G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30012338
Length (bp)1372
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30012338) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30012338) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012338

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30012338h1SMcG0011555 SmedASXL_002759SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012338h1SMcG0011555 SmedASXL_080089SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30012338h1SMcG0011555 dd_Smed_v4_38431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012338h1SMcG0011555 dd_Smed_v4_38431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012338h1SMcG0011555 dd_Smed_v4_38431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012338h1SMcG0011555 dd_Smed_v6_38431_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012338h1SMcG0011555 dd_Smed_v6_56204_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GHSR (growth hormone secretagogue receptor [Source:HGNC Symbol;Acc:HGNC:4267])

HSP 1 Score: 57.3806 bits (137), Expect = 2.238e-8
Identity = 71/334 (21.26%), Postives = 137/334 (41.02%), Query Frame = 1
Query:  247 LFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILI---IGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFL--DAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKR 1233
            LF++G  GN     V+ + + +R +T  YL+ +   D  I +   + L+R W  + + F       + C++FQF+  + +  +V  I  ++VER   I  PLR    V+  + KL+I  ++ +    +   F  V +     +     T E +          TE+A  + + T +   + ++  LP+  + V+  +IG  +++  R RG+ +   S                                L ++  +Q   ML VV   F++   P  + ++    + +   S       +  + +  +L Y + AIN +LY    KK+R  V R
Sbjct:   53 LFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGD-----LLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWD-TNECR---------PTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLWR--RRRGDAVVGAS--------------------------------LRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKS-FEPGSLEIAQISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFR 336          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GHSR (growth hormone secretagogue receptor [Source:HGNC Symbol;Acc:HGNC:4267])

HSP 1 Score: 54.299 bits (129), Expect = 1.513e-7
Identity = 51/226 (22.57%), Postives = 105/226 (46.46%), Query Frame = 1
Query:  247 LFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILI---IGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFL--DAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMI---SMNSKDLRKT 900
            LF++G  GN     V+ + + +R +T  YL+ +   D  I +   + L+R W  + + F       + C++FQF+  + +  +V  I  ++VER   I  PLR    V+  + KL+I  ++ +    +   F  V +     +     T E +          TE+A  + + T +   + ++  LP+  + V+  +IG  +++  R RG+ +   S+  ++ ++T
Sbjct:   53 LFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGD-----LLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWD-TNECR---------PTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLWR--RRRGDAVVGASLRDQNHKQT 261          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: TRHR (thyrotropin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:12299])

HSP 1 Score: 50.447 bits (119), Expect = 3.921e-6
Identity = 75/336 (22.32%), Postives = 134/336 (39.88%), Query Frame = 1
Query:  256 LGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWL------VCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKS-INSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTP---LVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKR 1233
            LG +GN     V+++ K +R  T  YL  L   D  +L+   L    D  +G     +W+      +C    Q++G+  S  S   I   T+ER I I  P++     +  + K II+ ++  T      +F  + LN           +  K+   + C +K     ++ I+  +D  ++  +P++L  V+   I   ++            NSK  +   +  N+N +  T NR +  T             +Q+T ML VV   F +   P   LV++  F+      N    +            + +Y N AIN ++Y    +KFR   ++
Sbjct:   38 LGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSIYG-----SWVYGYVGCLCITYLQYLGINASSCS---ITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFFLLDLN----------ISTYKDAIVISCGYKISRNYYSPIY-LMDFGVFYVVPMILATVLYGFIARILFLNPIPSDP--KENSKTWKNDSTHQNTNLNVNTSNRCFNSTVS---------SRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFC----------RICIYLNSAINPVIYNLMSQKFRAAFRK 333          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: TRHR (thyrotropin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:12299])

HSP 1 Score: 50.447 bits (119), Expect = 3.921e-6
Identity = 75/336 (22.32%), Postives = 134/336 (39.88%), Query Frame = 1
Query:  256 LGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWL------VCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKS-INSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTP---LVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKR 1233
            LG +GN     V+++ K +R  T  YL  L   D  +L+   L    D  +G     +W+      +C    Q++G+  S  S   I   T+ER I I  P++     +  + K II+ ++  T      +F  + LN           +  K+   + C +K     ++ I+  +D  ++  +P++L  V+   I   ++            NSK  +   +  N+N +  T NR +  T             +Q+T ML VV   F +   P   LV++  F+      N    +            + +Y N AIN ++Y    +KFR   ++
Sbjct:   38 LGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSIYG-----SWVYGYVGCLCITYLQYLGINASSCS---ITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFFLLDLN----------ISTYKDAIVISCGYKISRNYYSPIY-LMDFGVFYVVPMILATVLYGFIARILFLNPIPSDP--KENSKTWKNDSTHQNTNLNVNTSNRCFNSTVS---------SRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFC----------RICIYLNSAINPVIYNLMSQKFRAAFRK 333          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: K03H6.1 (pep chromosome:WBcel235:IV:1523718:1526599:1 gene:WBGene00019367.1 transcript:K03H6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K03H6.1)

HSP 1 Score: 54.299 bits (129), Expect = 1.082e-7
Identity = 59/261 (22.61%), Postives = 106/261 (40.61%), Query Frame = 1
Query:  475 SLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIIT--MTISSHFFETVTLNRRKNSKTL-----------QMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFR 1218
            S  ++WLI+ V++ER ++++ P R   Y    K  +++ S+F+ T  +T+  HF     +    N   L           Q T  +K+      + K  Y  F+   TFL+A L   +P+VL+IV+N+++          R   I+  S  L   +   +    R   R+                     + ++ +   F +T  P   +  +   + Y    T Y      + +I   L+ T   INF+L+C S + FR
Sbjct:  106 SAAAIWLILAVSIERYLIVRSPFRAKLYWQRGKMVVVLSSIFVTTGLLTVYHHFEWDCVIEEFCNGTQLLDFCYYSGMRHQKTYRNKDW-VTPSNVKKVYLKFS---TFLNAILVVFVPIVLVIVLNMLM---------IRQLKINWTSPRLESMRGAMTRSHVRQRQRV--------------------AVTVIAIGLCFSLTQGPSAFMALYELFSEYELGHTFYA-----IFSITNSLVVTGKTINFILFCLSSEHFR 328          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: sprr-1 (Sex Peptide Receptor (Drosophila) Related [Source:UniProtKB/TrEMBL;Acc:G5EEU4])

HSP 1 Score: 51.6026 bits (122), Expect = 7.481e-7
Identity = 64/273 (23.44%), Postives = 116/273 (42.49%), Query Frame = 1
Query:  481 MSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICD-------FKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTK---------SINSNKSTR----TGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFF 1239
            M++WL V + ++R I I +P  V  + +I ++K +I   FII++    +  + +  +    +K+  +    +N +  +C         K     + K+           +P VL+++    +   I  ADR    ++S  S   R T+         S N NK TR      +   G  PR+A         +Q T ML+VV   FLIT  P  L+     L++    S      L ++  +  +L+  ++   F +YC   ++FR  V++ F
Sbjct:  124 MAIWLTVYLAIQRYIYICVPSLVRKFCTIHRSKQVIF--FIISVATIMYTPDLMAFH----NKSHDVFDSKRNRTMKLCYRHRAPFMLKLGDDIYYKVMFTTQTVAVHLIPSVLLVIFTWKLVGAIRVADRRHANLLSKYSTTTRSTRRKFSELTNSSENENKITRLFKQRDSVSVGNEPRRA------HGLKQNTRMLVVVILLFLITEIPAALIFTIHVLSVSLKFSFVDYQFLNILLIVRNVLIVVSYPFRFAIYCGMSQQFRDVVRQMF 384          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: sprr-1 (Sex Peptide Receptor (Drosophila) Related [Source:UniProtKB/TrEMBL;Acc:G5EEU4])

HSP 1 Score: 51.6026 bits (122), Expect = 7.481e-7
Identity = 64/273 (23.44%), Postives = 116/273 (42.49%), Query Frame = 1
Query:  481 MSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICD-------FKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTK---------SINSNKSTR----TGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFF 1239
            M++WL V + ++R I I +P  V  + +I ++K +I   FII++    +  + +  +    +K+  +    +N +  +C         K     + K+           +P VL+++    +   I  ADR    ++S  S   R T+         S N NK TR      +   G  PR+A         +Q T ML+VV   FLIT  P  L+     L++    S      L ++  +  +L+  ++   F +YC   ++FR  V++ F
Sbjct:  124 MAIWLTVYLAIQRYIYICVPSLVRKFCTIHRSKQVIF--FIISVATIMYTPDLMAFH----NKSHDVFDSKRNRTMKLCYRHRAPFMLKLGDDIYYKVMFTTQTVAVHLIPSVLLVIFTWKLVGAIRVADRRHANLLSKYSTTTRSTRRKFSELTNSSENENKITRLFKQRDSVSVGNEPRRA------HGLKQNTRMLVVVILLFLITEIPAALIFTIHVLSVSLKFSFVDYQFLNILLIVRNVLIVVSYPFRFAIYCGMSQQFRDVVRQMF 384          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: T10E10.3 (pep chromosome:WBcel235:X:6311715:6314588:1 gene:WBGene00020420.1 transcript:T10E10.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T10E10.3)

HSP 1 Score: 50.8322 bits (120), Expect = 1.329e-6
Identity = 73/358 (20.39%), Postives = 135/358 (37.71%), Query Frame = 1
Query:  241 PILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGL----LRRWVDKTFGFSSENNWLVCCQVFQ-----------FIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGI------YQADRSRGEMISMNSKDLRK---TKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRN---SSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKR 1233
            P L +LG  GN+    VL+ R + R ST   LA    F   + II +    L RW         +N    C   +            F+    S  S W IV V+ +RL  IK P          +  L+ + L +     S        L+    S     +T          + +    T  ++ T      +  +P++L+I  +  + + +      +   R+R    S  S D+     +   + ++  R  +   G   R       N+  R +T  ++ +   ++++  P   L  ++ +NL+ N   S+    T +++  T+    +  +   NF+L+C S K FR  +K+
Sbjct:    3 PFLAILGVFGNSITLFVLLSRSM-RNSTNEMLAA-AAFSDILYIICMVPNQLSRWPSMVLSDCPDNPERKCASEYHMWFAVHKHHLAFLANWFSAASTWFIVTVSFDRLYAIKAPFSARLQTICPRHNLVAIPLILFFTGASCFHMNFKLLDDHAGSGNFTNSTME--------NIEDNRITLIQVMTVFMFIFHILIPMILLISFHTCLLYYLRNRFRHFFPARTRSARNSTRSDDVPAPLLSNVTDRSEVVRHHSSNSGVWNRHV-----NKAERHVTYTVIAIVTCYIVSHIPSACL--YVYINLFHNVLYSTRWMYTSVQVSTTV----VTCSKVANFILFCMSSKHFRKEMKK 339          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: H09F14.1 (pep chromosome:WBcel235:V:10613738:10615511:-1 gene:WBGene00010375.1 transcript:H09F14.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H09F14.1)

HSP 1 Score: 49.6766 bits (117), Expect = 2.457e-6
Identity = 73/334 (21.86%), Postives = 134/334 (40.12%), Query Frame = 1
Query:  241 PILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQ----SILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPL-VLLKFFIKLNLYRNSSTSYITKLELVDTIF---EMLMYTNHAINFLLYCASGKKFR 1218
            P++ + G  GN  +   +   +L RV+   YL VLT  D      IL+I     W+   +           C   +++ +  S +S W    +T+ER + I  PL    Y  + + K+++  + I  +     FF            +L+  TE +      C  K   A +  I   +D  L   +P  +++V+N+++     Q  +S+   ++       +TK  NS ++  +                 +  +   T +L V+   F++  TP  V++   I   +   S  S  T+ EL  T++     + Y N AI+ L+Y  S   FR
Sbjct:   16 PLIVIFGLSGNVISLVTIFHSRLRRVNANIYLIVLTLADSIFLTGILLICFKVDWIAYEY-----------CVGLEYVLMTASYISSWSTAALTIERYLAIAHPLSHMKYGHVDRAKVMLYWVPIPFVLQLFQFF------------SLEPATEERK-----CALKE--ANYQIIAQAVDTVLCYVVPCGIIVVLNILVA---LQVQKSQEHFMA-------ETKKSNSRRTGGS-----------------SSSSGTWTRILWVMPLVFVVLNTPFYVIMMIEIVFQIIYQSPPSGDTRSELFVTVYNTAHYMYYMNTAIDVLVYAFSSANFR 292          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CNMaR (gene:FBgn0053696 transcript:FBtr0091684)

HSP 1 Score: 96.6709 bits (239), Expect = 3.322e-21
Identity = 94/399 (23.56%), Postives = 157/399 (39.35%), Query Frame = 1
Query:  211 IFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSK----------------------DLRKTKSINSNKSTRT--------GNRIY---------------------GFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKF--FIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFESI 1248
            I H + + + P+L   G++GN  +  V  + KL ++S+ +YLA L   D +  + GL  +W++         N+   CQ F F     S  SVW +V  TVER I +  PL+  +  ++++ K++   LF +T+    H    + + +      L  T         ICD  +EY     ++ + D  +   +P   + V+N   G  +++    R  +     K                        R + S+   KST T         NR                         T + A   + N    ++T MLL+VS  F+    P  LL+   + +    RN +++       +  IF     TN  INF+LYC SG+ FR  V   F  +
Sbjct:   57 IGHFVHQYYIPVLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAALAVSD-TCFLAGLFAQWLNFLNVDIYNQNYF--CQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRRAKIV---LFCLTLVGCLHCLPYIVIAKPVFMPKLNTT---------ICDLNSEYKEQLALFNYWDTIVVYAVPFTTIAVLNTCTGCTVWKFATVRRTLTMHKMKPQTNSMPSNSSNSSGGASSAVASYRLSASLKRQKSTGTHPSGQHNVANRQTDDQEQQQQSQQHQINNCQHHCEITQKPARRKVQNSSQLKVTKMLLIVSTVFVCLNLPSCLLRIEAYWETESARNQNSTIA-----LQYIFHAFFITNFGINFVLYCVSGQNFRKAVLSIFRRV 435          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0100552)

HSP 1 Score: 53.1434 bits (126), Expect = 3.868e-7
Identity = 45/169 (26.63%), Postives = 81/169 (47.93%), Query Frame = 1
Query:  205 CQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGL---LRRWVDKTFGFS------SENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYV--SIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQ 678
             ++ H++ +   P +F++G LGN+ +  VL  RK +R +T  YL  L   D + L   L   L+ +    + F           WL  C  F +I       S+++ V  T+ER I I+ PL+  ++   S+ K  +  +++F +  T+S+ F  T+T+  R+     Q
Sbjct:   36 AEVRHVVQRILVPCVFVIGLLGNSVSIYVLT-RKRMRCTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHFKLYWQLYGYFVWL--CDSFGYI-------SIYIAVCFTIERFIAIRYPLKRQTFCTESLAKKVIAAVAIFCLLSTLSTAFEHTITIGTRQIDDAYQ 194          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0070713)

HSP 1 Score: 53.1434 bits (126), Expect = 3.868e-7
Identity = 45/169 (26.63%), Postives = 81/169 (47.93%), Query Frame = 1
Query:  205 CQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGL---LRRWVDKTFGFS------SENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYV--SIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQ 678
             ++ H++ +   P +F++G LGN+ +  VL  RK +R +T  YL  L   D + L   L   L+ +    + F           WL  C  F +I       S+++ V  T+ER I I+ PL+  ++   S+ K  +  +++F +  T+S+ F  T+T+  R+     Q
Sbjct:   36 AEVRHVVQRILVPCVFVIGLLGNSVSIYVLT-RKRMRCTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHFKLYWQLYGYFVWL--CDSFGYI-------SIYIAVCFTIERFIAIRYPLKRQTFCTESLAKKVIAAVAIFCLLSTLSTAFEHTITIGTRQIDDAYQ 194          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0100551)

HSP 1 Score: 53.1434 bits (126), Expect = 3.868e-7
Identity = 45/169 (26.63%), Postives = 81/169 (47.93%), Query Frame = 1
Query:  205 CQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGL---LRRWVDKTFGFS------SENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYV--SIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQ 678
             ++ H++ +   P +F++G LGN+ +  VL  RK +R +T  YL  L   D + L   L   L+ +    + F           WL  C  F +I       S+++ V  T+ER I I+ PL+  ++   S+ K  +  +++F +  T+S+ F  T+T+  R+     Q
Sbjct:   36 AEVRHVVQRILVPCVFVIGLLGNSVSIYVLT-RKRMRCTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHFKLYWQLYGYFVWL--CDSFGYI-------SIYIAVCFTIERFIAIRYPLKRQTFCTESLAKKVIAAVAIFCLLSTLSTAFEHTITIGTRQIDDAYQ 194          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: Proc-R (gene:FBgn0029723 transcript:FBtr0070714)

HSP 1 Score: 53.1434 bits (126), Expect = 3.868e-7
Identity = 45/169 (26.63%), Postives = 81/169 (47.93%), Query Frame = 1
Query:  205 CQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGL---LRRWVDKTFGFS------SENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYV--SIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQ 678
             ++ H++ +   P +F++G LGN+ +  VL  RK +R +T  YL  L   D + L   L   L+ +    + F           WL  C  F +I       S+++ V  T+ER I I+ PL+  ++   S+ K  +  +++F +  T+S+ F  T+T+  R+     Q
Sbjct:   36 AEVRHVVQRILVPCVFVIGLLGNSVSIYVLT-RKRMRCTTNIYLTALAITDIAYLTCQLILSLQHYDYPKYHFKLYWQLYGYFVWL--CDSFGYI-------SIYIAVCFTIERFIAIRYPLKRQTFCTESLAKKVIAAVAIFCLLSTLSTAFEHTITIGTRQIDDAYQ 194          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: trhrb (thyrotropin-releasing hormone receptor b [Source:ZFIN;Acc:ZDB-GENE-060503-382])

HSP 1 Score: 67.781 bits (164), Expect = 6.939e-12
Identity = 89/356 (25.00%), Postives = 153/356 (42.98%), Query Frame = 1
Query:  244 ILFL---LGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWL------VCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTP---LVLLKFFIKLNLYRNSSTSYITKLELVDTIFEML----MYTNHAINFLLYCASGKKFRYHVKRFFESICCGKN 1263
            I+FL   LG +GN     V++  K +R  T  YL  L   D  +L+   L    D  FG     +W+      +C   FQ++G+  S  S   I   T+ER I I  P++     ++ + K II+ +++ T      +F    + +             K+ + + C +K     +  I+ F D  ++  LPL L  V+  +I   ++         ++    D ++ K+ + N S    N++   + R ++    +R  RQ+T ML VV   F +   P   LV++  F++         +Y+      DT F +     +Y N AIN L+Y A  +KFR   +R      CG+N
Sbjct:   28 IVFLICALGIVGNVMVILVVLTTKHMRTPTNGYLVSLAVADLMVLVAAGLPSIADSLFG-----SWVFGHAGCLCITYFQYLGINASSCS---ITAFTIERYIAICHPIKAQFLCTLSRAKKIIIGVWVFTSLYCVMWFYLSDVQQ----------VLYKDATIITCAYKVSRNLYLPIY-FFDFGIFFVLPLTLATVLYGLIARILF---------LNPLPSDTKEEKNGHGNFSKAKRNKLKS-SSRCSSTTAASR--RQVTKMLAVVVILFAVLWMPYRTLVVVNSFLQ--------DAYL------DTWFLLFCRTCVYLNSAINPLIYNAMSQKFRAAFRRLCR---CGRN 335          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: ghsra (growth hormone secretagogue receptor a [Source:ZFIN;Acc:ZDB-GENE-070912-238])

HSP 1 Score: 66.2402 bits (160), Expect = 2.067e-11
Identity = 77/337 (22.85%), Postives = 140/337 (41.54%), Query Frame = 1
Query:  244 ILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILI---IGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLD--AFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFF 1239
            + F +G  GN     V+ + K +R +T  YL+ +   D  I +   + L R W  + + F +     + C++FQF+    +  ++  I  ++VER   I  PLR    V+  + + +IL L+I++   +   F  V +     + +   T E K          TEYA  + + T +   + ++  LP+  + V+  +IG  +++                RK ++I  N S+R                  ++  RQ   ML VV   F++   P  + ++ I  +    S    I      + I  +L Y + AIN +LY    KK+R    + F
Sbjct:   46 LFFFVGVTGNLMTILVVTKYKDMRTTTNLYLSSMAFSDLLIFLCMPLDLYRIWRYRPWNFGN-----ILCKLFQFVSECCTYSTILNITALSVERYFAICFPLRAKVVVTKGRVRGVILVLWIVSFFSAGPVFVLVGVEHENGTNSWD-TNECK---------ATEYAIRSGLLTIMVWVSSIFFFLPVFCLTVLYSLIGRKLWK----------------RKRETIGENASSR------------------DKSNRQTVKMLAVVVFAFVLCWLPFHVGRYLISKSTEMGSPVMSIIS-HYCNLISFVLFYLSAAINPILYNIMSKKYRMAACKLF 332          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: ghsrb (growth hormone secretagogue receptor b [Source:ZFIN;Acc:ZDB-GENE-090327-1])

HSP 1 Score: 66.2402 bits (160), Expect = 2.301e-11
Identity = 78/340 (22.94%), Postives = 141/340 (41.47%), Query Frame = 1
Query:  247 LFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILI---IGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFL----DAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKL-ELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFE 1242
            LFL+G  GN     V+ + K +R +T  YL  +   D  I +   + L R W  + + F  E      C++FQF+  + +  ++  I  ++VER   I  PLR    V+  + K +IL L+ + +  +   F  V +     +   + T E K          TEYA  + + T +      F +  LP++ + V+  +IG  +++  R    +  ++S+D                                 +  +Q   ML VV   F++   P  + ++ +  +   NS    I+++ E  + +  +L Y + AIN +LY    KKFR    + F 
Sbjct:   52 LFLVGIAGNLLTILVVTKYKDMRTTTNLYLCSMALSDLLIFLCMPLDLYRVWRYRPWNFGDE-----LCKLFQFVSESCTYSTILNITALSVERYFAICFPLRAKVIVTRGRVKGVILLLWTVALCSAGPIFILVGVEHENGTNAWE-TNECK---------ATEYAIRSGLLTMMVWVSSVFFF--LPVLCLTVLYSLIGRRLWR--RKENPVGPISSRD---------------------------------KSNKQTVKMLAVVVLAFVLCWLPFHVGRYLVSKSSEANSPV--ISQISEYCNLVSFVLFYLSAAINPILYNIMSKKFRSAACKLFR 337          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: trhra (thyrotropin-releasing hormone receptor a [Source:ZFIN;Acc:ZDB-GENE-100922-18])

HSP 1 Score: 53.9138 bits (128), Expect = 2.128e-7
Identity = 77/330 (23.33%), Postives = 135/330 (40.91%), Query Frame = 1
Query:  256 LGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQV--FQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTP---LVLLKFFIKLNLYRNSSTSYITKLELVDTIF----EMLMYTNHAINFLLYCASGKKFR 1218
            +G +GN     V++  K +R  T  YL  L   D  +L    L    +  FG      +  C  +  FQ++G+  S  S   I   T+ER I I  P++     ++ + K II+ ++++T      +F    L+ R+            N   + C +K     +  I+ F D  ++  +PL+L  V+  +I   ++         ++    D ++++     +ST   +R                  RQ+T ML VV   F +   P   LV++  F+K         +Y+      DT F     + +Y N AIN ++Y A  +KFR
Sbjct:   32 VGIVGNVMVILVVLTTKHMRTPTNCYLVSLAVADLMVLTAAGLPNITEILFGGQWVYGYAGCLSITYFQYLGINASSCS---ITAFTIERYIAICHPIKAQFMCTLSRAKKIIVLVWVLTSLYCVMWF--YLLDTREKVY--------DNAVLVTCGYKVSRELYLPIY-FTDYAVFYVIPLLLATVLYGLIARILF---------LNPLPSDPKESRRNWKKESTTVASR------------------RQVTKMLAVVVILFALLWMPYRTLVVVNSFLK--------EAYL------DTCFLLFCRLCIYMNSAINPIIYNAMSQKFR 306          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: nmur3 (neuromedin U receptor 3 [Source:ZFIN;Acc:ZDB-GENE-130530-567])

HSP 1 Score: 53.5286 bits (127), Expect = 2.888e-7
Identity = 80/364 (21.98%), Postives = 154/364 (42.31%), Query Frame = 1
Query:  244 ILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGL----LRRWVDKTFGFSSENNWLVCC-QVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKL-ELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFESICCGKNHDVTTHYNRITF--IPHD 1311
            ++F+ G LGN     V+ + + ++  T  YL  L   D  +L+ G+       W +  F F       +CC ++F F  V     SV  + V++VER I +  PL+    ++ K  + +I  ++ +++  +       +L+  +     +   ES   + L    K  Y    +I T L  F    +P++++ V+ ++IG  + +  + + + +  N          +SN S +                L +R  RQ+T M  VV   F I   P  + +    L  +  S T ++  + E V  I  +L Y + A+N ++Y     +FR      F+++ C +    ++  + + F  IP D
Sbjct:   98 LIFMTGVLGNLLTCAVITKDRKMQTPTNLYLFSLAISDLLVLLFGMPLEIYELWQNYPFPFGES----ICCFKIFLFETVC--FASVLNVTVLSVERYIAVIHPLKTRYAITNKHARRVIAGVWAMSLLCA---VPNTSLHGLQYQYLPERVQESATCNLL--KPKWMYNLVIQITTVLFYF----VPMMMISVLYLMIGLTLGRGQKQKKDKLGSN----------HSNDSWKIH--------------LDSRRRRQVTKMHFVVVLVFAICWAPFHIDRL---LWSFITSWTDHMHNIFEYVHIISGVLFYLSSAVNPIIYNLLSSRFRER----FQALVCSRLSTRSSRNDSMPFYIIPKD 415          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: GHSR (growth hormone secretagogue receptor [Source:NCBI gene;Acc:100497774])

HSP 1 Score: 64.3142 bits (155), Expect = 1.328e-10
Identity = 74/338 (21.89%), Postives = 139/338 (41.12%), Query Frame = 1
Query:  244 ILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILI---IGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFL--DAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFE 1242
            +LF++G  GN     V+ + K +R +T  YL+ +   D  I +   + L R W  + + F S       C++FQF+    +  ++  I  ++VER   I  PL+    ++  + KL+I  L+ ++   +   F  V +     +  L  T E K          TEYA  + + T +   + ++  LP+  + V+  +IG  +++                RK ++I  + S R                  ++  +Q   ML VV   F++   P  + ++    + +   S       +  + +  +L Y + AIN +LY    KK+R    R F 
Sbjct:   50 LLFIIGISGNVMTMLVVSKYKDMRTTTNLYLSSMAFSDLLIFLCMPLDLYRLWQYRPWNFGSS-----LCKLFQFVSECCTYSTILNITALSVERYFAICFPLKAKVVITKGRVKLVISVLWAVSFVSAGPIFVLVGVEHENGTNPLD-TNECK---------ATEYAIKSGLLTIMVWTSSIFFFLPVFCLTVLYTLIGRKLWR----------------RKRETIGPHTSIR------------------DKHNKQTVKMLAVVVFAFILCWLPFHVARYLFSKS-FEAGSLEIALISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAACRLFR 337          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: kiaa1324l (KIAA1324-like [Source:Xenbase;Acc:XB-GENE-5954588])

HSP 1 Score: 54.299 bits (129), Expect = 2.613e-7
Identity = 78/334 (23.35%), Postives = 136/334 (40.72%), Query Frame = 1
Query:  256 LGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWL------VCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIY----QADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTP---LVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFR 1218
            LG +GN     V++Q K +R  T  YL  L   D  +L+   L    +  +G     +W+      +C    Q++G+  S  S   I   TVER + I  P++     +I + K II+ ++  T      +F  + LN          TT  K+ + + C ++   + ++ I+  +D  ++  +P+ L  V+  +I   ++     +D         N     + K+ NS  S+R  N                   RQ+T ML VV   F     P   LV++  F+        S  Y+    ++     + +Y N AIN ++Y    +KFR
Sbjct:   38 LGIVGNIMVVLVVLQTKHMRTPTNCYLVSLAIADLIVLVAAGLPNITESVYG-----SWVYGYIGCLCITYLQYLGINASSCS---ITAFTVERYLAICHPIKAQFLCTISRAKKIIVFVWAFTSLYCLMWFFLLDLN----------TTIYKDATVVNCGYRVPRSFYSPIY-LIDFGIFYAVPMTLATVLYGLIARILFLNPIPSDPKENSKTWKNDVT-HQNKAFNSKMSSRCSNNTIA-------------SRRQVTKMLAVVVILFAFLWMPYRTLVVVNSFL--------SRPYLQTWFVL--FCRICIYLNSAINPVIYNLMSQKFR 328          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: efr3b (EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491])

HSP 1 Score: 52.7582 bits (125), Expect = 8.839e-7
Identity = 74/367 (20.16%), Postives = 151/367 (41.14%), Query Frame = 1
Query:  244 ILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWL---VCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVM-----------NVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGN----RIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEM---LMYTNHAINFLLYCASGKKFRYHVKRFFESICCGKNHDVTTH 1281
            +    G LGN      +   + ++  T+Y++A L   D  +L++ ++   +  +  F  +  WL   + C ++  + V     S+  +  ++++R I +  PLR  S ++ K+  L +L ++++++ IS            ++ K  ++T E              YA F+   +F        LPL +++VM           + V+  G+ + ++S  E +++        +SI S  S++       R+  F+          RE +    + +VV C F++   P  L+     +    NSS          DTIF++   L Y N  IN ++Y  S  +FR   +    + C  +    + +
Sbjct:   59 VFITFGVLGNILVILSVACHRHLQTVTHYFIANLAVAD--LLLMSMV---LPFSATFEIQGYWLFGRIFCNIWAAVDVLCCTASIMSLCAISIDRYIGVSYPLRYPSIMTEKRGVLALLCIWVLSLVISIGPLFGWKQPAPEDDKICEITKEPG------------YALFSAFGSFY-------LPLSIILVMYFRVYIVAKRESKVLTSGM-KLEKSDSEEVTLRIHRKSTPESIGSTSSSKQKTQFSVRLLKFS----------REKKAAKTLGIVVGC-FVLCWLPFFLVMPIGSIYPPANSS----------DTIFKITFWLGYFNSCINPVIYPCSSPEFRKAFQNILHARCSHRRQAASKY 379          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Ghsr (growth hormone secretagogue receptor [Source:MGI Symbol;Acc:MGI:2441906])

HSP 1 Score: 56.6102 bits (135), Expect = 2.650e-8
Identity = 76/342 (22.22%), Postives = 141/342 (41.23%), Query Frame = 1
Query:  247 LFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILI---IGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFL----DAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRF--FES 1245
            LF++G  GN     V+ + + +R +T  YL+ +   D  I +   + L+R W  + + F       + C++FQF+  + +  +V  I  ++VER   I  PLR    V+  + KL+IL ++ +    +   F  V +   +N    + T E +          TE+A  + + T +      F +  LP+  + V+  +IG  ++   R RG+    +S                                L ++  +Q   ML VV   F++   P  + ++    + +   S       +  + +  +L Y + AIN +LY    KK+R  V +   FES
Sbjct:   52 LFVVGISGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGD-----LLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVE-HENGTDPRDTNECR---------ATEFAVRSGLLTVMVWVSSVFFF--LPVFCLTVLYSLIGRKLW---RRRGDAAVGSS--------------------------------LRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKS-FEPGSLEIAQISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFKLLGFES 340          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Trhr2 (thyrotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:2177284])

HSP 1 Score: 53.5286 bits (127), Expect = 2.873e-7
Identity = 78/330 (23.64%), Postives = 134/330 (40.61%), Query Frame = 1
Query:  256 LGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLV----CCQV--FQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTP---LVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFR 1218
            +G +GN     V++  + +   T  YL  L   D  +L+   L    D   G     +W+     C  +  FQ++G+  S  S   I+  TVER I I  P+R  +  ++ + + II  ++ +T      +F  V LN R N +             L C +K     +  I+  LD  ++   PL+  +V+   IG  ++Q+  S+        +  +K +  +       GN     +   +         +Q T ML V+   F +  TP   LVLL  F+        +  ++    L+       +YTN AIN ++Y    +KFR
Sbjct:   35 VGIVGNAMVVLVVLTSRDMHTPTNCYLVSLALADLIVLLAAGLPNVSDSLVG-----HWIYGHAGCLGITYFQYLGINVSSCS---ILAFTVERYIAICHPMRAQTVCTVARARRIIAGIWGVTSLYCLLWFFLVDLNVRDNQR-------------LECGYKVSRGLYLPIY-LLDFAVFFIAPLLGTLVLYGFIGRILFQSPLSQ--------EAWQKERQSHGQSEGTPGNCSRSKSSMSS--------RKQATRMLAVIVLLFAVLWTPYRTLVLLNSFL--------ARPFLDPWVLL--FCRTCVYTNSAINPVIYSLMSQKFR 316          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Nmur1 (neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI:1341898])

HSP 1 Score: 52.373 bits (124), Expect = 8.714e-7
Identity = 72/326 (22.09%), Postives = 131/326 (40.18%), Query Frame = 1
Query:  244 ILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVAT-SLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFR 1218
            ++F++GTLGN     V+++ K +R  T +YL  L   D  +L++GL     +    +  +     C   F+ + + T  L SV  +  ++VER + +  PL+  S ++    + ++ +++++    S       +L+       L +          IC        F K+     A L+ CLP+V + V+ ++IG       R    ++ +  K  RKT +       R                L +R  RQ+T ML  +   F I   P    +    L +Y +S+       + V     +  Y   A N +LY     +FR
Sbjct:   69 LIFVVGTLGNGLTCTVILRNKTMRTPTNFYLFSLAVSDMLVLLVGLPLELYEMQQNYPFQLGASAC--YFRILLLETVCLASVLNVTALSVERYVAVVRPLQAKSVMTRAHVRRMVGAIWVLATLFS---LPNTSLH---GLSQLTVPCRGPVPDSAICSLVGPM-DFYKLVVLTTALLFFCLPMVTISVLYLLIG----LRLRRERMLLQVEVKG-RKTAATQETSHRRIQ--------------LQDRGRRQVTKMLFALVVVFGICWAPFHADRIMWSL-VYGHSTEGLHLAYQCVHIASGIFFYLGSAANPVLYSLMSTRFR 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Nmur1 (neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI:1341898])

HSP 1 Score: 51.9878 bits (123), Expect = 9.663e-7
Identity = 76/337 (22.55%), Postives = 134/337 (39.76%), Query Frame = 1
Query:  229 KAFPPI------LFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVAT-SLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFR 1218
            K F PI      +F++GTLGN     V+++ K +R  T +YL  L   D  +L++GL     +    +  +     C   F+ + + T  L SV  +  ++VER + +  PL+  S ++    + ++ +++++    S       +L+       L +          IC        F K+     A L+ CLP+V + V+ ++IG       R    ++ +  K  RKT +       R                L +R  RQ+T ML  +   F I   P    +    L +Y +S+       + V     +  Y   A N +LY     +FR
Sbjct:   35 KQFVPICVTYLLIFVVGTLGNGLTCTVILRNKTMRTPTNFYLFSLAVSDMLVLLVGLPLELYEMQQNYPFQLGASAC--YFRILLLETVCLASVLNVTALSVERYVAVVRPLQAKSVMTRAHVRRMVGAIWVLATLFS---LPNTSLH---GLSQLTVPCRGPVPDSAICSLVGPM-DFYKLVVLTTALLFFCLPMVTISVLYLLIG----LRLRRERMLLQVEVKG-RKTAATQETSHRRI--------------QLQDRGRRQVTKMLFALVVVFGICWAPFHADRIMWSL-VYGHSTEGLHLAYQCVHIASGIFFYLGSAANPVLYSLMSTRFR 342          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Trhr (thyrotropin releasing hormone receptor [Source:MGI Symbol;Acc:MGI:98824])

HSP 1 Score: 51.6026 bits (122), Expect = 1.338e-6
Identity = 74/339 (21.83%), Postives = 134/339 (39.53%), Query Frame = 1
Query:  256 LGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWL------VCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIY----QADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTP---LVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKR 1233
            LG +GN     V+++ K +R  T  YL  L   D  +L+   L    D  +G     +W+      +C    Q++G+  S  S   I   T+ER I I  P++     +  + K II+ ++  T      +F  + LN           +  KN   + C +K     ++ I+  +D  ++  +P++L  V+   I   ++     +D      +  N   + + K++N N + R  N                   +Q+T ML VV   F +   P   LV++  F+      N    +            + +Y N AIN ++Y    +KFR   ++
Sbjct:   38 LGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSIYG-----SWVYGYVGCLCITYLQYLGINASSCS---ITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLN----------ISTYKNAVVVSCGYKISRNYYSPIY-LMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKMWKND-SIHQNKNLNLNATNRCFNSTVS-------------SRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENWFLLFC----------RICIYLNSAINPVIYNLMSQKFRAAFRK 333          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|A5A4K9|GHSR_RABIT (Growth hormone secretagogue receptor type 1 OS=Oryctolagus cuniculus OX=9986 GN=GHSR PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 5.894e-9
Identity = 74/334 (22.16%), Postives = 136/334 (40.72%), Query Frame = 1
Query:  247 LFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILI---IGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFL----DAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHV 1227
            LF++G  GN     V+ + + +R +T  YL+ +   D  I +   + L+R W  + + F       + C++FQF+  + +  +V  I  ++VER   I  PLR    V+  + KL+IL ++ +    +   F  V +   +N    Q T E +          TE+A  + + T +      F +  LP+  + V+  +IG  +++  R  G + S                                   L ++  RQ   ML VV   F++   P  + ++    + +   S       +  + +  +L Y + AIN +LY    KK+R  V
Sbjct:   53 LFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGD-----LLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWALAFCSAGPIFVLVGVE-HENGTDPQDTNECR---------ATEFAVRSGLLTIMVWVSSVFFF--LPVFCLTVLYSLIGRKLWRRKRGDGAVGS----------------------------------SLRDQNHRQTVKMLAVVVFAFILCWLPFHVGRYLFSKS-FEPGSLEIAQISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAV 334          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|A5A4L1|GHSR_MUSPF (Growth hormone secretagogue receptor type 1 OS=Mustela putorius furo OX=9669 GN=GHSR PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 4.064e-8
Identity = 73/334 (21.86%), Postives = 136/334 (40.72%), Query Frame = 1
Query:  247 LFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILI---IGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFL----DAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHV 1227
            LF++G  GN     V+ + + +R +T  YL+ +   D  I +   + L+R W  + + F       + C++FQF+  + +  +V  I  ++VER   I  PLR    V+  + KL+IL ++ +    +   F  V +   +N    + T E +          TE+A  + + T +      F +  LP+  + V+  +IG  +++  R RGE                                      L ++  +Q   ML VV   F++   P  + ++    + +   S       +  + +  +L Y + AIN +LY    KK+R  V
Sbjct:   53 LFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGD-----LLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVE-HENGTDPRDTNECR---------ATEFAVRSGLLTVMVWVSSVFFF--LPVFCLTVLYSLIGRKLWR--RKRGEA--------------------------------AVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKS-FEPGSLEIAQISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAV 334          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q92847|GHSR_HUMAN (Growth hormone secretagogue receptor type 1 OS=Homo sapiens OX=9606 GN=GHSR PE=1 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.075e-7
Identity = 71/334 (21.26%), Postives = 137/334 (41.02%), Query Frame = 1
Query:  247 LFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILI---IGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFL--DAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKR 1233
            LF++G  GN     V+ + + +R +T  YL+ +   D  I +   + L+R W  + + F       + C++FQF+  + +  +V  I  ++VER   I  PLR    V+  + KL+I  ++ +    +   F  V +     +     T E +          TE+A  + + T +   + ++  LP+  + V+  +IG  +++  R RG+ +   S                                L ++  +Q   ML VV   F++   P  + ++    + +   S       +  + +  +L Y + AIN +LY    KK+R  V R
Sbjct:   53 LFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGD-----LLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWD-TNECR---------PTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLWR--RRRGDAVVGAS--------------------------------LRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKS-FEPGSLEIAQISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFR 336          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q95254|GHSR_PIG (Growth hormone secretagogue receptor type 1 OS=Sus scrofa OX=9823 GN=GHSR PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.562e-7
Identity = 74/334 (22.16%), Postives = 136/334 (40.72%), Query Frame = 1
Query:  247 LFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILI---IGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFL----DAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHV 1227
            LF++G  GN     V+ + + +R +T  YL+ +   D  I +   + L R W  + +   +     + C++FQF+  + +  +V  I  ++VER   I  PLR    V+  + KL+IL ++ +    +   F  V +    N    + T E +          TE+A  + + T +      F +  LP+  + V+  +IG  +++  R RGE    +S                                L ++  +Q   ML VV   F++   P  + ++    +L    S       +  + +  +L Y + AIN +LY    KK+R  V
Sbjct:   53 LFVVGIAGNLLTMLVVSRFREMRTTTNLYLSSMAFSDLLIFLCMPLDLFRLWQYRPWNLGN-----LLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVE-HDNGTDPRDTNECR---------ATEFAVRSGLLTVMVWVSSVFFF--LPVFCLTVLYSLIGRKLWR--RKRGEAAVGSS--------------------------------LRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSL-EPGSVEIAQISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAV 334          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99P50|GHSR_MOUSE (Growth hormone secretagogue receptor type 1 OS=Mus musculus OX=10090 GN=Ghsr PE=2 SV=3)

HSP 1 Score: 56.6102 bits (135), Expect = 1.854e-7
Identity = 76/342 (22.22%), Postives = 141/342 (41.23%), Query Frame = 1
Query:  247 LFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILI---IGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFL----DAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRF--FES 1245
            LF++G  GN     V+ + + +R +T  YL+ +   D  I +   + L+R W  + + F       + C++FQF+  + +  +V  I  ++VER   I  PLR    V+  + KL+IL ++ +    +   F  V +   +N    + T E +          TE+A  + + T +      F +  LP+  + V+  +IG  ++   R RG+    +S                                L ++  +Q   ML VV   F++   P  + ++    + +   S       +  + +  +L Y + AIN +LY    KK+R  V +   FES
Sbjct:   52 LFVVGISGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGD-----LLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVE-HENGTDPRDTNECR---------ATEFAVRSGLLTVMVWVSSVFFF--LPVFCLTVLYSLIGRKLW---RRRGDAAVGSS--------------------------------LRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKS-FEPGSLEIAQISQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFKLLGFES 340          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1S8WXZ4 (7 transmembrane receptor OS=Opisthorchis viverrini OX=6198 GN=X801_04808 PE=4 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 9.916e-65
Identity = 152/450 (33.78%), Postives = 230/450 (51.11%), Query Frame = 1
Query:   46 DITEHSDLNYIQFILSLNDSMLQGMISYL--HLNEDPDAFRKD-IQNKIPGRLLVQCQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKT---LQMTTESK----NHSFLI-----------------CDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITK--LELVDTIFEMLMYTNHAINFLLYCASGKKFRYHV-------KRFFESICCGKNHDVTTHYN 1287
            D+    DLN ++ +  L   M+Q   S    + ++ PD   K  I  K PG  L  C+I+H +W   PPI+FLLG+LGNT AF VL       VS + YL   +  D+ +L +GLLRRW+D   G   EN   + C++ QF+G ++SL+SVWL V++T ER +V+  PL+ +  V+  K +  I+ L ++ + IS HFF TV L +R        ++M   S     +H FL                  C F    AT   +WT +DA +Y  LP  L+  +N+VI H +Y A + +  + +   +    +  +++N                          RQLTIML VVS +FL+TT  +V++K  I++   + S TS  TK   +L DT+ E+LMY NHA+NF L+CA+GK+FR  +       KR   +  C +  ++TT  N
Sbjct:    4 DVCSKIDLNVVKAVERLRQ-MMQAEDSTFVPNFSQTPDDLIKTVIMRKSPGVFLTTCKIYHFLWTFVPPIVFLLGSLGNTLAFLVLRHPATRHVSVFVYLTARSVVDEIVLTVGLLRRWIDYLVGTKLENTSAIFCKLAQFLGTSSSLLSVWLTVLLTAERALVVTFPLQGNRLVTFAKVRRAIIFLSVVCVAISMHFFFTVDLVQRNAENCVLRVEMNGSSPLDEGSHEFLFNITSLKGKSSKSVCDGHCSFPDGMATMRWLWTTVDAIIYCYLPFCLIFSLNIVILHYVYAAHKDQYGIRAQPERLKSGSLGVDNN-------------------------IRQLTIMLQVVSFSFLVTTVSIVVMKTLIQVPAMK-SVTSVQTKAAFQLADTVAELLMYINHAMNFYLFCATGKRFRSRLVFLLMKCKRQTCAWFCVQQQEITTACN 426          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: H2KNW0 (G-protein coupled receptor OS=Clonorchis sinensis OX=79923 GN=CLF_100861 PE=4 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 1.494e-64
Identity = 149/448 (33.26%), Postives = 229/448 (51.12%), Query Frame = 1
Query:   46 DITEHSDLNYIQFILSLNDSMLQGMISYL-HLNEDPDAFRKD-IQNKIPGRLLVQCQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVT---LNRRKNSKTLQMTTES----KNHSFLI-----------------CDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRN-SSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHV-------KRFFESICCGKNHDVTTHYN 1287
            D+    DLN ++    L   M     +++ +L++ PD   K  I  K PG  L  C+I H +W   PPI+FLLG+LGNT AF VL       VS + YL   +  D+ +LI+GLLRRW+D   G   EN   + C++ QF+G ++SL+SVWL V++T ER +V+  PL+ +  V+  K +  I+ L ++ + IS HFF TV    LN       ++M   S     +H FL+                 C F  E AT   +WT +DA +Y  LP  L+  +N+VI H +Y A + +  + +   +    +  +++N                          RQLTIML VVS +FL+TT  +V++K  I++   ++ +S       +L DT+ E+LMY NHA+NF L+CA+GK+FR  +       KR   +  C +  ++TT  N
Sbjct:    4 DVCSKIDLNVVKAAERLRQIMQAEDGNFVPNLSQTPDDLIKTVIMRKSPGVFLTTCKIHHFLWTFVPPIVFLLGSLGNTLAFLVLRHPATRHVSVFVYLTARSVVDEIVLIVGLLRRWIDYLVGTKLENTSAIFCKLAQFLGTSSSLLSVWLTVLLTAERALVVTFPLQGNRLVTFAKVRRAIVFLSVVCVAISMHFFFTVDLVHLNAENCVLRVEMNGSSMLDEGSHEFLLNITSLKGKSTKSVCDGHCSFPDEMATMRWLWTTVDAIIYCYLPFCLIFSLNIVILHYVYAAHKDQYGIRAQPERLKSGSLGVDNN-------------------------IRQLTIMLQVVSFSFLVTTVSIVVMKTLIQVPAMKSVTSVQNKAAFQLADTVAELLMYINHAMNFYLFCATGKRFRSRLVFLLMKCKRQTCAWFCVQQQEITTACN 426          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A4S2KQC3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010711 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 4.960e-62
Identity = 145/420 (34.52%), Postives = 215/420 (51.19%), Query Frame = 1
Query:   46 DITEHSDLNYIQFILSLNDSMLQGMISYL--HLNEDPDAFRKD-IQNKIPGRLLVQCQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVT---LNRRKNSKTLQMTTES----KNHSFLI-----------------CDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITK--LELVDTIFEMLMYTNHAINFLLYCASGKKFR 1218
            D+    DLN ++ +  L   MLQ   S      ++ PD   K  I  K PG  L  C+I H +W   PPI+FLLG+LGNT AF VL       VS + YL   +  D+ +L +GLLRRW+D   G   EN   + C++ QF+G ++SL+SVWL V++T ER +V+  PL+ +  V+  K +  I+ L ++ + +S HFF TV    LN       ++M   S     +H FL                  C F    AT   +WT +DA +Y  LP  L+  +N+VI H +Y A + +  + +   +    +  +++N                          RQLTIML VVS +FL+TT  +V++K   ++   + S TS  TK   +L DT+ E+LMY NHA+NF L+CA+GK+FR
Sbjct:    4 DVCSKIDLNVVKAVERLRQ-MLQAEDSTFVPSFSQTPDDLIKTVIMRKSPGVFLTTCKIHHFLWTFVPPIVFLLGSLGNTLAFLVLRHPATRHVSVFVYLTARSVVDEIVLTVGLLRRWIDYLVGTKLENTSAIFCKLAQFLGTSSSLLSVWLTVLLTAERALVVTFPLQGNRLVTFAKVRRAIVFLSVVCVAVSMHFFFTVDLVHLNAENCVLRVEMNGSSMLDDGSHEFLFNITSLKGKSAKSVCDGHCSFPDGMATMRWLWTTVDAIIYCYLPFCLIFSLNIVILHYVYAAHKDQYGIRAQPERLKSGSLGVDNN-------------------------IRQLTIMLQVVSFSFLVTTVSIVVMKTLTQVPAMK-SVTSVQTKAAFQLADTVAELLMYINHAMNFYLFCATGKRFR 396          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A2T7NJU4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19599 PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 2.139e-58
Identity = 132/353 (37.39%), Postives = 194/353 (54.96%), Query Frame = 1
Query:  238 PPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFA-KIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFESICCGKNHDVTTHYNRI 1293
            PP+L +LGT GN  +F VL +R + +VS+Y YLA L   D  +L IGLLR W+D+  G + ++N    C+V  F+G   S +SVWLI+ VTVER IV+  PLR  +  +  + KL+I+ +  +   ++ HFF TV L  R         T+S N    IC+    Y      +W ++DA +YS LP V+++V NV+I   + +A   R  + +M      + K +    ST TG  I G   R  A    + E  +LT+MLL VS TFL+TT P+ +          +N     I +L+L  TI E+LMY NH+INF LYCA+G+KFR  +      +CC K  + +T +N +
Sbjct:   27 PPVLIILGTFGNVVSFIVLRRRAMSKVSSYLYLASLAIADSLVLYIGLLRLWLDELTGVNFQDNSEWLCKVTMFLGYLASDLSVWLIIAVTVERYIVVCFPLRAFTMCNTNRAKLVIIFIVFLICCMNMHFFWTVGLVER--------ATDSDN--ITICEAAPAYNHLVDDVWPWVDACVYSFLPFVIILVCNVLIITEVVEARAHRLNLQNMPDYHYHQQKQLQHRTST-TGTAISG-CRRSCA----SGEGTKLTVMLLTVSFTFLLTTLPMNISLIVTAFWEQQNHGIRQIAQLKLAKTIAELLMYVNHSINFFLYCATGQKFRQQIAHL---MCCRK--ETSTSWNSM 358          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A2H1CXP9 (7 transmembrane receptor OS=Fasciola hepatica OX=6192 GN=D915_000019 PE=4 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 3.831e-55
Identity = 124/363 (34.16%), Postives = 190/363 (52.34%), Query Frame = 1
Query:  205 CQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTL--------------------NR---RKNSKTLQMTT-ESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIK-LNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFR 1218
            C  +  +W   PPI+ LLG+ GN  +F VL       VS + YL V +  D+ +LI+GLLRRW+D       E+     C+V QF GV++S +SVWL V +T ER +V+  PL    +++  + + +I +L +I + +S+HFF TV L                    NR   R+N    +++T +  +     C+FK E+A  A +WT +DA +Y  LP +L+  +NVVI H    A            K+  + +  +S  S +   +   F+  Q          RQ+TIMLLV+S  FLITT  +V+ K   + L+L  +S        +L D++ E+LMY NHA+NF L+CA+GK+FR
Sbjct:   62 CSAYRFLWTFIPPIIILLGSFGNILSFLVLRHPSTRYVSAFVYLTVRSVVDEVVLIVGLLRRWIDYLINHKLEDTSSTLCKVAQFAGVSSSFLSVWLTVTLTAERALVVSFPLHGTRFITYSRVRRLIFTLTVICVLLSTHFFVTVDLIPIPGSNKAKKEHTYSEPWANRTVLRRNYSQHELSTIKPTSEQVYRCNFKPEFAALAWLWTTMDAVIYCYLPFILIFGLNVVIVHHANAAQ-----------KEQHRIRVRHSTTSKQQLGKTPSFSREQV------NNVRQMTIMLLVISFAFLITTLAIVVTKILSQVLDLSGSSRRLQRLNFQLADSVAELLMYINHAMNFYLFCATGKRFR 407          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: trhrb (thyrotropin-releasing hormone receptor-like [Source:NCBI gene;Acc:103029490])

HSP 1 Score: 76.6406 bits (187), Expect = 6.707e-15
Identity = 89/340 (26.18%), Postives = 139/340 (40.88%), Query Frame = 1
Query:  256 LGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWL------VCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTP---LVLLKFFIKLNLYRNSSTSYITKLELVDTIFEML----MYTNHAINFLLYCASGKKFRYHVKRF 1236
            LG +GN     V++  K +R  T  YL  L   D  +L+   L    D  +G     +WL      +C   FQ++G+  S  S   I   TVER I I  P+R  S  +  + K IIL +++ T      +F    +         ++  E  + + + C +K     +  I+ F D  ++  LPL L  V+  +I   ++                L KTKS N +    +GN+  G               RQ+T ML VV   F +   P   LV++  F++         +Y+      DT F +     +Y N AIN ++Y A  +KFR   KR 
Sbjct:   35 LGIVGNVMVILVVLTTKHMRTPTNCYLVSLAAADLMVLVAAGLPSVADSLYG-----SWLFGRVGCLCITYFQYLGINASSCS---ITAFTVERYIAICHPIRAQSLCTYTRAKRIILGVWVTTSLYCVMWFYLADIE--------ELVYE--DATIVSCAYKVSRNLYLPIY-FFDFGVFFVLPLTLSTVLYGLIARILFL-------------NPLPKTKSKNGHDGVYSGNKTNGLKSSSQCSSTTAASRRQVTKMLAVVVILFAVLWMPYRTLVVVNSFLQ--------EAYL------DTWFLLFCRTCVYLNSAINPVIYNAMSQKFRAAFKRL 328          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: TRHR (thyrotropin-releasing hormone receptor [Source:NCBI gene;Acc:103040459])

HSP 1 Score: 63.1586 bits (152), Expect = 1.880e-10
Identity = 94/354 (26.55%), Postives = 146/354 (41.24%), Query Frame = 1
Query:  244 ILFL--LGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLV----CCQV--FQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIF----EMLMYTNHAINFLLYCASGKKFRYHVKRFFESIC-CGKNH 1266
            +LF+  LG +GN     V++  K +R  T  YL  L   D  +L    L    D  F       W+     C  +   Q++G+  S  S   I   TVER I I  P+R  S  ++ + K II  ++  T      +F    L ++ +           N + +IC +K     +  I+ F D  L+  LPL+L  V+  +I   +             NSK  R  KS N++ ST+   +   ++    +        RQ+T ML VV   F +   P    +  + +N       S++ K  L DT F     + +Y N AIN ++Y A  +KFR      F  +C CG  H
Sbjct:   37 VLFVCGLGIIGNAMVILVVLTTKHMRTPTNCYLVSLAVADLMVLTAAGLPNITDSLF-----EQWVYGYAGCLSITYLQYVGINASSCS---ITAFTVERYIAICHPIRAQSLCTLSRAKKIIALVWTFTGLYCVMWFCLADLEQQTHG----------NTTVVICAYKVSRTQYLPIY-FTDFALFYVLPLLLATVLYGLIARILILNPLPSDP--KENSKAWR--KSTNTSSSTQRAAKSSSYSTTATS-------RRQVTKMLAVVVILFALLWMP---YRTLVVVN-------SFLEKPYL-DTWFVLFCRICIYLNSAINPVIYNAMSQKFR----AAFRKLCHCGPQH 345          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ghsrb (growth hormone secretagogue receptor [Source:NCBI gene;Acc:103029199])

HSP 1 Score: 59.3066 bits (142), Expect = 3.246e-9
Identity = 80/343 (23.32%), Postives = 139/343 (40.52%), Query Frame = 1
Query:  244 ILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILI---IGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFL----DAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSS---TSYITKL-ELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFF 1239
            +LFL+G  GN     V+ + K +R +T  YL  +   D  I +   + L R W  + +    E      C++FQF+    +  ++  I  ++VER   I  PLR    V+  + K +I  L+ + +  +   F  V +     ++  + T E K          TE A  + + T +      F +  LP++ + V+  +IG  +++  R    +  ++S+D                                 +  +Q   ML VV   F+     L  L F +   L+  SS   +  IT++ E  + I  +L Y + AIN +LY    KK+R    R F
Sbjct:   43 LLFLVGIAGNLLTILVVTKYKDMRTTTNLYLCSMALSDLLIFLCMPLDLYRVWRYRPWNLGDE-----LCKLFQFVSECCTYSAILSITALSVERYFAICFPLRAKVLVTRGRVKGVIALLWTVALCSAGPIFVLVGVEHENGTEPWE-TNECK---------ATERAIQSGLLTLMVWVSSVFFF--LPVLCLTVLYSLIGRTLWK--RKENPVGPVSSRD---------------------------------KSNKQTVKMLAVVVLAFV-----LCWLPFHVGRYLFSKSSELNSPLITQISEYCNLISFVLFYFSAAINPILYNIMSKKYRVAACRLF 328          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: nmur3 (neuromedin-U receptor 2-like [Source:NCBI gene;Acc:103035443])

HSP 1 Score: 56.9954 bits (136), Expect = 2.167e-8
Identity = 84/380 (22.11%), Postives = 154/380 (40.53%), Query Frame = 1
Query:  244 ILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGL----LRRWVDKTFGFSSENNWLVCC-QVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYAT---FAKIWTF-----LDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMN-SKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPL---VLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFESICCGKNHDVTTH-----YNRITFIPHDQS 1317
            ++F+ G LGN     V+++ + +R  T  YL  L   D  +L+ G+       W +  F F       VCC +VF F  V     SV  + V++VER + +  PL+    ++ K  + +I  ++I+++  +                 +  T+    H + + +   E AT       W +     +   L+  +P++++  + +VIG  + +  + +G  +  N S D+ +   + S +                         RQ+T ML VV   F I   P     LL  FI     R  S       E V  +  +L Y + A+N ++Y     +FR   +RF E +C   + + + +     Y R ++ P D +
Sbjct:   65 LIFITGVLGNLLTCIVIIKHRKMRTPTNLYLFSLAVSDLLVLLFGMPLEIYELWQNYPFPFGES----VCCFKVFLFETVC--FASVLNVTVLSVERYVAVVHPLKTRYALTNKHAQKMIGGVWIVSLVCA-----------------VPNTSLHGIHYYYLPEKVLESATCNLLKPQWIYNLVIQVTTVLFYFVPMMVICGLYLVIGMKLGREQKQQGRKLGRNCSADVSRRVQVESGRR------------------------RQVTKMLAVVVLVFAICWAPFHTDRLLWSFITQWTDRMYSV-----FEYVHILSGVLFYLSSAVNPIIYNLLSSRFR---ERFLELMCARGDGNTSRNSSPPSYKRTSY-PKDPT 388          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000035261.1 (probable G-protein coupled receptor 139 [Source:NCBI gene;Acc:111191700])

HSP 1 Score: 50.447 bits (119), Expect = 2.270e-6
Identity = 74/367 (20.16%), Postives = 152/367 (41.42%), Query Frame = 1
Query:  229 KAFPPILFLLGTLGNTTAFCVLVQRKL-IRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGF-SSENNWLV--CCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIIT--MTISSHFFETVT-LNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSS---TSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFESICC-GKNHDVTTHYNRIT 1296
            K + P+L +LG   N   F ++  R   +  S   YL+ L   D   L+  +L   +D    F  S+  W     C +   +   T   S W++V  T+ER +V++  +     +  +   L   ++ +++   +I + +   V  +N   N + + M           C ++    +   +W  + +FL S +P++L+I+ N +I + +  + R       + +K+ R+T           G++  G               R+  ++L  +S  F++ T P   + + I   +Y +       Y   + +V  +  ML   N + NFLLYC   ++FR   +    ++ C  K  ++ +++   T
Sbjct:   12 KVYYPLLCILGIPANLFTFYMIRFRTCGMSDSARIYLSCLALVDTCYLVWVIL---LDLCLTFLQSQPFWHYHPWCGIMNILQFGTFYCSAWVVVAFTIERFLVLRATVSCQRPLHARHALLTCTTIILLSHLASIPAGWINVVAQVNLTLNGQVVSMPR---------CIYREALYSTVVVW--ITSFLSSGVPIMLVIIFNSLIAYHLLCSSR-------LFTKEERRTIQ---------GSKTRG-------------SIRRTLLLLGTISVAFVVLTLPR-FVTYCILRTIYNHKDFDRDDYEMPINIVSDVANMLHNLNSSTNFLLYCMVSRRFR---QELLNTLTCRAKARELGSYFTHTT 331          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: trhrb (thyrotropin-releasing hormone receptor b [Source:ZFIN;Acc:ZDB-GENE-060503-382])

HSP 1 Score: 54.6842 bits (130), Expect = 1.956e-8
Identity = 80/335 (23.88%), Postives = 129/335 (38.51%), Query Frame = 1
Query:  259 GTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQV--FQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIY----QADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTP---LVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRF 1236
            G +GN     V+V+ K +R  T YYL  L   D  +L+   L   V  +   S    +  C  +   Q++G+  S  S   I   T+ER + I  P+R  S  ++ + K I+  ++  T      +F  V ++ R          E    +   C ++     +  I+ F D   +  LPLVL  V+  +I   +      A R+        S  L    S       R G   Y                +Q+T ML VV   F +   P   LV++  F+        S+ Y     L+     + +Y N AIN ++Y A  +KFR   ++ 
Sbjct:   46 GIVGNVMIVLVVVRTKHMRTPTNYYLGSLAIADLLVLLAAGLPN-VSDSLAESWVYGYAGCLAITYLQYLGINVSSCS---ITAFTLERYLAICHPIRAQSLCTVSRAKRILALVWSSTAIYCLVWFFLVDVHPRSQGGG---GGEDPRSNVTECGYRVSRNLYLPIY-FFDFAAFYVLPLVLACVLYALIARVLLLPPPPASRTLAAPAVPLSLPLAAVCSGAVPSVNRRGKSAYS-------------SRKQVTKMLAVVVLLFAVLWLPYRMLVVVNSFV--------SSPYHDAWFLL--FCRLCLYANSAINPVVYNAMSQKFRAAFRKL 349          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: mlnr (motilin receptor [Source:ZFIN;Acc:ZDB-GENE-130530-1015])

HSP 1 Score: 53.5286 bits (127), Expect = 4.295e-8
Identity = 36/159 (22.64%), Postives = 72/159 (45.28%), Query Frame = 1
Query:  244 ILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQ---SILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFL 711
            +LF  G LGN+    V  +   +R +TY YL+ +   D    S +   L R W  + + F         C+ FQ++  + +  ++  I  ++VER + I  PL     ++ ++ + +IL L+ + +  +      V++   K     ++T E++    L
Sbjct:   52 LLFAFGVLGNSMTIAVFSRTHEMRTTTYLYLSSMAVSDLLIFSCMPFDLYRLWRYRPWLFGD-----FLCRCFQYVSESCTYATILHITALSVERYLAICFPLWAKVAITRRRVRALILGLWALALGSAGPVISIVSVQVEKREPVCKVTDEARKSGRL 205          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO44374 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW17])

HSP 1 Score: 51.2174 bits (121), Expect = 8.097e-7
Identity = 33/107 (30.84%), Postives = 58/107 (54.21%), Query Frame = 1
Query:  232 AFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWL--VCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLR 546
            +F  ++F +GT+GN   F  +++   +R +T YY+  L+  D  +  I +  R V   +    +++ L  +   V  FIG AT L S   + +++V+RLI +K PLR
Sbjct:   23 SFEVVIFFMGTIGNLLPFIAVMRNPRLRFATNYYVVSLSVADLLVTAILVPVRAVQHLWSSLGKSHQLPKILLDVVVFIGRATILASFANLALMSVDRLIALKFPLR 129          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042752.1 (pep primary_assembly:ASM223467v1:24:10229220:10232247:1 gene:ENSORLG00000028764.1 transcript:ENSORLT00000042752.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 4.736e-9
Identity = 77/348 (22.13%), Postives = 142/348 (40.80%), Query Frame = 1
Query:  211 IFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKL-IRVSTYYYLAVLTCFDQSILIIGLLRR-----WVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQL---TIMLL-VVSCTFLITTTPLVLLKFFIKLNLYRNS--STSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFR 1218
            +F  + + + P L ++G   N   F ++  R   +  +   YL+ L   D   LI  +L       W+ + F  S    W   C +  F+   +   S W++VV T+ER +V+K             TKL  +++ +++  +S      V +      K + +T + +N +   C ++    + A +W  + +FL   +P+VL+I+ N +IG+ + +A                      SN  T+   R+           +  R TR +   TI LL  +S  F++ + P  +    ++      S     Y   + +   +  ML   N + NFLLYC    +FR
Sbjct:    8 VFITVQRIYYPFLCIMGIPANLFTFYMIYFRNCGMSNAAVVYLSSLAIADTFYLIWVILLDLTLTFWILQPFWHSQP--W---CGILGFLQHGSLCSSSWIVVVFTIERYLVLKSSTVKQRLSEAGVTKLTCMAIVVLSHLVS------VPMGWINTVKLVNLTVDGENMTLPRCLYREHTYSTAVVW--IASFLSGGIPIVLVILFNYLIGYNLCRA----------------------SNLFTKEEQRV-----------MHGRSTRGMLKRTIFLLGTISVVFVVLSLPRFVTYCILRTKHNDESFDRNDYSIPINVAGDVANMLHNLNSSTNFLLYCVVSHRFR 309          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: trhr2 (TRHR2 protein [Source:NCBI gene;Acc:100533510])

HSP 1 Score: 57.7658 bits (138), Expect = 1.078e-8
Identity = 78/338 (23.08%), Postives = 138/338 (40.83%), Query Frame = 1
Query:  256 LGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLV----CCQV--FQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTP---LVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFE 1242
            +G +GN     V+   + +R  T  YL  L   D ++L+   L    D   G      W+     C  +   Q++G+  S  S   I   TVER I I  P++  +  ++ + K II  ++I T      +   V +             +      + C ++ +   +  I+  +D  ++  +PL+L IV+  +I   +Y +        S  +  LR++   +++++ R G        RQ  P       +Q+T ML VV   F +   P   LVL+  F+        ST Y+    L+       +Y N AIN ++Y A  +KFR   +  + 
Sbjct:   43 VGIIGNVMVVLVVFTTRHMRTPTNCYLVSLAIADLTVLVAAGLPNVSDSLTG-----TWIFGQAGCLGITYLQYLGINVSSCS---ITAFTVERYIAICHPMKAQTVCTVSRAKRIIAGVWIFTCVYCMLWLFLVDI-------------QVGPDGHVQCGYRVKRELYLPIY-LIDFAIFYVIPLLLAIVLYALIARILYLSPLPHQPDTSATT--LRRSCR-DTSEAARPG--------RQGRPKSALSSRKQVTKMLAVVVILFALLWMPYRTLVLINSFV--------STPYLNAWFLL--FCRTCIYANSAINPVIYNAMSQKFRLAFRGLYS 337          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: trhr2 (TRHR2 protein [Source:NCBI gene;Acc:100533510])

HSP 1 Score: 56.6102 bits (135), Expect = 1.987e-8
Identity = 78/338 (23.08%), Postives = 138/338 (40.83%), Query Frame = 1
Query:  256 LGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLV----CCQV--FQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTP---LVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFE 1242
            +G +GN     V+   + +R  T  YL  L   D ++L+   L    D   G      W+     C  +   Q++G+  S  S   I   TVER I I  P++  +  ++ + K II  ++I T      +   V +             +      + C ++ +   +  I+  +D  ++  +PL+L IV+  +I   +Y +        S  +  LR++   +++++ R G        RQ  P       +Q+T ML VV   F +   P   LVL+  F+        ST Y+    L+       +Y N AIN ++Y A  +KFR   +  + 
Sbjct:   35 VGIIGNVMVVLVVFTTRHMRTPTNCYLVSLAIADLTVLVAAGLPNVSDSLTG-----TWIFGQAGCLGITYLQYLGINVSSCS---ITAFTVERYIAICHPMKAQTVCTVSRAKRIIAGVWIFTCVYCMLWLFLVDI-------------QVGPDGHVQCGYRVKRELYLPIY-LIDFAIFYVIPLLLAIVLYALIARILYLSPLPHQPDTSATT--LRRSCR-DTSEAARPG--------RQGRPKSALSSRKQVTKMLAVVVILFALLWMPYRTLVLINSFV--------STPYLNAWFLL--FCRTCIYANSAINPVIYNAMSQKFRLAFRGLYS 329          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: trhr1b (TRHR1b protein [Source:NCBI gene;Acc:100533509])

HSP 1 Score: 56.225 bits (134), Expect = 3.311e-8
Identity = 87/348 (25.00%), Postives = 143/348 (41.09%), Query Frame = 1
Query:  259 GTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWL------VCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTP---LVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFESIC-CG-KNHD 1269
            G +GN     V++  K +R  T  YL  L   D  +L    L    D  F       W+      +C   FQ++G+  S  S   I   T+ER I I  P++     ++ + K IIL ++  T      +F          S   ++  E  N + + C ++     +  ++ F D  ++  LPL+L  V+  +I   ++        +  + S+   K KS  +N  T   N       R ++    +R  RQ+T ML VV   F +   P   LV++  F+          +Y+    L+     + +Y N AIN ++Y A  +KFR      F+ IC CG K  D
Sbjct:   39 GIVGNIMVILVVLTTKHMRTPTNCYLVSLAVADLMVLTAAGLPAITDSIFA-----TWVFGRYGCLCITYFQYLGINASSCS---ITAFTIERYIAICHPIKAQFLCTLSRAKKIILFVWAFTSIYCVMWFYL--------SDIQELVYE--NITIITCGYRVPRKFYLPVY-FFDFGVFFVLPLLLSAVLYGLIARILF--------LNPLPSEHKAKKKSGANNPKTSCKNS------RHSSSTATSR--RQVTKMLAVVVILFAVLWMPYRTLVVVNSFLD--------QAYLDSWFLL--FCRICIYLNSAINPVIYNAMSQKFR----AAFQKICHCGMKGSD 337          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: ghsrb (growth hormone secretagogue receptor type 1 [Source:NCBI gene;Acc:101167158])

HSP 1 Score: 50.8322 bits (120), Expect = 1.601e-6
Identity = 34/140 (24.29%), Postives = 68/140 (48.57%), Query Frame = 1
Query:  244 ILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILI---IGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNR 654
            +LFL+G  GN     V+ + + +R +T  YL  +   D  I +   + L R W  + +           C++FQF+  + +  ++  I  ++VER + I  PLR  + V+ ++ + +I  L+ +++  +   F  V + R
Sbjct:   76 LLFLVGVTGNVMTILVVGRYRDMRTTTNLYLCSMAVSDLLIFLCMPLDLYRMWRYRPWRLGD-----ALCKLFQFVSESCTYSTILSITALSVERYLAICFPLRAKALVTKRRVRALICFLWTVSLLSAGPVFVMVGVER 210          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000063133.1 (SMESG000063133.1)

HSP 1 Score: 894.034 bits (2309), Expect = 0.000e+0
Identity = 435/435 (100.00%), Postives = 435/435 (100.00%), Query Frame = 1
Query:   19 DPDPMSFQCDITEHSDLNYIQFILSLNDSMLQGMISYLHLNEDPDAFRKDIQNKIPGRLLVQCQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFESICCGKNHDVTTHYNRITFIPHDQSII 1323
            DPDPMSFQCDITEHSDLNYIQFILSLNDSMLQGMISYLHLNEDPDAFRKDIQNKIPGRLLVQCQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFESICCGKNHDVTTHYNRITFIPHDQSII
Sbjct:  122 DPDPMSFQCDITEHSDLNYIQFILSLNDSMLQGMISYLHLNEDPDAFRKDIQNKIPGRLLVQCQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFESICCGKNHDVTTHYNRITFIPHDQSII 556          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000042142.1 (SMESG000042142.1)

HSP 1 Score: 277.715 bits (709), Expect = 1.703e-88
Identity = 168/404 (41.58%), Postives = 236/404 (58.42%), Query Frame = 1
Query:   31 MSFQCDITEHSDLNYIQFILSLNDSMLQGMISYLHL--NEDPDAFRKDIQN----KIPGRLLVQCQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLN--RRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFR 1218
            M+  C   +H        +LSLNDSML    S  +L  +E P A+R+ + N    KIPG+L+ +C   + +W   P  +  +G++GN  +  VL ++ +  +S+Y YLA L  FD+ IL+ GL R+W++    +S EN+ +  C++FQ IGV++S +SVWLIV +TVER+++IK P     Y    + K II+SL II+ T S HFFETVTL     KN  T   +++  ++S   C FKTEY  F   W F+D   YS +PL L+I+ N++I   IY+A      MI+ N  +         NK+  T         R       NRET+QLT+MLL+VS +FLITT+P V+LK  IKL  Y N     + +L L+D IFEMLMY NHAINF LYCA+G KFR
Sbjct:    1 MAGLCSELDHPMAETFMHLLSLNDSMLINYDSRFNLTMSELP-AYRRRLFNILVKKIPGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEASKYAKASRAKYIIVSLIIISFTTSCHFFETVTLQNLNHKNVNT-NFSSDKGSNSIKKCQFKTEYTKFTNAWFFIDGAFYSWIPLFLLIINNLIILSEIYKARNIHNSMINTNHDE---------NKTLGTSIVRTQLPRRMKESSSRNRETKQLTVMLLIVSFSFLITTSPFVILKLLIKLKGYPNGDRK-LAQLVLLDGIFEMLMYVNHAINFYLYCATGNKFR 392          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000053893.1 (SMESG000053893.1)

HSP 1 Score: 270.781 bits (691), Expect = 2.401e-86
Identity = 172/422 (40.76%), Postives = 241/422 (57.11%), Query Frame = 1
Query:   43 CDITEHSDLNYIQFILSLNDSMLQGMISYLHLNEDPDAFRKDIQNK--------IPGRLLVQCQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFR-------YHVKRFFESICCGKN 1263
            C ITEH D   I ++L LNDS LQ  ++  H NE  +   ++I+NK        IPG  L+ C I + +W   PP + L GT GN  AF V+ QR L++ S+Y YLA +   D+ IL+ GLLRRW D   G   E++    C++FQFIGV  S  SVWLIV +TVERLI+IKLPL+V+  VS  K K+ I+ L      +SSHFFETV+LN + NS +  +TT         C+FK +Y  F + W   +A  YS +P +L+I+ N +I    Y+A ++R  ++       R+ +SI+ N+     N               N ET+QLT+ML+ +S  FL TTTPLV  K  +K+ +       Y+   +L+DTIFE+LMY NH+INF +YCASG++FR       +H K  F S+   KN
Sbjct:    5 CQITEHPDTQPILYLLKLNDSNLQWQVNTFH-NESQNLNIREIRNKLEQLLVEKIPGSKLLHCVILNNLWTFLPPFILLFGTFGNILAFFVICQRHLLKTSSYVYLAAIAIIDELILLTGLLRRWSDHLVGSRIEDSNKFSCKIFQFIGVTVSFSSVWLIVFMTVERLIIIKLPLKVNRLVSPNKVKVYIVILIFCLSLLSSHFFETVSLNNQNNSNSNLVTTP-----LYRCNFKDKYYHFIRYWMMFEALFYSIIPFILLIIFNGIILSLTYKASKTRSTLVK-QCYMTRQFQSISHNRQKVVTN-----------VSQLNHETKQLTVMLVTISVAFLCTTTPLVTYKLILKV-INNTDDVRYLAIRQLMDTIFELLMYINHSINFYIYCASGRRFRTQLWKIFHHNKPGFTSVSFAKN 407          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000061235.1 (SMESG000061235.1)

HSP 1 Score: 232.646 bits (592), Expect = 1.388e-71
Identity = 139/358 (38.83%), Postives = 208/358 (58.10%), Query Frame = 1
Query:  157 FRKDIQNKIPGRLLVQCQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKLNLYRNSSTSYITK-LELVDTIFEMLMYTNHAINFLLYCASGKKFRYHV 1227
             ++ +  +IPG+LL  C+++H+ W   PPI+ L+G++GN  A  VL    + + S+Y YLAV+   D+ IL+ GLLRR++   F    EN  ++ C++ QFIGV++SL+SVWLIVV+T+ER+I+I LPLR       K  + +I S  I +  ++SHFF TV  +  K     Q    +  H F  C  K ++  F ++WT LDA LYS +P  ++I +NV+I   I ++  +R   I MN+ +   +KSI    +                      +T  L++ L+ VS  FLITTTPLV+ K  I    +R+    Y +  ++ +D IFEMLMYTNH+INFLLYCA+G +FR HV
Sbjct:   48 LKETLMKEIPGKLLYSCRLYHIFWTVIPPIILLIGSIGNVLACIVLCCYLIDKCSSYIYLAVMVIVDEMILVTGLLRRYIGYIFIKHIENESVLFCRLTQFIGVSSSLVSVWLIVVMTIERVIIIYLPLRAKQITQKKIARAVISSTIICSSLVASHFFFTVDTHVTK-----QFNKTNLIH-FGECTAKPQFHYFYRVWTILDASLYSLIPFCVLISLNVLIVREILRSKNNRS--ILMNNFNQACSKSIKKVST----------------------DTHHLSVTLIAVSFIFLITTTPLVVHKLLIH---FRDKDEVYHSGIIQFLDVIFEMLMYTNHSINFLLYCATGNRFRQHV 372          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000020718.1 (SMESG000020718.1)

HSP 1 Score: 204.912 bits (520), Expect = 1.173e-60
Identity = 139/415 (33.49%), Postives = 209/415 (50.36%), Query Frame = 1
Query:   70 NYIQFILSLNDSMLQGMISYLHLN----EDPDAFRKDIQ-----------NKIPGRLLVQCQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPLVLLKFFIKL---------NLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFRYHVKRFFE 1242
            N+I  I   N S L  ++ + +LN     +P+ + ++I+           N  P   L  C + + I    P I+   GT+GN  +F VL       VST+ YL++L   DQ +LI GLL+RWVD       EN     C + Q+ G + S++SVWLIV VT+ER IVI  P + H+ +   +  +I +S+  + M ++ HF  T+ L    NS  L    ES +++F +C F   Y  F  +W  +DA +YS LP + +  +NV+I   + QA R+R  M+++N    R  KS+  ++S                       TRQLTIMLL++S TFLITTTP+ ++K    +           +           +  D+I E+LM+ NHA+NF LYCASG KFR  +K  F 
Sbjct:   17 NWINQIDHQNKSNLIELLIFYNLNPNLISNPEIWSQEIEKVKLILQENVYNANPSEELSLCVLHNYILTIIPAIILFFGTIGNVMSFIVLCNFAGKTVSTFIYLSLLAIVDQFVLIFGLLKRWVDYLLKRKIENRNKTFCILSQYFGTSASVLSVWLIVAVTLERAIVISFPFKAHNLIQKSRAIVISISMASVIMILNCHFIFTLDLT---NSTQL---FESTDNNF-VCGFSESYRNFKTVWLLIDAIIYSFLPFIFIFALNVIILIKVCQARRTRQSMMTLN----RGQKSVYRSES-----------------------TRQLTIMLLMISGTFLITTTPIFIVKMLYVVPKAFSKAIPKTFHAPGIRDAVASQFADSIAEILMHLNHALNFYLYCASGNKFRACLKSLFS 397          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GHSR2.238e-821.26growth hormone secretagogue receptor [Source:HGNC ... [more]
GHSR1.513e-722.57growth hormone secretagogue receptor [Source:HGNC ... [more]
TRHR3.921e-622.32thyrotropin releasing hormone receptor [Source:HGN... [more]
TRHR3.921e-622.32thyrotropin releasing hormone receptor [Source:HGN... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
K03H6.11.082e-722.61pep chromosome:WBcel235:IV:1523718:1526599:1 gene:... [more]
sprr-17.481e-723.44Sex Peptide Receptor (Drosophila) Related [Source... [more]
sprr-17.481e-723.44Sex Peptide Receptor (Drosophila) Related [Source... [more]
T10E10.31.329e-620.39pep chromosome:WBcel235:X:6311715:6314588:1 gene:W... [more]
H09F14.12.457e-621.86pep chromosome:WBcel235:V:10613738:10615511:-1 gen... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNMaR3.322e-2123.56gene:FBgn0053696 transcript:FBtr0091684[more]
Proc-R3.868e-726.63gene:FBgn0029723 transcript:FBtr0100552[more]
Proc-R3.868e-726.63gene:FBgn0029723 transcript:FBtr0070713[more]
Proc-R3.868e-726.63gene:FBgn0029723 transcript:FBtr0100551[more]
Proc-R3.868e-726.63gene:FBgn0029723 transcript:FBtr0070714[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trhrb6.939e-1225.00thyrotropin-releasing hormone receptor b [Source:Z... [more]
ghsra2.067e-1122.85growth hormone secretagogue receptor a [Source:ZFI... [more]
ghsrb2.301e-1122.94growth hormone secretagogue receptor b [Source:ZFI... [more]
trhra2.128e-723.33thyrotropin-releasing hormone receptor a [Source:Z... [more]
nmur32.888e-721.98neuromedin U receptor 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
GHSR1.328e-1021.89growth hormone secretagogue receptor [Source:NCBI ... [more]
kiaa1324l2.613e-723.35KIAA1324-like [Source:Xenbase;Acc:XB-GENE-5954588][more]
efr3b8.839e-720.16EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ghsr2.650e-822.22growth hormone secretagogue receptor [Source:MGI S... [more]
Trhr22.873e-723.64thyrotropin releasing hormone receptor 2 [Source:M... [more]
Nmur18.714e-722.09neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI... [more]
Nmur19.663e-722.55neuromedin U receptor 1 [Source:MGI Symbol;Acc:MGI... [more]
Trhr1.338e-621.83thyrotropin releasing hormone receptor [Source:MGI... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A5A4K9|GHSR_RABIT5.894e-922.16Growth hormone secretagogue receptor type 1 OS=Ory... [more]
sp|A5A4L1|GHSR_MUSPF4.064e-821.86Growth hormone secretagogue receptor type 1 OS=Mus... [more]
sp|Q92847|GHSR_HUMAN1.075e-721.26Growth hormone secretagogue receptor type 1 OS=Hom... [more]
sp|Q95254|GHSR_PIG1.562e-722.16Growth hormone secretagogue receptor type 1 OS=Sus... [more]
sp|Q99P50|GHSR_MOUSE1.854e-722.22Growth hormone secretagogue receptor type 1 OS=Mus... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8WXZ49.916e-6533.787 transmembrane receptor OS=Opisthorchis viverrini... [more]
H2KNW01.494e-6433.26G-protein coupled receptor OS=Clonorchis sinensis ... [more]
A0A4S2KQC34.960e-6234.52G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A2T7NJU42.139e-5837.39G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A2H1CXP93.831e-5534.167 transmembrane receptor OS=Fasciola hepatica OX=6... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trhrb6.707e-1526.18thyrotropin-releasing hormone receptor-like [Sourc... [more]
TRHR1.880e-1026.55thyrotropin-releasing hormone receptor [Source:NCB... [more]
ghsrb3.246e-923.32growth hormone secretagogue receptor [Source:NCBI ... [more]
nmur32.167e-822.11neuromedin-U receptor 2-like [Source:NCBI gene;Acc... [more]
ENSAMXT00000035261.12.270e-620.16probable G-protein coupled receptor 139 [Source:NC... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trhrb1.956e-823.88thyrotropin-releasing hormone receptor b [Source:Z... [more]
mlnr4.295e-822.64motilin receptor [Source:ZFIN;Acc:ZDB-GENE-130530-... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO443748.097e-730.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000042752.14.736e-922.13pep primary_assembly:ASM223467v1:24:10229220:10232... [more]
trhr21.078e-823.08TRHR2 protein [Source:NCBI gene;Acc:100533510][more]
trhr21.987e-823.08TRHR2 protein [Source:NCBI gene;Acc:100533510][more]
trhr1b3.311e-825.00TRHR1b protein [Source:NCBI gene;Acc:100533509][more]
ghsrb1.601e-624.29growth hormone secretagogue receptor type 1 [Sourc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063133.10.000e+0100.00SMESG000063133.1[more]
SMESG000042142.11.703e-8841.58SMESG000042142.1[more]
SMESG000053893.12.401e-8640.76SMESG000053893.1[more]
SMESG000061235.11.388e-7138.83SMESG000061235.1[more]
SMESG000020718.11.173e-6033.49SMESG000020718.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012338 ID=SMED30012338|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1372bp
ATTTATTTGTTATATTTAGATCCCGATCCAATGTCATTTCAATGTGATAT
TACTGAACATTCCGACTTGAATTACATCCAATTTATATTATCCTTGAACG
ATTCAATGTTGCAGGGTATGATTTCCTATCTTCATCTGAATGAAGATCCA
GACGCATTTCGAAAAGATATACAAAACAAAATCCCGGGTAGACTTCTAGT
TCAATGTCAAATATTCCATTTAATTTGGAAAGCTTTCCCTCCGATACTTT
TCTTGCTTGGAACATTAGGCAATACGACTGCCTTTTGTGTTCTCGTTCAA
CGAAAATTAATCCGAGTATCTACTTATTATTATCTCGCGGTTTTAACATG
CTTCGATCAGTCTATATTAATAATCGGGCTATTGCGACGGTGGGTTGATA
AAACCTTTGGGTTTTCCAGTGAAAATAATTGGCTCGTCTGCTGTCAGGTG
TTTCAGTTCATTGGAGTTGCGACAAGTTTAATGTCGGTTTGGTTAATCGT
TGTCGTGACAGTTGAACGATTAATCGTGATAAAGTTGCCACTTCGGGTAC
ATTCTTACGTCAGTATCAAGAAGACAAAACTTATTATCCTTTCTCTTTTC
ATTATAACCATGACAATTAGCAGCCATTTCTTTGAAACTGTAACGCTAAA
CCGTCGGAAAAATTCCAAAACTCTCCAAATGACAACGGAATCCAAAAACC
ATTCTTTTTTGATTTGTGATTTTAAAACGGAATATGCAACATTTGCAAAG
ATTTGGACATTTCTTGACGCTTTCCTCTACAGTTGTTTGCCGTTGGTTTT
GATGATTGTCATGAATGTCGTTATCGGACATGGAATCTATCAAGCTGATC
GAAGTCGAGGAGAAATGATATCAATGAATAGTAAGGATTTGAGAAAAACA
AAATCTATCAATTCAAACAAATCCACTAGAACCGGGAACCGAATTTATGG
CTTTACGCCCCGTCAAGCGGCCCCTCCATTACCCAACCGTGAAACTCGTC
AACTGACGATTATGTTGCTAGTTGTTTCATGTACATTTCTCATCACCACG
ACTCCATTAGTTTTGTTGAAATTCTTTATAAAATTGAATCTGTACCGCAA
TTCCAGTACCAGTTATATTACCAAACTGGAACTGGTGGACACGATATTCG
AAATGCTGATGTACACAAATCATGCTATAAACTTTCTCCTGTATTGCGCG
TCCGGTAAAAAGTTCCGATATCACGTCAAAAGGTTTTTCGAATCAATTTG
CTGTGGTAAAAATCATGATGTTACCACTCATTATAATCGCATAACATTTA
TTCCGCATGATCAGTCTATCATTTGAAAGGAAAATTTACTTTGTATTGTT
TATGTTTATGTATGTTTGTTTA
back to top

protein sequence of SMED30012338-orf-1

>SMED30012338-orf-1 ID=SMED30012338-orf-1|Name=SMED30012338-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=442bp
IYLLYLDPDPMSFQCDITEHSDLNYIQFILSLNDSMLQGMISYLHLNEDP
DAFRKDIQNKIPGRLLVQCQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQ
RKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQV
FQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLF
IITMTISSHFFETVTLNRRKNSKTLQMTTESKNHSFLICDFKTEYATFAK
IWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKT
KSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITT
TPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCA
SGKKFRYHVKRFFESICCGKNHDVTTHYNRITFIPHDQSII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 75..99
score: 19.98
coord: 155..177
score: 20.72
coord: 335..359
score: 19.96
coord: 380..406
score: 27.11
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 90..398
e-value: 2.9E-16
score: 59.6
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 68..426
e-value: 1.7E-47
score: 163.9
NoneNo IPR availablePANTHERPTHR46641FAMILY NOT NAMEDcoord: 70..425
NoneNo IPR availablePANTHERPTHR46641:SF12CNMAMIDE RECEPTORcoord: 70..425
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 81..406
e-value: 1.00849E-33
score: 126.208
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 70..422
NoneNo IPR availableTMHMMTMhelixcoord: 194..216
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 338..360
NoneNo IPR availableTMHMMTMhelixcoord: 82..99
NoneNo IPR availableTMHMMTMhelixcoord: 257..279
NoneNo IPR availableTMHMMTMhelixcoord: 380..402
NoneNo IPR availableTMHMMTMhelixcoord: 153..175
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 90..398
score: 26.249