAIMLLSLTTSR 458
            +N  +  +   N +     Y  ++ +L  D+     E +K ++ ++Y  K    K  +Q    + +W +IC+ G+V N  VI   +RN   ++YEIFCIGLA TD+ FLLL VP+T +HYLL +W+ G+F+C+ +N++    +FSS+++L+ LT SR
Sbjct:    4 RNFQIIFNPDSNISILTRAYNELMKHLNDDSIRNESEKLKALLHSKYESKVGAFKLSNQVYYLVAIWILICVTGVVSNLVVIITLWRNPCKLIYEIFCIGLAFTDIGFLLLAVPLTSVHYLLLNWILGSFMCKLINYLIQSVVFSSSLILVGLTFSR 160          
The following BLAST results are available for this feature:
BLAST of SMED30012347 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
KISS1R5.471e-842.53KISS1 receptor [Source:HGNC Symbol;Acc:HGNC:4510][more]
KISS1R1.123e-742.53KISS1 receptor [Source:HGNC Symbol;Acc:HGNC:4510][more]
BRS32.642e-737.76bombesin receptor subtype 3 [Source:HGNC Symbol;Ac... [more]
GALR23.192e-636.56galanin receptor 2 [Source:HGNC Symbol;Acc:HGNC:41... [more]
back to top
BLAST of SMED30012347 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012347 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SIFaR2.853e-727.45gene:FBgn0038880 transcript:FBtr0084098[more]
SIFaR2.853e-727.45gene:FBgn0038880 transcript:FBtr0301815[more]
CCKLR-17D33.617e-729.59gene:FBgn0030954 transcript:FBtr0113003[more]
CCKLR-17D11.535e-626.53gene:FBgn0259231 transcript:FBtr0299681[more]
back to top
BLAST of SMED30012347 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kiss1rb1.967e-936.54KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-... [more]
kiss1rb2.543e-940.43KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-... [more]
kiss1ra8.668e-933.63KISS1 receptor a [Source:ZFIN;Acc:ZDB-GENE-070912-... [more]
galr2a1.231e-737.23galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
galr2a1.231e-737.23galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
back to top
BLAST of SMED30012347 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpc25.353e-933.33glypican 2 [Source:Xenbase;Acc:XB-GENE-6258957][more]
kiss1r6.454e-938.46KISS1 receptor [Source:NCBI gene;Acc:100316929][more]
sp31.501e-835.92Sp3 transcription factor [Source:Xenbase;Acc:XB-GE... [more]
fnbp41.526e-839.13formin binding protein 4 [Source:Xenbase;Acc:XB-GE... [more]
sp32.107e-832.43Sp3 transcription factor [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of SMED30012347 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kiss1r2.530e-842.53KISS1 receptor [Source:MGI Symbol;Acc:MGI:2148793][more]
Kiss1r3.891e-842.53KISS1 receptor [Source:MGI Symbol;Acc:MGI:2148793][more]
Brs33.206e-737.76bombesin-like receptor 3 [Source:MGI Symbol;Acc:MG... [more]
Oprm11.170e-629.47opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:9... [more]
Oprm11.209e-629.47opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of SMED30012347 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6BD04|GPR54_ORENI3.925e-835.51G-protein coupled receptor 54 OS=Oreochromis nilot... [more]
sp|Q91V45|KISSR_MOUSE1.770e-742.53KiSS-1 receptor OS=Mus musculus OX=10090 GN=Kiss1r... [more]
sp|Q924U1|KISSR_RAT3.131e-742.53KiSS-1 receptor OS=Rattus norvegicus OX=10116 GN=K... [more]
sp|O97967|BRS3_SHEEP3.140e-737.76Bombesin receptor subtype-3 OS=Ovis aries OX=9940 ... [more]
sp|Q969F8|KISSR_HUMAN5.393e-742.53KiSS-1 receptor OS=Homo sapiens OX=9606 GN=KISS1R ... [more]
back to top
BLAST of SMED30012347 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUA91.898e-1735.67GCR080 OS=Schmidtea mediterranea OX=79327 GN=gcr08... [more]
A0A4Z2CYY84.154e-1644.35Allatostatin-A receptor OS=Schistosoma japonicum O... [more]
A0A504Y8V11.091e-1443.10Protein trapped in endoderm-1 OS=Fasciola gigantic... [more]
A0A4E0RIC83.725e-1450.00Protein trapped in endoderm-1 OS=Fasciola hepatica... [more]
A0A183A9945.345e-1446.08G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of SMED30012347 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kiss1rb2.781e-838.89G-protein coupled receptor 54-like [Source:NCBI ge... [more]
ENSAMXT00000053361.14.216e-835.64G-protein coupled receptor 54 [Source:NCBI gene;Ac... [more]
ENSAMXT00000033000.14.375e-835.64G-protein coupled receptor 54 [Source:NCBI gene;Ac... [more]
ENSAMXT00000034462.11.499e-732.97pep primary_assembly:Astyanax_mexicanus-2.0:15:146... [more]
galr2b1.360e-632.98galanin receptor type 2-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of SMED30012347 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kiss1rb4.581e-1239.60KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-... [more]
galr1a4.449e-939.13galanin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
ENSPMAT00000010013.11.533e-740.24pep scaffold:Pmarinus_7.0:GL489109:1257:2844:-1 ge... [more]
galr2a8.153e-736.56galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
NPBWR12.367e-632.46neuropeptides B and W receptor 1 [Source:HGNC Symb... [more]
back to top
BLAST of SMED30012347 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012347 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012347 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000043055.15.767e-928.83G-protein coupled receptor 54 [Source:NCBI gene;Ac... [more]
ENSORLT00000002103.28.824e-938.30G-protein coupled receptor 54-like [Source:NCBI ge... [more]
oprm11.541e-729.79delta-type opioid receptor [Source:NCBI gene;Acc:1... [more]
galr2a1.174e-630.77galanin receptor type 2 [Source:NCBI gene;Acc:1011... [more]
npy4r2.153e-631.31neuropeptide Y receptor type 1-like [Source:NCBI g... [more]
back to top
BLAST of SMED30012347 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003338.16.000e-10799.40SMESG000003338.1[more]
SMESG000003338.11.799e-9798.68SMESG000003338.1[more]
SMESG000003338.12.827e-9499.33SMESG000003338.1[more]
SMESG000036226.12.683e-3342.37SMESG000036226.1[more]
SMESG000065496.11.183e-2135.67SMESG000065496.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012347 ID=SMED30012347|Name=SMED30012347|organism=Schmidtea mediterranea sexual|type=transcript|length=526bp
AATCTCGAAGTCGTTAGTGACAACAACATTATAGCTGATGAAAATAAACT
TCCATATGAAATGAAGTTGACAAATCGGCAGAGAAAATTCCCAAATACCC
AACTCTTGAGCAGATAATGTAAAATGGTAATCGGGACGGTTAGCAGCAGA
AAGCTCAGATCTGTCAATGCGAGTCCAATGCAGAATATTTCATAGACAAC
GTGCTGTTTATTTCGGTAAAACACGGCGATGACAAAAGAATTACCCACGA
TACCGATCAAACAGATCATTGTCCACAAAGTGATCCAAATAGAGGTTTGC
GAAACGAACTTTTTCTTGTTGTACTCATTTTGAATCATTTTTATCAGTTC
TAGGGAATATTCAGAATTGTCTTTTACAAGATAGTGAATAATGATTTGGT
AGAGATACTCAAATGTTGTTTGATTAACTTTTCCCGATCGGAAGAGATTC
ATGTTCTTGAAAAATTCAATTTGTTCAAAGGAATAGTTTCCAAGATTCAT
ATTTATTGCGTTTGTAATATTTGTGC
back to top

protein sequence of SMED30012347-orf-1

>SMED30012347-orf-1 ID=SMED30012347-orf-1|Name=SMED30012347-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=174bp
TNITNAINMNLGNYSFEQIEFFKNMNLFRSGKVNQTTFEYLYQIIIHYLV
KDNSEYSLELIKMIQNEYNKKKFVSQTSIWITLWTMICLIGIVGNSFVIA
VFYRNKQHVVYEIFCIGLALTDLSFLLLTVPITILHYLLKSWVFGNFLCR
FVNFISYGSLFSSAIMLLSLTTSR
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 156..174
score: 17.41
coord: 111..132
score: 27.38
coord: 79..103
score: 25.64
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 94..174
e-value: 6.2E-12
score: 45.4
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 50..174
e-value: 3.4E-23
score: 83.7
NoneNo IPR availablePANTHERPTHR45695FAMILY NOT NAMEDcoord: 67..173
NoneNo IPR availableCDDcd150957tmA_KiSS1Rcoord: 82..155
e-value: 2.18085E-19
score: 80.7892
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 77..172
NoneNo IPR availableTMHMMTMhelixcoord: 80..102
NoneNo IPR availableTMHMMTMhelixcoord: 151..173
NoneNo IPR availableTMHMMTMhelixcoord: 117..139
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 94..174
score: 17.262