Anoctamin

Overview
NameAnoctamin
Smed IDSMED30012337
Length (bp)2831
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Anoctamin (SMED30012337) t-SNE clustered cells

Violin plots show distribution of expression levels for Anoctamin (SMED30012337) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Anoctamin (SMED30012337) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Anoctamin (SMED30012337) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012337

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30012337h1SMcG0018946 SmedASXL_080948SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012337h1SMcG0018946 SmedASXL_002976SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012337h1SMcG0018946 SmedASXL_002166SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
non-ciliated neuronSMED30012337h1SMcG0018946 dd_Smed_v4_88494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012337h1SMcG0018946 Contig41850newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012337h1SMcG0018946 Contig41850uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30012337h1SMcG0018946 dd_Smed_v4_43159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012337h1SMcG0018946 dd_Smed_v4_43159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012337h1SMcG0018946 dd_Smed_v4_43159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30012337h1SMcG0018946 dd_Smed_v4_43159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012337h1SMcG0018946 dd_Smed_v4_43159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012337h1SMcG0018946 dd_Smed_v6_43159_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Anoctamin vs. Ensembl Human
Match: ANO4 (anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837])

HSP 1 Score: 543.117 bits (1398), Expect = 1.383e-178
Identity = 319/875 (36.46%), Postives = 521/875 (59.54%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPP------------LSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKF--KDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYE-KNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSW-------TLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITV--CRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            ID+++VY  S    +     +R+ FE+N+  +G+++ K   + +  + FV +  PW++L ++A+ M ++MP +  +   P            +S     +   P       L D+     Y + F   +   F +   E FF+ + RS I + IL R ++++ ++ +G++RL+  G Y AA+PLHEG +  K++++ + +++ R +LYE WA+   + +YQP++L+R+YFGEKI +YFAWLG YT  L P + +G+F F Y +    +                +S E+C    I   +MCP+CD+ C +  L +SC+++K+  +FDN  T+ F++ +++W +VFL+FWKR++  + + W+  D+EE E+  R  +E K  + +R+N I+G+ E +    DK  R + S   +FFMI VV++ + G+++ R++  S     ++ +I + +++ T+G A  ++ C I++LNVLY+ +A+ LT+ E PRT++E++++ TLKM++FQF N   S FYIA+F G F G PG+Y      WR EEC P+GCL++L +QM +I V KQ  NN ME+  P+I+  W     + +H                E  ++                    PQWEKD+ L   N   +FDEYLEM++Q+GF T+F AA PLAPL AL NNIIEIR+DAYK +T+WRRPLA +A+DIGIW+ IL+ I I+SV++NAF+I+ TS  +P+LVY Y Y   +         + GYVN +LSVF IS+F+  + P +    F    +  CRYRD+R+   S   Y  ++ +WHVLAARLAF+IV+EH+VF +  LI+++IP +   ++ R+ +EK L  ++M++AE E+L++
Sbjct:   84 IDYILVYRKSNPQTE-----KREVFERNIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIHNKETFFNNATRSRIVHHILQRIKYEEGKNKIGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQ--------------VSKEVCQATDI---IMCPVCDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPEPYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEH--------------GPERKIS-------------------FPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQK 903          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO4 (anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837])

HSP 1 Score: 543.502 bits (1399), Expect = 2.827e-178
Identity = 319/875 (36.46%), Postives = 521/875 (59.54%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPP------------LSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKF--KDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYE-KNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSW-------TLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITV--CRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            ID+++VY  S    +     +R+ FE+N+  +G+++ K   + +  + FV +  PW++L ++A+ M ++MP +  +   P            +S     +   P       L D+     Y + F   +   F +   E FF+ + RS I + IL R ++++ ++ +G++RL+  G Y AA+PLHEG +  K++++ + +++ R +LYE WA+   + +YQP++L+R+YFGEKI +YFAWLG YT  L P + +G+F F Y +    +                +S E+C    I   +MCP+CD+ C +  L +SC+++K+  +FDN  T+ F++ +++W +VFL+FWKR++  + + W+  D+EE E+  R  +E K  + +R+N I+G+ E +    DK  R + S   +FFMI VV++ + G+++ R++  S     ++ +I + +++ T+G A  ++ C I++LNVLY+ +A+ LT+ E PRT++E++++ TLKM++FQF N   S FYIA+F G F G PG+Y      WR EEC P+GCL++L +QM +I V KQ  NN ME+  P+I+  W     + +H                E  ++                    PQWEKD+ L   N   +FDEYLEM++Q+GF T+F AA PLAPL AL NNIIEIR+DAYK +T+WRRPLA +A+DIGIW+ IL+ I I+SV++NAF+I+ TS  +P+LVY Y Y   +         + GYVN +LSVF IS+F+  + P +    F    +  CRYRD+R+   S   Y  ++ +WHVLAARLAF+IV+EH+VF +  LI+++IP +   ++ R+ +EK L  ++M++AE E+L++
Sbjct:  119 IDYILVYRKSNPQTE-----KREVFERNIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIHNKETFFNNATRSRIVHHILQRIKYEEGKNKIGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHS--------------QVSKEVCQATDI---IMCPVCDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPEPYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEH--------------GPERKIS-------------------FPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQK 938          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO4 (anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837])

HSP 1 Score: 543.502 bits (1399), Expect = 2.149e-176
Identity = 319/875 (36.46%), Postives = 521/875 (59.54%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPP------------LSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKF--KDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYE-KNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSW-------TLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITV--CRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            ID+++VY  S    +     +R+ FE+N+  +G+++ K   + +  + FV +  PW++L ++A+ M ++MP +  +   P            +S     +   P       L D+     Y + F   +   F +   E FF+ + RS I + IL R ++++ ++ +G++RL+  G Y AA+PLHEG +  K++++ + +++ R +LYE WA+   + +YQP++L+R+YFGEKI +YFAWLG YT  L P + +G+F F Y +    +                +S E+C    I   +MCP+CD+ C +  L +SC+++K+  +FDN  T+ F++ +++W +VFL+FWKR++  + + W+  D+EE E+  R  +E K  + +R+N I+G+ E +    DK  R + S   +FFMI VV++ + G+++ R++  S     ++ +I + +++ T+G A  ++ C I++LNVLY+ +A+ LT+ E PRT++E++++ TLKM++FQF N   S FYIA+F G F G PG+Y      WR EEC P+GCL++L +QM +I V KQ  NN ME+  P+I+  W     + +H                E  ++                    PQWEKD+ L   N   +FDEYLEM++Q+GF T+F AA PLAPL AL NNIIEIR+DAYK +T+WRRPLA +A+DIGIW+ IL+ I I+SV++NAF+I+ TS  +P+LVY Y Y   +         + GYVN +LSVF IS+F+  + P +    F    +  CRYRD+R+   S   Y  ++ +WHVLAARLAF+IV+EH+VF +  LI+++IP +   ++ R+ +EK L  ++M++AE E+L++
Sbjct:  285 IDYILVYRKSNPQTE-----KREVFERNIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIHNKETFFNNATRSRIVHHILQRIKYEEGKNKIGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQ--------------VSKEVCQATDI---IMCPVCDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPEPYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEH--------------GPERKIS-------------------FPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQK 1104          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO6 (anoctamin 6 [Source:HGNC Symbol;Acc:HGNC:25240])

HSP 1 Score: 525.783 bits (1353), Expect = 3.146e-172
Identity = 342/908 (37.67%), Postives = 517/908 (56.94%), Query Frame = 1
Query:   10 QFPFREMEFQEFPNKQFQEPSS--FMD----IDFVIVYDIST---DNAKHLNQTRRKK---FEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQD--DVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINFITGEWE------WHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGS--YTKLLTSGLAA-----FMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRY------YYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            Q  FR  EF+EF  K    P S  F D    IDFV+VY+  +    N K  N+ +R+K   +E NL   G++L     V D  L FV +  PW++L  +A+ M +K+PLK   +K   S   +L  F   +  V +    P ++ + + F  ++   F +   + FF+ + RS I Y IL R ++  + +    GI+RL+ +G+Y AA+PLH+ KF+   ++ +  +ER +LY  WA PRS  + QP++LIRKY+GEKI IYFAWLG YT  L+  +++G+  F Y  +N  N               + S E+C+    G  +MCP CD  C +W L  +C  SK   IFD+  T++F++ + +W ++FL+FWKR+Q +L++ W+T + ++ E  R +YE  C    IN IT E E      W   ++  +      FF +  +I  V+ +I   + + I+ ++ L +    I G+    K LT   A       +    I+ILN +Y+ +A+ +T+FE PRTQT+Y+++LT+KM++FQF N+Y S FYIA+FKG F+G PG   Y+ G +R EECDP GCL+EL+ Q+ +I  GK I NNI E+ LP I       L    HR  G                                  K  P+WE+D+ L    +L +F EYLEM+IQ+GFVT+F A+ PLAPL AL NNI+EIR+DA+K+ T++RR +  +AQDIG W  I+Q I+I++VV+NA II++TS  +P+LVY +      Y +H S+T+ GY+N TLS+F +++F+  +   NP     N T CRYRDFR       EY  +I YWHV+AA+LAF+IV EHV++ +   I++ IP VS   K +I++EK L  KL+ +   + + +
Sbjct:   24 QHDFRTPEFEEFNGK----PDSLFFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLDDKLVFVKVHAPWEVLCTYAEIMHIKLPLKPNDLKNRSSAFGTLNWFT-KVLSVDESIIKPEQEFFTAPFEKNRMNDFYIVDRDAFFNPATRSRIVYFILSRVKYQVINNVSKFGINRLVNSGIYKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIYFAWLGYYTQMLLLAAVVGVACFLYGYLNQDN--------------CTWSKEVCHPDIGGKIIMCPQCDRLCPFWKLNITCESSKKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARPEYEARCTHVVINEITQEEERIPFTAWGKCIRITLCASAV-FFWILLIIASVIGIIVYRLSVFIVFSAKLPK---NINGTDPIQKYLTPQTATSITASIISFIIIMILNTIYEKVAIMITNFELPRTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPGGCLLELTTQLTIIMGGKAIWNNIQEVLLPWI-----MNLIGRFHRVSGSE--------------------------------KITPRWEQDYHLQPMGKLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKLTTQFRRLVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSVPPYGDHTSYTMEGYINNTLSIFKVADFKNKS-KGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIVMEHVIYSVKFFISYAIPDVSKRTKSKIQREKYLTQKLLHENHLKDMTK 870          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO6 (anoctamin 6 [Source:HGNC Symbol;Acc:HGNC:25240])

HSP 1 Score: 525.398 bits (1352), Expect = 7.627e-172
Identity = 342/908 (37.67%), Postives = 517/908 (56.94%), Query Frame = 1
Query:   10 QFPFREMEFQEFPNKQFQEPSS--FMD----IDFVIVYDIST---DNAKHLNQTRRKK---FEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQD--DVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINFITGEWE------WHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGS--YTKLLTSGLAA-----FMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRY------YYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            Q  FR  EF+EF  K    P S  F D    IDFV+VY+  +    N K  N+ +R+K   +E NL   G++L     V D  L FV +  PW++L  +A+ M +K+PLK   +K   S   +L  F   +  V +    P ++ + + F  ++   F +   + FF+ + RS I Y IL R ++  + +    GI+RL+ +G+Y AA+PLH+ KF+   ++ +  +ER +LY  WA PRS  + QP++LIRKY+GEKI IYFAWLG YT  L+  +++G+  F Y  +N  N               + S E+C+    G  +MCP CD  C +W L  +C  SK   IFD+  T++F++ + +W ++FL+FWKR+Q +L++ W+T + ++ E  R +YE  C    IN IT E E      W   ++  +      FF +  +I  V+ +I   + + I+ ++ L +    I G+    K LT   A       +    I+ILN +Y+ +A+ +T+FE PRTQT+Y+++LT+KM++FQF N+Y S FYIA+FKG F+G PG   Y+ G +R EECDP GCL+EL+ Q+ +I  GK I NNI E+ LP I       L    HR  G                                  K  P+WE+D+ L    +L +F EYLEM+IQ+GFVT+F A+ PLAPL AL NNI+EIR+DA+K+ T++RR +  +AQDIG W  I+Q I+I++VV+NA II++TS  +P+LVY +      Y +H S+T+ GY+N TLS+F +++F+  +   NP     N T CRYRDFR       EY  +I YWHV+AA+LAF+IV EHV++ +   I++ IP VS   K +I++EK L  KL+ +   + + +
Sbjct:   42 QHDFRTPEFEEFNGK----PDSLFFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLDDKLVFVKVHAPWEVLCTYAEIMHIKLPLKPNDLKNRSSAFGTLNWFT-KVLSVDESIIKPEQEFFTAPFEKNRMNDFYIVDRDAFFNPATRSRIVYFILSRVKYQVINNVSKFGINRLVNSGIYKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIYFAWLGYYTQMLLLAAVVGVACFLYGYLNQDN--------------CTWSKEVCHPDIGGKIIMCPQCDRLCPFWKLNITCESSKKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARPEYEARCTHVVINEITQEEERIPFTAWGKCIRITLCASAV-FFWILLIIASVIGIIVYRLSVFIVFSAKLPK---NINGTDPIQKYLTPQTATSITASIISFIIIMILNTIYEKVAIMITNFELPRTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPGGCLLELTTQLTIIMGGKAIWNNIQEVLLPWI-----MNLIGRFHRVSGSE--------------------------------KITPRWEQDYHLQPMGKLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKLTTQFRRLVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSVPPYGDHTSYTMEGYINNTLSIFKVADFKNKS-KGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIVMEHVIYSVKFFISYAIPDVSKRTKSKIQREKYLTQKLLHENHLKDMTK 888          
BLAST of Anoctamin vs. Ensembl Celegans
Match: anoh-1 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:C0P286])

HSP 1 Score: 173.711 bits (439), Expect = 2.017e-44
Identity = 198/760 (26.05%), Postives = 341/760 (44.87%), Query Frame = 1
Query:   79 MDIDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKA--LSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMS--FVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRT---------QFDDLQDDV-----------------GIDRLIKAGVYLAAYPLH----EGKFKDNLKNNTSKSERQVLYEYWATPRS--------FCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSF-FTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIG-RPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSS 2226
            + IDFV+V++ +        ++R K   +  F K V+   +   H ++    F L+  P+  L + A+  +M  PLK   VKP L +    +S  FV D     +  + P ++ + S F        N    + FF+ SQR  + Y+IL +          +  + QD+                  G+  L+ + VY  A+ LH    E  +   ++N + K+  + + E    PR         + ++QP+  IR YFGE+I+ YFAW G +   L P  + G+  F Y  I+        I +   D+      ++ N  G    V C M +    ++ +      S     FD      F++ +S+WGSVF+Q WKR  + L + WN++D+  +E  R ++  +   +  + ITGE  W      + ++ L SF F  F M+ VV+S++   +L   ++ +      YT    +  L  + L + ++  + + L  +Y  +  RL  +EN RT++E++++L +K++ FQ  N Y SLFY+A+ +    G +P   +      ++ C    C   L++Q+L   + K       ++ LP                   K    R     TE+ V I  D+  N   + +  LK  P    DF L + N         E +I +G   MFA+  PLAPL AL    +++RIDA++++   R+P+      IGIW  IL  +   +V +NAFI+++TS 
Sbjct:   17 ISIDFVLVHNAA--------ESRSKGKYREFFEKAVQKEGLIIRHQQSGQTHFTLISTPFHRLTREAEMSQMCFPLKDCQVKPGLPSCCIPLSQIFVTDD--TVRFINAPFQRKHGSLF-------LNYHDEKSFFTSSQRGYLTYQILTKIDISKDLKGERLGESQDEPTDPSTSSITSDEQLRRKGLSWLLMSDVYEEAFVLHAPSKEEPYFKAMQNGSVKAYNEFISEIELDPRRSLSLNWERWYKFQPLNKIRDYFGEQIAYYFAWQGTFLTLLWPAVIFGLVVFIYGFIDS-------ISSAPLDW---NHCKVVNFIGQTENVACGMRNGVTLFFSMVTQWFMSS----FDTKMNAFFAVFMSIWGSVFVQIWKRNNSVLSYQWNSDDFHAIEPDRPEFRGSKVKE--DPITGEDIWISPALARYIKMLASFVFVSFSMLVVVISLMLVTLLKIWMVYNFQCTKEYTF---HCWLSAAFLPSILNTLSAMGLGAIYSNLVSRLNSWENHRTESEHNNSLIVKIFAFQMVNTYTSLFYVAFIRPESHGLQPNGLFGLGTEFKDTCLDDTCSSLLALQLLTHTLIKPFPKFFKDVVLPYFV----------------KLFRLRMYTSRTEARVEIEDDDQANV--LVREWLK--PS-AGDFVLWEMN---------EKIILFGTTMMFASLFPLAPLLALIIGFVDMRIDAHRLIWFNRKPIPIITNGIGIWLPILTFLQYCAVFTNAFIVAFTSG 710          
BLAST of Anoctamin vs. Ensembl Celegans
Match: anoh-1 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:C0P286])

HSP 1 Score: 173.711 bits (439), Expect = 2.361e-44
Identity = 197/764 (25.79%), Postives = 340/764 (44.50%), Query Frame = 1
Query:   79 MDIDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKA--LSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMS--FVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRT---------QFDDLQDDV-----------------GIDRLIKAGVYLAAYPLH----EGKFKDNLKNNTSKSERQVLYEYWATPRS--------FCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSF-FTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIG-RPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEK----DFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSS 2226
            + IDFV+V++ +        ++R K   +  F K V+   +   H ++    F L+  P+  L + A+  +M  PLK   VKP L +    +S  FV D     +  + P ++ + S F        N    + FF+ SQR  + Y+IL +          +  + QD+                  G+  L+ + VY  A+ LH    E  +   ++N + K+  + + E    PR         + ++QP+  IR YFGE+I+ YFAW G +   L P  + G+  F Y  I+        I +   D+      ++ N  G    V C M +    ++ +      S     FD      F++ +S+WGSVF+Q WKR  + L + WN++D+  +E  R ++  +   +  + ITGE  W      + ++ L SF F  F M+ VV+S++   +L   ++ +      YT    +  L  + L + ++  + + L  +Y  +  RL  +EN RT++E++++L +K++ FQ  N Y SLFY+A+ +    G +P   +      ++ C    C   L++Q+L   + K       ++ LP                   K    R     TE+ V I  D+  N           + +W K    DF L + N         E +I +G   MFA+  PLAPL AL    +++RIDA++++   R+P+      IGIW  IL  +   +V +NAFI+++TS 
Sbjct:   35 ISIDFVLVHNAA--------ESRSKGKYREFFEKAVQKEGLIIRHQQSGQTHFTLISTPFHRLTREAEMSQMCFPLKDCQVKPGLPSCCIPLSQIFVTDD--TVRFINAPFQRKHGSLF-------LNYHDEKSFFTSSQRGYLTYQILTKIDISKDLKGERLGESQDEPTDPSTSSITSDEQLRRKGLSWLLMSDVYEEAFVLHAPSKEEPYFKAMQNGSVKAYNEFISEIELDPRRSLSLNWERWYKFQPLNKIRDYFGEQIAYYFAWQGTFLTLLWPAVIFGLVVFIYGFIDS-------ISSAPLDW---NHCKVVNFIGQTENVACGMRNGVTLFFSMVTQWFMSS----FDTKMNAFFAVFMSIWGSVFVQIWKRNNSVLSYQWNSDDFHAIEPDRPEFRGSKVKE--DPITGEDIWISPALARYIKMLASFVFVSFSMLVVVISLMLVTLLKIWMVYNFQCTKEYTF---HCWLSAAFLPSILNTLSAMGLGAIYSNLVSRLNSWENHRTESEHNNSLIVKIFAFQMVNTYTSLFYVAFIRPESHGLQPNGLFGLGTEFKDTCLDDTCSSLLALQLLTHTLIKPFPKFFKDVVLPYFV----------------KLFRLRMYTSRTEARVEIEDDDQANV---------LVREWLKPSAGDFVLWEMN---------EKIILFGTTMMFASLFPLAPLLALIIGFVDMRIDAHRLIWFNRKPIPIITNGIGIWLPILTFLQYCAVFTNAFIVAFTSG 728          
BLAST of Anoctamin vs. Ensembl Celegans
Match: anoh-2 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:H2L2L3])

HSP 1 Score: 59.6918 bits (143), Expect = 9.408e-9
Identity = 58/245 (23.67%), Postives = 111/245 (45.31%), Query Frame = 1
Query: 1036 IIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEE---MEDRRLDYEKNCQSQRINFITGEWE-WHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPII 1758
            ++F+    +W +++L++WKR Q +L F W T D  +   ++D R  ++ +  +   N ++G  E ++   K  ++R + ++  + F+  V +      I     +    +   + +  S+         A M    I+I + +Y+ +A+ L D EN RT  EY+D L  K+ +FQF   + SLFYIA     F+ R                    +  L   +  + + +Q+  NIME  +P +
Sbjct:  278 VLFAFFNCIWSTIYLEWWKRVQAELAFKWGTYDATQDSYLQDPRPAFQGDYLAP--NPVSGRLEPFYPAWKHTVMRYVITY-PITFLCVVGMFAAMLAIFTVQDLADFYFGDSWML--SWLCYFPMIFYALM----IVISDKIYRRLALILNDLENYRTDDEYEDFLITKIVLFQFVTAFGSLFYIA-----FVLRD-------------------MKRLQETLATLLITRQVTQNIMETVVPFM 489          

HSP 2 Score: 55.4546 bits (132), Expect = 1.905e-7
Identity = 31/61 (50.82%), Postives = 45/61 (73.77%), Query Frame = 1
Query: 1972 FDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIW 2154
             D++LEM IQ+G+V +F+ A PLA + AL NN+IEIR+DA+K+    +RP  R+ +DIG W
Sbjct:  623 LDDFLEMFIQFGYVLLFSPAFPLAAVCALINNLIEIRVDAFKLCNTVQRPFGRRVKDIGAW 683          
BLAST of Anoctamin vs. Ensembl Celegans
Match: anoh-2 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:H2L2L3])

HSP 1 Score: 59.6918 bits (143), Expect = 9.976e-9
Identity = 58/245 (23.67%), Postives = 111/245 (45.31%), Query Frame = 1
Query: 1036 IIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEE---MEDRRLDYEKNCQSQRINFITGEWE-WHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPII 1758
            ++F+    +W +++L++WKR Q +L F W T D  +   ++D R  ++ +  +   N ++G  E ++   K  ++R + ++  + F+  V +      I     +    +   + +  S+         A M    I+I + +Y+ +A+ L D EN RT  EY+D L  K+ +FQF   + SLFYIA     F+ R                    +  L   +  + + +Q+  NIME  +P +
Sbjct:  334 VLFAFFNCIWSTIYLEWWKRVQAELAFKWGTYDATQDSYLQDPRPAFQGDYLAP--NPVSGRLEPFYPAWKHTVMRYVITY-PITFLCVVGMFAAMLAIFTVQDLADFYFGDSWML--SWLCYFPMIFYALM----IVISDKIYRRLALILNDLENYRTDDEYEDFLITKIVLFQFVTAFGSLFYIA-----FVLRD-------------------MKRLQETLATLLITRQVTQNIMETVVPFM 545          

HSP 2 Score: 55.4546 bits (132), Expect = 2.102e-7
Identity = 31/61 (50.82%), Postives = 45/61 (73.77%), Query Frame = 1
Query: 1972 FDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIW 2154
             D++LEM IQ+G+V +F+ A PLA + AL NN+IEIR+DA+K+    +RP  R+ +DIG W
Sbjct:  679 LDDFLEMFIQFGYVLLFSPAFPLAAVCALINNLIEIRVDAFKLCNTVQRPFGRRVKDIGAW 739          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0083806)

HSP 1 Score: 473.011 bits (1216), Expect = 7.539e-152
Identity = 307/876 (35.05%), Postives = 490/876 (55.94%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQT-RRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLK--------TTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSA-FRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDL-QDDV--GIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---------------RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLK 2628
            IDFV+ Y I+      L  T +R+ FE NL ++G++   V+      + FV +  P ++L ++A+ +K++MP+K            K   S+L+ +  F     +V + +  P +   ++A +  DK+ +F++   + FF+ + RS I   IL R +F    Q D+  GI+RLI  GVY AAYPLH+G+  +      + + R +LY++WA+   + RYQP++ I++YFG KI +YFAWLG YT+ L+  S++G+  F Y+  +  N            + P    +IC + G  +  MCP+CD  C++W L E+C ++K+  + DN  T+ F++ +S W ++FL+ WKR   ++   W+   ++  E+                R+DY  N +   + F      W MKL   +     SF  V  +I +    +  V++ R+ + + L      +  S   +L +  AAF++LC + ILN +Y  +A  LT+ E  RTQT++DD+LTLK+Y+ QF N+Y S+FYIA+FKG F+G PG Y   F +RQEEC   GCL EL IQ+ +I VGKQ  N I+E+ LP+                          +   + G++   + + N +           +W +DF+LLD     +F EYLEMV+QYGFVT+F AA PLAP FAL NNI+E+R+DA K+LT  +RP++++ +DIG+W+ IL  I  +SV++N FII++TS  +P+LVYR+Y N K  TL+GY+NFTLS F + +  P    L       NIT CRY DFR    S  +Y++S +++ +LA RL FV+V+E+ V  +  L+ W IP +S  ++ +I +E  +  +++   EA + +
Sbjct:   45 IDFVLAYRINAHEPTELENTEKRRVFEANLISQGLE---VESSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKEIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDE-EIFPKRAHRFTAIYSRDKEYLFDIR-QDCFFTTAVRSRIVEFILDRQRFPAKNQHDMAFGIERLIAEGVYSAAYPLHDGEITE------TGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKN------------YVPV--KDIC-QSGNTNITMCPLCDW-CNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPF------WRMKLPATVF----SFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMF----------------------WRKVLAIQVGLSRLFNNTPNPDKAKDE------RWMRDFKLLDWGARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVN-KQGTLDGYLNFTLSEFKVID-SPTLYSLAGD--LSNITTCRYTDFRLPPSSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEIIIDQEAHRAR 851          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0334921)

HSP 1 Score: 473.011 bits (1216), Expect = 7.539e-152
Identity = 307/876 (35.05%), Postives = 490/876 (55.94%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQT-RRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLK--------TTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSA-FRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDL-QDDV--GIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---------------RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLK 2628
            IDFV+ Y I+      L  T +R+ FE NL ++G++   V+      + FV +  P ++L ++A+ +K++MP+K            K   S+L+ +  F     +V + +  P +   ++A +  DK+ +F++   + FF+ + RS I   IL R +F    Q D+  GI+RLI  GVY AAYPLH+G+  +      + + R +LY++WA+   + RYQP++ I++YFG KI +YFAWLG YT+ L+  S++G+  F Y+  +  N            + P    +IC + G  +  MCP+CD  C++W L E+C ++K+  + DN  T+ F++ +S W ++FL+ WKR   ++   W+   ++  E+                R+DY  N +   + F      W MKL   +     SF  V  +I +    +  V++ R+ + + L      +  S   +L +  AAF++LC + ILN +Y  +A  LT+ E  RTQT++DD+LTLK+Y+ QF N+Y S+FYIA+FKG F+G PG Y   F +RQEEC   GCL EL IQ+ +I VGKQ  N I+E+ LP+                          +   + G++   + + N +           +W +DF+LLD     +F EYLEMV+QYGFVT+F AA PLAP FAL NNI+E+R+DA K+LT  +RP++++ +DIG+W+ IL  I  +SV++N FII++TS  +P+LVYR+Y N K  TL+GY+NFTLS F + +  P    L       NIT CRY DFR    S  +Y++S +++ +LA RL FV+V+E+ V  +  L+ W IP +S  ++ +I +E  +  +++   EA + +
Sbjct:   45 IDFVLAYRINAHEPTELENTEKRRVFEANLISQGLE---VESSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKEIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDE-EIFPKRAHRFTAIYSRDKEYLFDIR-QDCFFTTAVRSRIVEFILDRQRFPAKNQHDMAFGIERLIAEGVYSAAYPLHDGEITE------TGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKN------------YVPV--KDIC-QSGNTNITMCPLCDW-CNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPF------WRMKLPATVF----SFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMF----------------------WRKVLAIQVGLSRLFNNTPNPDKAKDE------RWMRDFKLLDWGARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVN-KQGTLDGYLNFTLSEFKVID-SPTLYSLAGD--LSNITTCRYTDFRLPPSSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEIIIDQEAHRAR 851          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0083805)

HSP 1 Score: 473.781 bits (1218), Expect = 1.368e-150
Identity = 307/876 (35.05%), Postives = 490/876 (55.94%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQT-RRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLK--------TTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSA-FRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDL-QDDV--GIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---------------RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLK 2628
            IDFV+ Y I+      L  T +R+ FE NL ++G++   V+      + FV +  P ++L ++A+ +K++MP+K            K   S+L+ +  F     +V + +  P +   ++A +  DK+ +F++   + FF+ + RS I   IL R +F    Q D+  GI+RLI  GVY AAYPLH+G+  +      + + R +LY++WA+   + RYQP++ I++YFG KI +YFAWLG YT+ L+  S++G+  F Y+  +  N            + P    +IC + G  +  MCP+CD  C++W L E+C ++K+  + DN  T+ F++ +S W ++FL+ WKR   ++   W+   ++  E+                R+DY  N +   + F      W MKL   +     SF  V  +I +    +  V++ R+ + + L      +  S   +L +  AAF++LC + ILN +Y  +A  LT+ E  RTQT++DD+LTLK+Y+ QF N+Y S+FYIA+FKG F+G PG Y   F +RQEEC   GCL EL IQ+ +I VGKQ  N I+E+ LP+                          +   + G++   + + N +           +W +DF+LLD     +F EYLEMV+QYGFVT+F AA PLAP FAL NNI+E+R+DA K+LT  +RP++++ +DIG+W+ IL  I  +SV++N FII++TS  +P+LVYR+Y N K  TL+GY+NFTLS F + +  P    L       NIT CRY DFR    S  +Y++S +++ +LA RL FV+V+E+ V  +  L+ W IP +S  ++ +I +E  +  +++   EA + +
Sbjct:  194 IDFVLAYRINAHEPTELENTEKRRVFEANLISQGLE---VESSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKEIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDE-EIFPKRAHRFTAIYSRDKEYLFDIR-QDCFFTTAVRSRIVEFILDRQRFPAKNQHDMAFGIERLIAEGVYSAAYPLHDGEITE------TGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKN------------YVPV--KDIC-QSGNTNITMCPLCDW-CNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPF------WRMKLPATVF----SFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMF----------------------WRKVLAIQVGLSRLFNNTPNPDKAKDE------RWMRDFKLLDWGARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVN-KQGTLDGYLNFTLSEFKVID-SPTLYSLAGD--LSNITTCRYTDFRLPPSSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEIIIDQEAHRAR 1000          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0334922)

HSP 1 Score: 466.463 bits (1199), Expect = 3.748e-149
Identity = 307/900 (34.11%), Postives = 492/900 (54.67%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQT-RRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTM--------------------------------VKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSA-FRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDL-QDDV--GIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---------------RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLK 2628
            IDFV+ Y I+      L  T +R+ FE NL ++G++   V+      + FV +  P ++L ++A+ +K++MP+K ++                                 K   S+L+ +  F     +V + +  P +   ++A +  DK+ +F++   + FF+ + RS I   IL R +F    Q D+  GI+RLI  GVY AAYPLH+G+  +      + + R +LY++WA+   + RYQP++ I++YFG KI +YFAWLG YT+ L+  S++G+  F Y+  +  N            + P    +IC + G  +  MCP+CD  C++W L E+C ++K+  + DN  T+ F++ +S W ++FL+ WKR   ++   W+   ++  E+                R+DY  N +   + F      W MKL   +     SF  V  +I +    +  V++ R+ + + L      +  S   +L +  AAF++LC + ILN +Y  +A  LT+ E  RTQT++DD+LTLK+Y+ QF N+Y S+FYIA+FKG F+G PG Y   F +RQEEC   GCL EL IQ+ +I VGKQ  N I+E+ LP+                          +   + G++   + + N +           +W +DF+LLD     +F EYLEMV+QYGFVT+F AA PLAP FAL NNI+E+R+DA K+LT  +RP++++ +DIG+W+ IL  I  +SV++N FII++TS  +P+LVYR+Y N K  TL+GY+NFTLS F + +  P    L       NIT CRY DFR    S  +Y++S +++ +LA RL FV+V+E+ V  +  L+ W IP +S  ++ +I +E  +  +++   EA + +
Sbjct:   45 IDFVLAYRINAHEPTELENTEKRRVFEANLISQGLE---VESSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKESLCNLRISERSNRLRNAAHYLTNKIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDE-EIFPKRAHRFTAIYSRDKEYLFDIR-QDCFFTTAVRSRIVEFILDRQRFPAKNQHDMAFGIERLIAEGVYSAAYPLHDGEITE------TGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKN------------YVPV--KDIC-QSGNTNITMCPLCDW-CNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPF------WRMKLPATVF----SFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMF----------------------WRKVLAIQVGLSRLFNNTPNPDKAKDE------RWMRDFKLLDWGARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVN-KQGTLDGYLNFTLSEFKVID-SPTLYSLAGD--LSNITTCRYTDFRLPPSSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEIIIDQEAHRAR 875          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0302492)

HSP 1 Score: 466.463 bits (1199), Expect = 1.322e-147
Identity = 309/899 (34.37%), Postives = 493/899 (54.84%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQT-RRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLES--------LMSFVPDLFWV--------SQLDDV---------------PHKQAYWSA-FRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDL-QDDV--GIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---------------RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLK 2628
            IDFV+ Y I+      L  T +R+ FE NL ++G++   V+      + FV +  P ++L ++A+ +K++MP+K ++    +S   +        L + +P +  V        S L  V               P +   ++A +  DK+ +F++   + FF+ + RS I   IL R +F    Q D+  GI+RLI  GVY AAYPLH+G+  +      + + R +LY++WA+   + RYQP++ I++YFG KI +YFAWLG YT+ L+  S++G+  F Y+  +  N            + P    +IC + G  +  MCP+CD  C++W L E+C ++K+  + DN  T+ F++ +S W ++FL+ WKR   ++   W+   ++  E+                R+DY  N +   + F      W MKL   +     SF  V  +I +    +  V++ R+ + + L      +  S   +L +  AAF++LC + ILN +Y  +A  LT+ E  RTQT++DD+LTLK+Y+ QF N+Y S+FYIA+FKG F+G PG Y   F +RQEEC   GCL EL IQ+ +I VGKQ  N I+E+ LP+                          +   + G++   + + N +           +W +DF+LLD     +F EYLEMV+QYGFVT+F AA PLAP FAL NNI+E+R+DA K+LT  +RP++++ +DIG+W+ IL  I  +SV++N FII++TS  +P+LVYR+Y N K  TL+GY+NFTLS F + +  P    L       NIT CRY DFR    S  +Y++S +++ +LA RL FV+V+E+ V  +  L+ W IP +S  ++ +I +E  +  +++   EA + +
Sbjct:  194 IDFVLAYRINAHEPTELENTEKRRVFEANLISQGLE---VESSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKESLCNLRISERSNRLRNAAHYLTNKIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEIFPKRAHRFTAIYSRDKEYLFDIR-QDCFFTTAVRSRIVEFILDRQRFPAKNQHDMAFGIERLIAEGVYSAAYPLHDGEITE------TGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKN------------YVPV--KDIC-QSGNTNITMCPLCDW-CNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPF------WRMKLPATVF----SFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMF----------------------WRKVLAIQVGLSRLFNNTPNPDKAKDE------RWMRDFKLLDWGARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVN-KQGTLDGYLNFTLSEFKVID-SPTLYSLAGD--LSNITTCRYTDFRLPPSSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEIIIDQEAHRAR 1024          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano3 (anoctamin 3 [Source:ZFIN;Acc:ZDB-GENE-111031-3])

HSP 1 Score: 533.872 bits (1374), Expect = 1.822e-174
Identity = 326/893 (36.51%), Postives = 506/893 (56.66%), Query Frame = 1
Query:   49 NKQFQEPSSFM------DIDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLK-----TTMVKPPLST--------LESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDN--LKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYE-KNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYN--------HKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
             K  + PS  M       ID+++VY  S+   +     +R  FE+NL  +G+ L K   + +  + FV +  PWD L K+A+ M ++MP +     T   K  + +        L+S +   P       L D+     Y + F   +   F ++  E FFS S RS I + +L RT+++D +  +GI+RL+    Y AA+P HEG +K    +K + +++ R +LYE WA    + +YQP++LIR+YFGEKI +YFAWLG YT  LIP +L+G+F F Y L    +                +S EIC      + VMCPMC+ +C  W L +SC+++K+  +FDN  T+ F+I +++W +VFL+FWKR++ +L + W+  D+EE E+  R  +E K  + +R+N I+G+ E    L DK+ R + S   +FFMI++VL+ +  V++ R+I        ++  +    +  TSG    ++   I+ LNV+Y+ +A  LT+ E+PRT++E++++  LKM++FQF N   S FYIA+F G F GRPG Y   F  WR EEC P+GCL++L +QM VI V KQI NN ME+  P+++                                  +S   +   G    + + LPQW++D+ L   N   + DEYLEMV+Q+GF T+F AA PLAPL AL NNIIEIR+DAYK +T+WRRP+  +A DIGIW  +L+ I +++V++NAF+I+ TS  +P+ VY   Y         H+   L GY+N +LSVF++   +  +        ++N   CRYRD+R    S   Y  ++ +WHVLAARLAF+IV+EH+VF +   I  +IP +   +  R+ +EK L  +++++AE E L++
Sbjct:  146 GKNLETPSGLMFRDGKKRIDYILVYKKSSPQVE-----KRCTFERNLRAEGLMLEKEPSLTNSDIMFVKIHAPWDTLCKYAEQMNIRMPFRKKCYFTDWKKKAMGSRFQLRFRQLKSWLPRNPMKLDKEALPDLVETDCYTAPFCRARMHHFTINNRETFFSNSTRSRIVHHVLQRTKYEDGKSKMGINRLLGNSTYEAAFPPHEGCYKSRHPIKTHGAQNHRHLLYERWARWGIWYKYQPLDLIRRYFGEKIGLYFAWLGWYTGMLIPAALVGLFVFLYGLFTMDSSQ--------------VSKEICE---ANTTVMCPMCEGNCSSWTLSDSCVYAKVTHLFDNGGTVFFAIFMAIWATVFLEFWKRRRAELTYDWDLIDWEEEEEELRPQFEAKYSRKERVNPISGKPEPFQPLTDKLSRLMVSVSGIFFMISLVLTAVFAVVVFRLIAMEKFVSFQWEFVKKNWQFATSGTGVCINFMIIMSLNVVYEKVAYLLTNLEHPRTESEWENSFALKMFLFQFVNLNSSTFYIAFFLGRFAGRPGDYNKLFNRWRMEECHPSGCLIDLCLQMGVIMVLKQIWNNFMELGYPLLQ--------------------------------NWWSRRKMKRAGEQSNSKEELPQWDRDWNLQPMNAHGLVDEYLEMVLQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPMPARATDIGIWHGVLEGIGVVAVITNAFVIAITSDYIPRFVYAIKYGPCVDKGYRHEK-CLRGYLNNSLSVFDMGELRNGS--------YEN-QYCRYRDYRAPPWSPEPYEFTLQFWHVLAARLAFIIVFEHLVFGIKTFIAHMIPDMPKDLCDRMRREKYLMQEMVYEAELEHLQK 974          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano5a (anoctamin 5a [Source:ZFIN;Acc:ZDB-GENE-091013-2])

HSP 1 Score: 520.776 bits (1340), Expect = 1.142e-170
Identity = 336/895 (37.54%), Postives = 511/895 (57.09%), Query Frame = 1
Query:   34 FQEFPNKQFQEPSS--FMD----IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVH--DKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFD-DLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRA-------RYTIIGSY--TKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-W---RQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYN-HKSWTLNGYVNFTLSVFNISNFQPANIP---LNPRPI-FQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLK 2628
            FQ   +KQ Q   S  F D    IDFV+ Y    D  K   Q RRK FE NL   G+++   D     D    F+ + VPW++L  +AD +K+K+P K   + P    +     F P  F +      P    + S F   K + F ++  E  F  S R+ I Y +L R  +  + +D  GI RL+  G Y +A+PLH+ ++    +++  +SER  LY+ WA   SF + QP+ LIRKY+GEKI IYFAWLG YT  L   +++G+  F Y +  +  +                S EICNE   G  VMCP+CD+ C YW L  +C  S  + +FDN+ T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C ++R+N +T E E ++ L  K  R + S  TV F I+++++ I GVI  R+ + +            +  I+G+    +  TS  A+ ++   I++LN LY+ +A+++TD E P+T  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G PG+Y Y FG W   R EEC+P GCL+EL+ Q++++ VGKQ+  NI E  +P +             RN               S       ESL +            +WE+D  L +  +L +F EYLEMVIQ+GF+T+F A+ PLAPL AL NNI+E+R+DA+K  T++RRP+A +A  IG W +IL +I++ SVV+NAFI+S+TS  +P+LVY+Y +N   + +++GY+  +LS++NIS F P N P    NP      N T CRYRD+R       +Y+ ++ +WH+LAA+LAF+I+ EHVVF +   + W+IP V   +K R+++E+ L  + +   E E+LK
Sbjct:   19 FQSRVDKQQQSKDSVYFRDGVRRIDFVLSYIDDKDGEK--KQDRRKVFEANLQKAGLEVETEDKSESEDGKTYFLKIHVPWEVLATYADVLKIKVPFKANDI-PENKEIPMGWLFTP--FRLPDHVMNPEPDFFTSTFDKSKIDFFLIEDKETLFPASTRNRIVYYLLSRIPYSTEDKDKKGIKRLLNNGTYTSAFPLHDCRYWTRSRDDNCESERYSLYKNWARFSSFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLSYAAVVGLLCFIYGVATFDEN--------------IWSREICNETIGGQIVMCPLCDKKCGYWKLSTTCSSSWQSYLFDNAATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYESKCTNRRLNRVTQEMEPYLPLTSKCARSILSGATVLFWISLIIASIIGVIAYRLAVFAAFASIMKDSPTNKLEIVGNLITPQFATSVTASCINFVIIMVLNFLYERVAIKITDMEVPKTHVEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGNYAYMFGPWSGLRNEECEPGGCLIELTTQLVIVMVGKQVWGNIQEALVPWL-------------RNWWV------------SRSARNHPESLYS------------RWEQDHDLQNLGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKFTTQFRRPVAAKAHSIGAWEEILNMIAVFSVVTNAFIVSFTSDMIPRLVYQYVHNTGNAASMSGYITHSLSIYNISEFPPENRPDDDENPDWFNAGNYTTCRYRDYRYPPGHEKQYTHNMDFWHILAAKLAFIIIMEHVVFVVKFFVAWLIPDVPSDVKARVKRERYLIQEYLHDYEVEKLK 857          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano5a (anoctamin 5a [Source:ZFIN;Acc:ZDB-GENE-091013-2])

HSP 1 Score: 520.005 bits (1338), Expect = 5.545e-170
Identity = 325/877 (37.06%), Postives = 501/877 (57.13%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVH--DKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFD-DLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYR-------ARYTIIGSY--TKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-W---RQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYN-HKSWTLNGYVNFTLSVFNISNFQPANIP---LNPRPI-FQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLK 2628
            IDFV+ Y    D  K   Q RRK FE NL   G+++   D     D    F+ + VPW++L  +AD +K+K+P K   + P    +     F P  F +      P    + S F   K + F ++  E  F  S R+ I Y +L R  +  + +D  GI RL+  G Y +A+PLH+ ++    +++  +SER  LY+ WA   SF + QP+ LIRKY+GEKI IYFAWLG YT  L   +++G+  F Y +  +  +                S EICNE   G  VMCP+CD+ C YW L  +C  S  + +FDN+ T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C ++R+N +T E E ++ L  K  R + S  TV F I+++++ I GVI  R+ + +            +  I+G+    +  TS  A+ ++   I++LN LY+ +A+++TD E P+T  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G PG+Y Y FG W   R EEC+P GCL+EL+ Q++++ VGKQ+  NI E  +P ++                                          N     + +N P+     WE+D  L +  +L +F EYLEMVIQ+GF+T+F A+ PLAPL AL NNI+E+R+DA+K  T++RRP+A +A  IG W +IL +I++ SVV+NAFI+S+TS  +P+LVY+Y +N   + +++GY+  +LS++NIS F P N P    NP      N T CRYRD+R       +Y+ ++ +WH+LAA+LAF+I+ EHVVF +   + W+IP V   +K R+++E+ L  + +   E E+LK
Sbjct:   65 IDFVLSYIDDKDGEK--KQDRRKVFEANLQKAGLEVETEDKSESEDGKTYFLKIHVPWEVLATYADVLKIKVPFKANDI-PENKEIPMGWLFTP--FRLPDHVMNPEPDFFTSTFDKSKIDFFLIEDKETLFPASTRNRIVYYLLSRIPYSTEDKDKKGIKRLLNNGTYTSAFPLHDCRYWTRSRDDNCESERYSLYKNWARFSSFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLSYAAVVGLLCFIYGVATFDEN--------------IWSREICNETIGGQIVMCPLCDKKCGYWKLSTTCSSSWQSYLFDNAATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYESKCTNRRLNRVTQEMEPYLPLTSKCARSILSGATVLFWISLIIASIIGVIAYRLAVFAAFASIMKDSPTNKLEIVGNLITPQFATSVTASCINFVIIMVLNFLYERVAIKITDMEVPKTHVEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGNYAYMFGPWSGLRNEECEPGGCLIELTTQLVIVMVGKQVWGNIQEALVPWLR------------------------------------------NWWVSRSARNHPESLYSRWEQDHDLQNLGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKFTTQFRRPVAAKAHSIGAWEEILNMIAVFSVVTNAFIVSFTSDMIPRLVYQYVHNTGNAASMSGYITHSLSIYNISEFPPENRPDDDENPDWFNAGNYTTCRYRDYRYPPGHEKQYTHNMDFWHILAAKLAFIIIMEHVVFVVKFFVAWLIPDVPSDVKARVKRERYLIQEYLHDYEVEKLK 880          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano5b (anoctamin 5b [Source:ZFIN;Acc:ZDB-GENE-061215-108])

HSP 1 Score: 513.457 bits (1321), Expect = 2.079e-167
Identity = 322/875 (36.80%), Postives = 497/875 (56.80%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVH--DKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF----DDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFF-------MITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSY--TKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-W---RQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHK-SWTLNGYVNFTLSVFNISNFQPANIP-LNPRPIFQN---ITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLK 2628
            IDFV+ Y    D        RR++FE NL   G++L   D     D+   ++ +  PW++L  +AD +K+K+P K + +       E  + ++   F + +    P    + + F   K + F +D  + FF  S R+ I Y IL R  +       +D  GI+RL+  G Y +AYPLH+ ++    ++   +SER  LY YWA    F + QP+ LI+KY+GEKI IYFAWLG YT  L   +++G+  F Y +++Y ++                S EIC+ +  G  VMCP+CD+ C YW L  +CL S  + +FDN  T+ F++ + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE+ C  +R+N IT E E ++    K  R   S  TV F        I  V++    V      +      ++  ++GS    +L TS  A+ ++   ILILN LY+ +A+ +TD E P+T  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G PG+Y Y FG W   R EEC P GCL+EL+ Q+L++  GKQ++ N+ E  LP++             RN   S+  RS    T S                        +WE+D  L + ++  +F EYLEMVIQ+GF+T+F A+ PLAPL ALFNNI+E+R+DA+K  T++RRP+A +A++IG W +IL V++I+SVV+NAFI+++TS  +P+LVY Y Y+      + GY+  +LS++NIS     N+P     P + N   IT CRYRD+R       +Y+ ++ +WH+LAA+LAF+I+ EHVVF +   + W+IP V   +K RI++E+ L  + +   E E+LK
Sbjct:   66 IDFVLSY--VDDKEGDKKAERRREFEANLEKAGLELETEDKSESDDRKTHYLKIHAPWEVLATYADVLKIKVPFKVSDIP---KAREVPLEWLSHPFRLPENIMRPEPDYFTAPFDKSKVDFFLIDDKDTFFPPSTRNRIVYYILTRCPYYKEDRKEKDKTGINRLLNNGTYTSAYPLHDCRYWKKAQDMQCESERYHLYRYWARFLCFYKEQPLNLIKKYYGEKIGIYFAWLGFYTEMLFYAAVMGVICFVYGVLSYEDN--------------ITSKEICDPKIGGMIVMCPLCDKKCSYWKLNSTCLSSWQSHLFDNEGTVFFAMFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQIRPEYEQKCTGRRLNRITQEMEPYLPFPSKCARFCLSGATVLFWTCLIVACIMGVIAYRLAVYAAFASVMKDSSTSKIQLVGSLITPQLATSVTASCINFVIILILNFLYEHVAIWITDMEIPKTHLEYENKLTMKMFMFQFVNYYSSCFYVAFFKGKFVGYPGNYSYMFGKWSTLRNEECAPGGCLIELTTQLLIVMAGKQMVGNVQEALLPLV-------------RNWWSSRKGRSHPESTYS------------------------RWEQDHDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNILEVRVDAWKFTTQFRRPMAAKARNIGAWEEILNVVAIMSVVTNAFIMAFTSDMIPRLVYLYAYHPGIEANMTGYITNSLSIYNISQIPEDNLPEAGENPSWFNSSTITTCRYRDYRYPPGHLRQYTHTMQFWHILAAKLAFIIIMEHVVFVVKFFVAWLIPDVPSEVKARIKRERFLVQEYLHNYEVEKLK 884          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano6 (anoctamin 6 [Source:ZFIN;Acc:ZDB-GENE-081104-64])

HSP 1 Score: 486.493 bits (1251), Expect = 1.348e-157
Identity = 327/881 (37.12%), Postives = 505/881 (57.32%), Query Frame = 1
Query:   85 IDFVIVYDIS-TDNAKHLNQT-------RRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSA-FRIDKQEMFNMDPAE--LFFSKSQRSLIAYEILMRTQFDDLQDD--VGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYEKNCQSQRINFITGEWE-WHMKLKDKILRKLTSFFTVFF--------MITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSY--TKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRY------YYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNP-RPI-FQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQL 2625
            IDFV+VY+   + N  +   +       RR+ FE +L NKG+ L     V D+ L FV + +P+D+L   A+ + +K+P+K       L T  S  +     F+ ++ D +  +  Y++A FR D    F +   E    F+ + RS + Y IL R ++D   ++   GI +L+  G+Y AAYPLH+ +F    K     +ER +LY  WA P++F + QP++LIRKYFGEKI IYFAWLG YTF L   SL   FG G  +  Y + +             + S E+C+    G  VMCP CD +C YW L  +C  SK   +FDN  T++F++ +S+W ++FL+FWKR Q  L++ W+T ++++ E++ R +YE  C  +R + IT   E        K +R      TV F        ++ V++  +   ++  + + S L R        Y   ++ TS  A+ +++  I+ILN++Y+ +AV +TDFE PRT+TEY+++LTLKM++FQF NFY S FYIA+FKG  +G PG   Y+ G +R EECDP GCL EL+ Q+ +I  GK + NNI E+ LP +             +N+            T+ G                 + K +P+WE+D++L     L +F EYLEMVIQ+GFVT+F A+ PLAPL AL NN+ EIR+DA+K  T++RR +  +AQDIG W  ILQ ++I++VV+N  II++TS  +P+LVY +      Y  + + T+ G+++ +LSVFNIS+F     P +  +PI F NIT CRYRD+R   +    Y  ++ YWHV+AA+LAF+IV EH+V+F   +++++IP V  ++  +I++E+ L   ++  ++   L
Sbjct:   19 IDFVLVYEYEESKNGSNKKASVIRRKKRRREFFEGSLMNKGLHLEMTQSVVDEKLFFVKLHMPFDVLCANAEVLHIKLPIKCN----DLRTQSSKHNCCTKPFYPNE-DVIGKEPDYFTAPFRKDLLNRFQLKEREGRELFTPTMRSRMVYYILSRAEYDIKGENKKFGITKLLAGGIYKAAYPLHDCRFNVKSKEEDCPNERYLLYSEWAHPKNFYKMQPLDLIRKYFGEKIGIYFAWLGFYTFML---SLAAAFGLGCFIYGYRSRESS-----------TWSKEVCDPDIGGQIVMCPQCDNNCPYWRLNTTCESSKRLCVFDNFGTLVFAVFMSVWVTLFLEFWKRYQAKLEYKWDTVEFQQQEEQPRPEYEARCTYERFSPITQSNEKVPYTACGKCMRVSCGIGTVLFWILLIVASVVGVIVYRLAMFMVFSMQLRSDLNRKELEPFREYITPQMATSITASIINVIIIMILNIVYEKVAVWITDFELPRTKTEYENSLTLKMFLFQFVNFYSSCFYIAFFKGKIVGYPGEPVYWLGKFRNEECDPGGCLTELTTQLSIIMTGKAVWNNIQEVLLPWL-------------KNL-------MFRHCTQVG-----------------SEKAIPRWEQDYQLQPMGTLGLFYEYLEMVIQFGFVTLFVASFPLAPLLALVNNLFEIRVDAWKFTTQFRRIVPEKAQDIGAWQPILQGVTILAVVTNTAIIAFTSDMIPRLVYYWAFSVSPYVENSNHTMAGFIDSSLSVFNISHFDDKTRPRDDIKPIWFNNITTCRYRDYRNPPDHQNPYQFNVYYWHVIAAKLAFMIVVEHIVYFTKFMLSYLIPDVPEALNEQIKRERFLTRDILNNSQLTDL 843          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO5 (anoctamin 5 [Source:NCBI gene;Acc:100489787])

HSP 1 Score: 543.502 bits (1399), Expect = 2.837e-179
Identity = 339/916 (37.01%), Postives = 510/916 (55.68%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDG--VHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF--DDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGS-----------YTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWT-LNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFGIGGRPSNQLANINFPRHSNKSKRSLEGKY*LSVA 2757
            IDFV+ Y   T         RR++FE NL   G++L   D     +    FV +  PW++L  +A+ + +KMPLK   +K      E+++S V  LF + Q    P    + + FR DKQE+F  +  E FF+ S R+ I Y IL R  +  ++ +   GI RL+  G YL AYPLH+ ++    K +    ER  LY +WA    F + QP++LIRKY+GEKI IYFAWLG YT  L   +++G F F Y  I   +                 S EIC+    G  +MCP+CD+ C++W L  +C  S+ + +FDN  T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C  ++ N +T E E ++    K  R   S  TV F I +++      I+  I+    +Y A  +I+ +             +L TS  A+ ++   I+ILN LY+ +A+ +TD E PRT  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G P  Y Y FG WR EECDPAGCL+EL+ Q+ ++  GKQI  NI E  +P                                             N + +   +N PQ     WE D  L     L +F+EYLEMV+Q+GF+T+F A+ PLAPL AL NNI+EIR+D++K+ T+++RP+A +A  IG+W +IL  I+I+SVV+NAFI+++TS  +P+LVY Y Y+    T ++GY+  +LSVFN+S+F+  ++P+       N+  CRYRD+R       EY V++ YWH+LAA++AF+I+ EHVVF +   + W+IP V   +K R+++EK L  K++ + E E+LKQ               +L N N P  ++K   + +GK  LS A
Sbjct:   42 IDFVLSYTEDTGKDAEKKAERRREFELNLQKSGLELETEDKKESENGKTYFVKIHAPWEVLTTYAEVLNLKMPLKADDLK---DDSENILSHVLKLFKLPQEVMYPEPDYFTAPFRKDKQELFRTEEREKFFTPSTRNRIVYYILSRCHYGEEEGKKKFGIKRLLTNGSYLDAYPLHDCQYWK--KTDERNCERYTLYTHWAKFTRFYKEQPLDLIRKYYGEKIGIYFAWLGFYTEMLFYAAVVGFFCFLYGWITMDDSIS--------------SKEICDPNIGGQIIMCPLCDKRCEFWRLNSTCEPSQYSHMFDNVATLFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYESKCTEKKKNPVTQEMEPYLPATSKAARFCFSGATVLFWIALII----ASIIAIIVYRLWVYAAFASIMDNNLALKPVSNLLTPQLATSVTASVLNFVTIMILNFLYERVAIWITDMEIPRTHLEYENRLTMKMFLFQFVNYYSSCFYVAFFKGKFVGYPADYSYLFGKWRNEECDPAGCLIELTTQLTIVMAGKQIWGNIQEAFVP------------------------------------------WTWNWLKRRKARNHPQNLYSRWEHDGDLQTFGGLGLFNEYLEMVVQFGFITLFVASFPLAPLLALLNNILEIRVDSWKLTTQFKRPVAAKAHSIGVWQEILNGIAILSVVTNAFIVAFTSDMIPRLVYYYAYSQDEGTPMSGYIGSSLSVFNVSDFKEQSMPMEND---MNVISCRYRDYRYPPGHEKEYQVTMQYWHILAAKMAFIIIMEHVVFLVKFFVAWLIPDVPSEVKARVKREKFLTQKILHEYELEKLKQ---------------KLCNKNEPLSNDKEFIATKGKVALSAA 874          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO5 (anoctamin 5 [Source:NCBI gene;Acc:100489787])

HSP 1 Score: 542.732 bits (1397), Expect = 2.993e-179
Identity = 339/916 (37.01%), Postives = 510/916 (55.68%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDG--VHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF--DDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGS-----------YTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWT-LNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFGIGGRPSNQLANINFPRHSNKSKRSLEGKY*LSVA 2757
            IDFV+ Y   T         RR++FE NL   G++L   D     +    FV +  PW++L  +A+ + +KMPLK   +K      E+++S V  LF + Q    P    + + FR DKQE+F  +  E FF+ S R+ I Y IL R  +  ++ +   GI RL+  G YL AYPLH+ ++    K +    ER  LY +WA    F + QP++LIRKY+GEKI IYFAWLG YT  L   +++G F F Y  I   +                 S EIC+    G  +MCP+CD+ C++W L  +C  S+ + +FDN  T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C  ++ N +T E E ++    K  R   S  TV F I +++      I+  I+    +Y A  +I+ +             +L TS  A+ ++   I+ILN LY+ +A+ +TD E PRT  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G P  Y Y FG WR EECDPAGCL+EL+ Q+ ++  GKQI  NI E  +P                                             N + +   +N PQ     WE D  L     L +F+EYLEMV+Q+GF+T+F A+ PLAPL AL NNI+EIR+D++K+ T+++RP+A +A  IG+W +IL  I+I+SVV+NAFI+++TS  +P+LVY Y Y+    T ++GY+  +LSVFN+S+F+  ++P+       N+  CRYRD+R       EY V++ YWH+LAA++AF+I+ EHVVF +   + W+IP V   +K R+++EK L  K++ + E E+LKQ               +L N N P  ++K   + +GK  LS A
Sbjct:   30 IDFVLSYTEDTGKDAEKKAERRREFELNLQKSGLELETEDKKESENGKTYFVKIHAPWEVLTTYAEVLNLKMPLKADDLK---DDSENILSHVLKLFKLPQEVMYPEPDYFTAPFRKDKQELFRTEEREKFFTPSTRNRIVYYILSRCHYGEEEGKKKFGIKRLLTNGSYLDAYPLHDCQYWK--KTDERNCERYTLYTHWAKFTRFYKEQPLDLIRKYYGEKIGIYFAWLGFYTEMLFYAAVVGFFCFLYGWITMDDSIS--------------SKEICDPNIGGQIIMCPLCDKRCEFWRLNSTCEPSQYSHMFDNVATLFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYESKCTEKKKNPVTQEMEPYLPATSKAARFCFSGATVLFWIALII----ASIIAIIVYRLWVYAAFASIMDNNLALKPVSNLLTPQLATSVTASVLNFVTIMILNFLYERVAIWITDMEIPRTHLEYENRLTMKMFLFQFVNYYSSCFYVAFFKGKFVGYPADYSYLFGKWRNEECDPAGCLIELTTQLTIVMAGKQIWGNIQEAFVP------------------------------------------WTWNWLKRRKARNHPQNLYSRWEHDGDLQTFGGLGLFNEYLEMVVQFGFITLFVASFPLAPLLALLNNILEIRVDSWKLTTQFKRPVAAKAHSIGVWQEILNGIAILSVVTNAFIVAFTSDMIPRLVYYYAYSQDEGTPMSGYIGSSLSVFNVSDFKEQSMPMEND---MNVISCRYRDYRYPPGHEKEYQVTMQYWHILAAKMAFIIIMEHVVFLVKFFVAWLIPDVPSEVKARVKREKFLTQKILHEYELEKLKQ---------------KLCNKNEPLSNDKEFIATKGKVALSAA 862          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO5 (anoctamin 5 [Source:NCBI gene;Acc:100489787])

HSP 1 Score: 539.65 bits (1389), Expect = 6.884e-178
Identity = 329/874 (37.64%), Postives = 495/874 (56.64%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDG--VHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF--DDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGS-----------YTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWT-LNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            IDFV+ Y   T         RR++FE NL   G++L   D     +    FV +  PW++L  +A+ + +KMPLK   +K      E+++S V  LF + Q    P    + + FR DKQE+F  +  E FF+ S R+ I Y IL R  +  ++ +   GI RL+  G YL AYPLH+ ++    K +    ER  LY +WA    F + QP++LIRKY+GEKI IYFAWLG YT  L   +++G F F Y  I   +                 S EIC+    G  +MCP+CD+ C++W L  +C  S+ + +FDN  T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C  ++ N +T E E ++    K  R   S  TV F I +++      I+  I+    +Y A  +I+ +             +L TS  A+ ++   I+ILN LY+ +A+ +TD E PRT  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G P  Y Y FG WR EECDPAGCL+EL+ Q+ ++  GKQI  NI E  +P                                             N + +   +N PQ     WE D  L     L +F+EYLEMV+Q+GF+T+F A+ PLAPL AL NNI+EIR+D++K+ T+++RP+A +A  IG+W +IL  I+I+SVV+NAFI+++TS  +P+LVY Y Y+    T ++GY+  +LSVFN+S+F+  ++P+       N+  CRYRD+R       EY V++ YWH+LAA++AF+I+ EHVVF +   + W+IP V   +K R+++EK L  K++ + E E+LKQ
Sbjct:   42 IDFVLSYTEDTGKDAEKKAERRREFELNLQKSGLELETEDKKESENGKTYFVKIHAPWEVLTTYAEVLNLKMPLKADDLK---DDSENILSHVLKLFKLPQEVMYPEPDYFTAPFRKDKQELFRTEEREKFFTPSTRNRIVYYILSRCHYGEEEGKKKFGIKRLLTNGSYLDAYPLHDCQYWK--KTDERNCERYTLYTHWAKFTRFYKEQPLDLIRKYYGEKIGIYFAWLGFYTEMLFYAAVVGFFCFLYGWITMDDSIS--------------SKEICDPNIGGQIIMCPLCDKRCEFWRLNSTCEPSQYSHMFDNVATLFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYESKCTEKKKNPVTQEMEPYLPATSKAARFCFSGATVLFWIALII----ASIIAIIVYRLWVYAAFASIMDNNLALKPVSNLLTPQLATSVTASVLNFVTIMILNFLYERVAIWITDMEIPRTHLEYENRLTMKMFLFQFVNYYSSCFYVAFFKGKFVGYPADYSYLFGKWRNEECDPAGCLIELTTQLTIVMAGKQIWGNIQEAFVP------------------------------------------WTWNWLKRRKARNHPQNLYSRWEHDGDLQTFGGLGLFNEYLEMVVQFGFITLFVASFPLAPLLALLNNILEIRVDSWKLTTQFKRPVAAKAHSIGVWQEILNGIAILSVVTNAFIVAFTSDMIPRLVYYYAYSQDEGTPMSGYIGSSLSVFNVSDFKEQSMPMEND---MNVISCRYRDYRYPPGHEKEYQVTMQYWHILAAKMAFIIIMEHVVFLVKFFVAWLIPDVPSEVKARVKREKFLTQKILHEYELEKLKQ 847          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO5 (anoctamin 5 [Source:NCBI gene;Acc:100489787])

HSP 1 Score: 538.88 bits (1387), Expect = 1.230e-177
Identity = 332/900 (36.89%), Postives = 501/900 (55.67%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDG--VHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF--DDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGS-----------YTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWT-LNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFGIGGRPSNQLANINFPRHS 2709
            IDFV+ Y   T         RR++FE NL   G++L   D     +    FV +  PW++L  +A+ + +KMPLK   +K      E+++S V  LF + Q    P    + + FR DKQE+F  +  E FF+ S R+ I Y IL R  +  ++ +   GI RL+  G YL AYPLH+ ++    K +    ER  LY +WA    F + QP++LIRKY+GEKI IYFAWLG YT  L   +++G F F Y  I   +                 S EIC+    G  +MCP+CD+ C++W L  +C  S+ + +FDN  T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C  ++ N +T E E ++    K  R   S  TV F I +++      I+  I+    +Y A  +I+ +             +L TS  A+ ++   I+ILN LY+ +A+ +TD E PRT  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G P  Y Y FG WR EECDPAGCL+EL+ Q+ ++  GKQI  NI E  +P                                             N + +   +N PQ     WE D  L     L +F+EYLEMV+Q+GF+T+F A+ PLAPL AL NNI+EIR+D++K+ T+++RP+A +A  IG+W +IL  I+I+SVV+NAFI+++TS  +P+LVY Y Y+    T ++GY+  +LSVFN+S+F+  ++P+       N+  CRYRD+R       EY V++ YWH+LAA++AF+I+ EHVVF +   + W+IP V   +K R+++EK L  K++ + E E+LKQ   +    +      Q  N  +   S
Sbjct:   42 IDFVLSYTEDTGKDAEKKAERRREFELNLQKSGLELETEDKKESENGKTYFVKIHAPWEVLTTYAEVLNLKMPLKADDLK---DDSENILSHVLKLFKLPQEVMYPEPDYFTAPFRKDKQELFRTEEREKFFTPSTRNRIVYYILSRCHYGEEEGKKKFGIKRLLTNGSYLDAYPLHDCQYWK--KTDERNCERYTLYTHWAKFTRFYKEQPLDLIRKYYGEKIGIYFAWLGFYTEMLFYAAVVGFFCFLYGWITMDDSIS--------------SKEICDPNIGGQIIMCPLCDKRCEFWRLNSTCEPSQYSHMFDNVATLFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYESKCTEKKKNPVTQEMEPYLPATSKAARFCFSGATVLFWIALII----ASIIAIIVYRLWVYAAFASIMDNNLALKPVSNLLTPQLATSVTASVLNFVTIMILNFLYERVAIWITDMEIPRTHLEYENRLTMKMFLFQFVNYYSSCFYVAFFKGKFVGYPADYSYLFGKWRNEECDPAGCLIELTTQLTIVMAGKQIWGNIQEAFVP------------------------------------------WTWNWLKRRKARNHPQNLYSRWEHDGDLQTFGGLGLFNEYLEMVVQFGFITLFVASFPLAPLLALLNNILEIRVDSWKLTTQFKRPVAAKAHSIGVWQEILNGIAILSVVTNAFIVAFTSDMIPRLVYYYAYSQDEGTPMSGYIGSSLSVFNVSDFKEQSMPMEND---MNVISCRYRDYRYPPGHEKEYQVTMQYWHILAAKMAFIIIMEHVVFLVKFFVAWLIPDVPSEVKARVKREKFLTQKILHEYELEKLKQKLCNKNEPLSNDKEEQDNNHGYVARS 873          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO4 (major histocompatibility complex class I-related gene protein-like [Source:Xenbase;Acc:XB-GENE-5756215])

HSP 1 Score: 529.25 bits (1362), Expect = 2.233e-174
Identity = 315/868 (36.29%), Postives = 519/868 (59.79%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMV------KPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKF--KDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYE-KNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSW-------TLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPE-YSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            ID+++VY  ++     L   +R+ FE+N+  +G+ L K   + +  + FV +  PW++L ++A+ M ++MP +  +       K   S    L+   P      ++ D+     Y + F   +   F ++  + FF+ + R+ I + IL R ++++ ++ +G++RL+    Y AA+PLHEG +  K+++K + +++ R +L+E WA+   + +YQP++L+R+YFGEKI +YFAWLG YT  L P +++G+F F Y +    +                +S EIC    I    MCP+CD+ C Y  L +SC+++K+  +FDNS T+ F++ +++W +VFL+FWKR++  + + W+  D+EE E+  R  +E K  + +R+N I+G+ E +    DK  R + S   +FFMI VV++ + G+++ R++  S     ++ +I + +++ T+G A  ++ C I++LNVLY+ +A+ LT+ E PRT++E++++ TLKM++FQF N   S FYIA+F G F GRPG+Y      WR EEC P+GCL++L +QM +I V KQ  NN ME+  P+I+  W     + +H   GK+                                  LPQWEKD+ L   N   +F+EYLEM++Q+GF T+F AA PLAPL AL NNIIEIR+DAYK +T+WRRPLA +A+DIGIW+ IL+ I I+SV++NAF+I+ TS  +P+LVY Y Y   +         + GYVN +LSVF +++F+  +   +P                    S PE Y+ ++ +WHVLAARLAF+IV+EH+VFF+  LI+++IP +   ++ R+ +EK L  ++M++AE E++++
Sbjct:   23 IDYILVYRKTS-----LQSEKREIFERNIRAEGLHLEKESSIVNSDIIFVKLHAPWEVLGRYAELMNVRMPFRRKIYYLHRRYKFMSSRFRGLLPKKPMRLDKEKIPDLEENDCYTAPFSQQRIHHFIINNKDTFFNNATRTRIVHHILQRVKYEEGKNKIGLNRLLTNCTYEAAFPLHEGSYRSKNSIKTHGAENHRHLLFECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAIVGLFVFLYGMFTLDSCQ--------------VSREICQATNI---TMCPLCDKYCPYMRLSDSCIYAKVTHLFDNSATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERVNPISGKPEPYQAFADKCSRLVVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYERVALFLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGRPGAYLRLINKWRLEECHPSGCLIDLCLQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKLRQEHGIHGKTA---------------------------------LPQWEKDYNLQPINPYGLFEEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFITQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAVTSDFIPRLVYAYKYGPCAGQGRAGEKCMVGYVNASLSVFLVTDFENHSNSSHP-------------------PSAPEPYAYTLQFWHVLAARLAFIIVFEHLVFFIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERVQK 816          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano4 (anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344])

HSP 1 Score: 544.658 bits (1402), Expect = 2.267e-179
Identity = 321/875 (36.69%), Postives = 521/875 (59.54%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPP------------LSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKF--KDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYE-KNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSW-------TLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITV--CRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            ID+++VY  S    +     +R+ FE+N+  +G+++ K   + +  + FV +  PW++L ++A+ M ++MP +  +   P            +S     +   P       L D+     Y + F   +   F +   + FF+ + RS I + IL R ++++ ++ +G++RL+  G Y AA+PLHEG +  K+++K + + + R +LYE WA+   + +YQP++L+R+YFGEKI +YFAWLG YT  L P + +G+F F Y +    +                +S E+C    I   +MCP+CD+ C +  L +SC+++K+  +FDN  T+ F++ +++W +VFL+FWKR++  + + W+  D+EE E+  R  +E K  + +R+N I+G+ E +    DK  R + S   +FFMI VV++ + G+++ R++  S     ++ +I + +++ T+G A  ++ C I++LNVLY+ +A+ LT+ E PRT++E++++ TLKM++FQF N   S FYIA+F G F G PG+Y      WR EEC P+GCL++L +QM +I V KQ  NN ME+  P+I+  W     + +H               TE  +                   N PQWEKD+ L   N   +FDEYLEM++Q+GF T+F AA PLAPL AL NNIIEIR+DAYK +T+WRRPLA +A+DIGIW+ IL+ I I+SV++NAF+I+ TS  +P+LVY Y Y   +         + GYVN +LSVF IS+F+  + P +    F    +  CRYRD+R+   S   Y  ++ +WHVLAARLAF+IV+EH+VF +  LI+++IP +   ++ R+ +EK L  ++M++AE E+L++
Sbjct:   84 IDYILVYRKSNPQTE-----KREVFERNIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIHNKDTFFNNATRSRIVHHILQRIKYEEGKNKIGLNRLLTNGSYEAAFPLHEGSYRSKNSIKTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDH--------------CQVSKEVCQATDI---IMCPVCDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPEPYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEH--------------GTERKI-------------------NFPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSLAPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQK 903          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano4 (anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344])

HSP 1 Score: 544.658 bits (1402), Expect = 2.267e-179
Identity = 321/875 (36.69%), Postives = 521/875 (59.54%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPP------------LSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKF--KDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYE-KNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSW-------TLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITV--CRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            ID+++VY  S    +     +R+ FE+N+  +G+++ K   + +  + FV +  PW++L ++A+ M ++MP +  +   P            +S     +   P       L D+     Y + F   +   F +   + FF+ + RS I + IL R ++++ ++ +G++RL+  G Y AA+PLHEG +  K+++K + + + R +LYE WA+   + +YQP++L+R+YFGEKI +YFAWLG YT  L P + +G+F F Y +    +                +S E+C    I   +MCP+CD+ C +  L +SC+++K+  +FDN  T+ F++ +++W +VFL+FWKR++  + + W+  D+EE E+  R  +E K  + +R+N I+G+ E +    DK  R + S   +FFMI VV++ + G+++ R++  S     ++ +I + +++ T+G A  ++ C I++LNVLY+ +A+ LT+ E PRT++E++++ TLKM++FQF N   S FYIA+F G F G PG+Y      WR EEC P+GCL++L +QM +I V KQ  NN ME+  P+I+  W     + +H               TE  +                   N PQWEKD+ L   N   +FDEYLEM++Q+GF T+F AA PLAPL AL NNIIEIR+DAYK +T+WRRPLA +A+DIGIW+ IL+ I I+SV++NAF+I+ TS  +P+LVY Y Y   +         + GYVN +LSVF IS+F+  + P +    F    +  CRYRD+R+   S   Y  ++ +WHVLAARLAF+IV+EH+VF +  LI+++IP +   ++ R+ +EK L  ++M++AE E+L++
Sbjct:   84 IDYILVYRKSNPQTE-----KREVFERNIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIHNKDTFFNNATRSRIVHHILQRIKYEEGKNKIGLNRLLTNGSYEAAFPLHEGSYRSKNSIKTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDH--------------CQVSKEVCQATDI---IMCPVCDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPEPYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEH--------------GTERKI-------------------NFPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSLAPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQK 903          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano4 (anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344])

HSP 1 Score: 545.428 bits (1404), Expect = 3.093e-179
Identity = 321/875 (36.69%), Postives = 521/875 (59.54%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPP------------LSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKF--KDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYE-KNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSW-------TLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITV--CRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            ID+++VY  S    +     +R+ FE+N+  +G+++ K   + +  + FV +  PW++L ++A+ M ++MP +  +   P            +S     +   P       L D+     Y + F   +   F +   + FF+ + RS I + IL R ++++ ++ +G++RL+  G Y AA+PLHEG +  K+++K + + + R +LYE WA+   + +YQP++L+R+YFGEKI +YFAWLG YT  L P + +G+F F Y +    +                +S E+C    I   +MCP+CD+ C +  L +SC+++K+  +FDN  T+ F++ +++W +VFL+FWKR++  + + W+  D+EE E+  R  +E K  + +R+N I+G+ E +    DK  R + S   +FFMI VV++ + G+++ R++  S     ++ +I + +++ T+G A  ++ C I++LNVLY+ +A+ LT+ E PRT++E++++ TLKM++FQF N   S FYIA+F G F G PG+Y      WR EEC P+GCL++L +QM +I V KQ  NN ME+  P+I+  W     + +H               TE  +                   N PQWEKD+ L   N   +FDEYLEM++Q+GF T+F AA PLAPL AL NNIIEIR+DAYK +T+WRRPLA +A+DIGIW+ IL+ I I+SV++NAF+I+ TS  +P+LVY Y Y   +         + GYVN +LSVF IS+F+  + P +    F    +  CRYRD+R+   S   Y  ++ +WHVLAARLAF+IV+EH+VF +  LI+++IP +   ++ R+ +EK L  ++M++AE E+L++
Sbjct:  119 IDYILVYRKSNPQTE-----KREVFERNIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIHNKDTFFNNATRSRIVHHILQRIKYEEGKNKIGLNRLLTNGSYEAAFPLHEGSYRSKNSIKTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDH--------------CQVSKEVCQATDI---IMCPVCDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPEPYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEH--------------GTERKI-------------------NFPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSLAPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQK 938          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano6 (anoctamin 6 [Source:MGI Symbol;Acc:MGI:2145890])

HSP 1 Score: 523.472 bits (1347), Expect = 2.399e-171
Identity = 344/932 (36.91%), Postives = 521/932 (55.90%), Query Frame = 1
Query:   19 FREMEFQEFPNKQFQEPSS--FMD----IDFVIVYDIST---DNAKHLNQTRRKK---FEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVK--PPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQD--DVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINFITGEWEW-HMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYT------------KLLTSGLAA-----FMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISK---TNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRY------YYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFGIGGRPSNQL 2682
            FR  EF+EF  K    P S  F D    IDF++VY+  +   +N K  N+ +++K   +E NL   G++L     V D  L FV +  PW++L  +A+ M +K+PLK   +K   P   L    ++   +  V++    P ++ + + F   +   F +   + FF+ + RS I Y IL R ++  + +    GI+RL+ +G+Y AA+PLH+ +F    ++ +  SER +LY  WA PRS  + QP++LIRKY+GEKI IYFAWLG YT  L+  +++G+  F Y  ++  N               + S E+C+    G  +MCP CD  C +W L  +C  SK   IFD+  T+IF++ + +W ++FL+FWKR+Q +L++ W+T + ++ E  R +YE  C    IN IT E E        K +R       VFF I +++           +I  ++YR    I+ S T            K LT  +A       +    I+ILN +Y+ +A+ +T+FE PRTQT+Y+++LT+KM++FQF N+Y S FYIA+FKG F+G PG   Y  G +R EECDP GCL+EL+ Q+ +I  GK I NNI E+ LP +                                        +N  G  K    + K  P+WE+D+ L    +L +F EYLEM+IQ+GFVT+F A+ PLAPL AL NNI+EIR+DA+K+ T++RR +  +AQDIG W  I+Q I+I++VV+NA II++TS  +P+LVY +      Y +H  +T++GY+N TLSVFNI++F+  +   NP     N T+CRYRDFR       EY  +I YWHV+AA+LAF+IV EH+++ +   I++ IP VS   K +I++EK L  KL+ ++  + L +        IGG   N +
Sbjct:   47 FRTPEFEEFNGK----PDSLFFTDGQRRIDFILVYEDESKKENNKKGTNEKQKRKRQAYESNLICHGLQLEATRSVSDDKLVFVKVHAPWEVLCTYAEIMHIKLPLKPNDLKTRSPFGNL----NWFTKVLRVNESVIKPEQEFFTAPFEKSRMNDFYILDRDSFFNPATRSRIVYFILSRVKYQVMNNVNKFGINRLVSSGIYKAAFPLHDCRFNYESEDISCPSERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIYFAWLGYYTQMLLLAAVVGVACFLYGYLDQDN--------------CTWSKEVCDPDIGGQILMCPQCDRLCPFWRLNITCESSKKLCIFDSFGTLIFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARPEYEAQCNHVVINEITQEEERIPFTTCGKCIRVTLCASAVFFWILLII---------ASVIGIIVYRLSVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYEKVAIMITNFELPRTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYLLGKYRSEECDPGGCLLELTTQLTIIMGGKAIWNNIQEVLLPWV----------------------------------------MNLIGRYKRVSGSEKITPRWEQDYHLQPMGKLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKLTTQFRRMVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSIPPYGDHTYYTMDGYINNTLSVFNITDFKNTD-KENPYIGLGNYTLCRYRDFRNPPGHPQEYKHNIYYWHVIAAKLAFIIVMEHIIYSVKFFISYAIPDVSKITKSKIKREKYLTQKLLHESHLKDLTKNMGIIAERIGGTVDNSV 906          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano6 (anoctamin 6 [Source:MGI Symbol;Acc:MGI:2145890])

HSP 1 Score: 523.472 bits (1347), Expect = 4.610e-171
Identity = 344/932 (36.91%), Postives = 521/932 (55.90%), Query Frame = 1
Query:   19 FREMEFQEFPNKQFQEPSS--FMD----IDFVIVYDIST---DNAKHLNQTRRKK---FEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVK--PPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQD--DVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINFITGEWEW-HMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYT------------KLLTSGLAA-----FMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISK---TNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRY------YYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFGIGGRPSNQL 2682
            FR  EF+EF  K    P S  F D    IDF++VY+  +   +N K  N+ +++K   +E NL   G++L     V D  L FV +  PW++L  +A+ M +K+PLK   +K   P   L    ++   +  V++    P ++ + + F   +   F +   + FF+ + RS I Y IL R ++  + +    GI+RL+ +G+Y AA+PLH+ +F    ++ +  SER +LY  WA PRS  + QP++LIRKY+GEKI IYFAWLG YT  L+  +++G+  F Y  ++  N               + S E+C+    G  +MCP CD  C +W L  +C  SK   IFD+  T+IF++ + +W ++FL+FWKR+Q +L++ W+T + ++ E  R +YE  C    IN IT E E        K +R       VFF I +++           +I  ++YR    I+ S T            K LT  +A       +    I+ILN +Y+ +A+ +T+FE PRTQT+Y+++LT+KM++FQF N+Y S FYIA+FKG F+G PG   Y  G +R EECDP GCL+EL+ Q+ +I  GK I NNI E+ LP +                                        +N  G  K    + K  P+WE+D+ L    +L +F EYLEM+IQ+GFVT+F A+ PLAPL AL NNI+EIR+DA+K+ T++RR +  +AQDIG W  I+Q I+I++VV+NA II++TS  +P+LVY +      Y +H  +T++GY+N TLSVFNI++F+  +   NP     N T+CRYRDFR       EY  +I YWHV+AA+LAF+IV EH+++ +   I++ IP VS   K +I++EK L  KL+ ++  + L +        IGG   N +
Sbjct:   68 FRTPEFEEFNGK----PDSLFFTDGQRRIDFILVYEDESKKENNKKGTNEKQKRKRQAYESNLICHGLQLEATRSVSDDKLVFVKVHAPWEVLCTYAEIMHIKLPLKPNDLKTRSPFGNL----NWFTKVLRVNESVIKPEQEFFTAPFEKSRMNDFYILDRDSFFNPATRSRIVYFILSRVKYQVMNNVNKFGINRLVSSGIYKAAFPLHDCRFNYESEDISCPSERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIYFAWLGYYTQMLLLAAVVGVACFLYGYLDQDNC--------------TWSKEVCDPDIGGQILMCPQCDRLCPFWRLNITCESSKKLCIFDSFGTLIFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARPEYEAQCNHVVINEITQEEERIPFTTCGKCIRVTLCASAVFFWILLII---------ASVIGIIVYRLSVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYEKVAIMITNFELPRTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYLLGKYRSEECDPGGCLLELTTQLTIIMGGKAIWNNIQEVLLPWV----------------------------------------MNLIGRYKRVSGSEKITPRWEQDYHLQPMGKLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKLTTQFRRMVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSIPPYGDHTYYTMDGYINNTLSVFNITDFKNTD-KENPYIGLGNYTLCRYRDFRNPPGHPQEYKHNIYYWHVIAAKLAFIIVMEHIIYSVKFFISYAIPDVSKITKSKIKREKYLTQKLLHESHLKDLTKNMGIIAERIGGTVDNSV 927          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q8C5H1|ANO4_MOUSE (Anoctamin-4 OS=Mus musculus OX=10090 GN=Ano4 PE=1 SV=2)

HSP 1 Score: 545.428 bits (1404), Expect = 2.163e-178
Identity = 321/875 (36.69%), Postives = 521/875 (59.54%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPP------------LSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKF--KDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYE-KNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSW-------TLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITV--CRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            ID+++VY  S    +     +R+ FE+N+  +G+++ K   + +  + FV +  PW++L ++A+ M ++MP +  +   P            +S     +   P       L D+     Y + F   +   F +   + FF+ + RS I + IL R ++++ ++ +G++RL+  G Y AA+PLHEG +  K+++K + + + R +LYE WA+   + +YQP++L+R+YFGEKI +YFAWLG YT  L P + +G+F F Y +    +                +S E+C    I   +MCP+CD+ C +  L +SC+++K+  +FDN  T+ F++ +++W +VFL+FWKR++  + + W+  D+EE E+  R  +E K  + +R+N I+G+ E +    DK  R + S   +FFMI VV++ + G+++ R++  S     ++ +I + +++ T+G A  ++ C I++LNVLY+ +A+ LT+ E PRT++E++++ TLKM++FQF N   S FYIA+F G F G PG+Y      WR EEC P+GCL++L +QM +I V KQ  NN ME+  P+I+  W     + +H               TE  +                   N PQWEKD+ L   N   +FDEYLEM++Q+GF T+F AA PLAPL AL NNIIEIR+DAYK +T+WRRPLA +A+DIGIW+ IL+ I I+SV++NAF+I+ TS  +P+LVY Y Y   +         + GYVN +LSVF IS+F+  + P +    F    +  CRYRD+R+   S   Y  ++ +WHVLAARLAF+IV+EH+VF +  LI+++IP +   ++ R+ +EK L  ++M++AE E+L++
Sbjct:  119 IDYILVYRKSNPQTE-----KREVFERNIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIHNKDTFFNNATRSRIVHHILQRIKYEEGKNKIGLNRLLTNGSYEAAFPLHEGSYRSKNSIKTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDH--------------CQVSKEVCQATDI---IMCPVCDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPEPYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEH--------------GTERKI-------------------NFPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSLAPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQK 938          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q32M45|ANO4_HUMAN (Anoctamin-4 OS=Homo sapiens OX=9606 GN=ANO4 PE=2 SV=1)

HSP 1 Score: 543.502 bits (1399), Expect = 1.358e-177
Identity = 319/875 (36.46%), Postives = 521/875 (59.54%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPP------------LSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKF--KDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYE-KNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSW-------TLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITV--CRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            ID+++VY  S    +     +R+ FE+N+  +G+++ K   + +  + FV +  PW++L ++A+ M ++MP +  +   P            +S     +   P       L D+     Y + F   +   F +   E FF+ + RS I + IL R ++++ ++ +G++RL+  G Y AA+PLHEG +  K++++ + +++ R +LYE WA+   + +YQP++L+R+YFGEKI +YFAWLG YT  L P + +G+F F Y +    +                +S E+C    I   +MCP+CD+ C +  L +SC+++K+  +FDN  T+ F++ +++W +VFL+FWKR++  + + W+  D+EE E+  R  +E K  + +R+N I+G+ E +    DK  R + S   +FFMI VV++ + G+++ R++  S     ++ +I + +++ T+G A  ++ C I++LNVLY+ +A+ LT+ E PRT++E++++ TLKM++FQF N   S FYIA+F G F G PG+Y      WR EEC P+GCL++L +QM +I V KQ  NN ME+  P+I+  W     + +H                E  ++                    PQWEKD+ L   N   +FDEYLEM++Q+GF T+F AA PLAPL AL NNIIEIR+DAYK +T+WRRPLA +A+DIGIW+ IL+ I I+SV++NAF+I+ TS  +P+LVY Y Y   +         + GYVN +LSVF IS+F+  + P +    F    +  CRYRD+R+   S   Y  ++ +WHVLAARLAF+IV+EH+VF +  LI+++IP +   ++ R+ +EK L  ++M++AE E+L++
Sbjct:  119 IDYILVYRKSNPQTE-----KREVFERNIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIHNKETFFNNATRSRIVHHILQRIKYEEGKNKIGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHS--------------QVSKEVCQATDI---IMCPVCDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPEPYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEH--------------GPERKIS-------------------FPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQK 938          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|A6QLE6|ANO4_BOVIN (Anoctamin-4 OS=Bos taurus OX=9913 GN=ANO4 PE=2 SV=1)

HSP 1 Score: 540.806 bits (1392), Expect = 5.007e-177
Identity = 319/875 (36.46%), Postives = 521/875 (59.54%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPP------------LSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKF--KDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYE-KNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSW-------TLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITV--CRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            ID+++VY  S    +     +R+ FE+N+  +G+++ K   + +  + FV +  PW++L ++A+ M ++MP +  +   P            +S     +   P       L D+     Y + F   +   F +   + FF+ + RS I + IL R ++++ ++ +G++RL+  G Y AA+PLHEG +  K++++ + + + R +LYE WA+   + +YQP++L+R+YFGEKI +YFAWLG YT  L P + +G+F F Y +I   +                +S E+C    I   +MCP+CD+ C +  L +SC+++K+  +FDN  T+ F++ +++W +VFL+FWKR++  + + W+  D+EE E+  R  +E K  + +R+N I+G+ E +    DK  R + S   +FFMI VV++ + G+++ R++  S     ++ +I + +++ T+G A  ++ C I++LNVLY+ +A+ LT+ E PRT++E++++ TLKM++FQF N   S FYIA+F G F G PG+Y      WR EEC P+GCL++L +QM +I V KQ  NN ME+  P+I+  W     + +H                E  ++                    PQWEKD+ L   N   +FDEYLEM++Q+GF T+F AA PLAPL AL NNIIEIR+DAYK +T+WRRPLA +A+DIGIW+ IL+ I I+SV++NAF+I+ TS  +P+LVY Y Y   +         + GYVN +LSVF IS+F+  + P +    F    +  CRYRD+R+   S   Y  ++ +WHVLAARLAF+IV+EH+VF +  LI+++IP +   ++ R+ +EK L  ++M++AE E+L++
Sbjct:   84 IDYILVYRKSNPQME-----KREVFERNIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIHNKDTFFNNATRSRIVHHILQRIKYEEGKNKIGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVITLDH--------------CQVSKEVCQATDI---IMCPVCDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPEPYQAFADKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEH--------------GPERKIS-------------------FPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQK 903          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q4KMQ2|ANO6_HUMAN (Anoctamin-6 OS=Homo sapiens OX=9606 GN=ANO6 PE=1 SV=2)

HSP 1 Score: 525.398 bits (1352), Expect = 3.663e-171
Identity = 342/908 (37.67%), Postives = 517/908 (56.94%), Query Frame = 1
Query:   10 QFPFREMEFQEFPNKQFQEPSS--FMD----IDFVIVYDIST---DNAKHLNQTRRKK---FEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQD--DVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINFITGEWE------WHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGS--YTKLLTSGLAA-----FMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRY------YYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            Q  FR  EF+EF  K    P S  F D    IDFV+VY+  +    N K  N+ +R+K   +E NL   G++L     V D  L FV +  PW++L  +A+ M +K+PLK   +K   S   +L  F   +  V +    P ++ + + F  ++   F +   + FF+ + RS I Y IL R ++  + +    GI+RL+ +G+Y AA+PLH+ KF+   ++ +  +ER +LY  WA PRS  + QP++LIRKY+GEKI IYFAWLG YT  L+  +++G+  F Y  +N  N               + S E+C+    G  +MCP CD  C +W L  +C  SK   IFD+  T++F++ + +W ++FL+FWKR+Q +L++ W+T + ++ E  R +YE  C    IN IT E E      W   ++  +      FF +  +I  V+ +I   + + I+ ++ L +    I G+    K LT   A       +    I+ILN +Y+ +A+ +T+FE PRTQT+Y+++LT+KM++FQF N+Y S FYIA+FKG F+G PG   Y+ G +R EECDP GCL+EL+ Q+ +I  GK I NNI E+ LP I       L    HR  G                                  K  P+WE+D+ L    +L +F EYLEM+IQ+GFVT+F A+ PLAPL AL NNI+EIR+DA+K+ T++RR +  +AQDIG W  I+Q I+I++VV+NA II++TS  +P+LVY +      Y +H S+T+ GY+N TLS+F +++F+  +   NP     N T CRYRDFR       EY  +I YWHV+AA+LAF+IV EHV++ +   I++ IP VS   K +I++EK L  KL+ +   + + +
Sbjct:   42 QHDFRTPEFEEFNGK----PDSLFFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLDDKLVFVKVHAPWEVLCTYAEIMHIKLPLKPNDLKNRSSAFGTLNWFT-KVLSVDESIIKPEQEFFTAPFEKNRMNDFYIVDRDAFFNPATRSRIVYFILSRVKYQVINNVSKFGINRLVNSGIYKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIYFAWLGYYTQMLLLAAVVGVACFLYGYLNQDN--------------CTWSKEVCHPDIGGKIIMCPQCDRLCPFWKLNITCESSKKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARPEYEARCTHVVINEITQEEERIPFTAWGKCIRITLCASAV-FFWILLIIASVIGIIVYRLSVFIVFSAKLPK---NINGTDPIQKYLTPQTATSITASIISFIIIMILNTIYEKVAIMITNFELPRTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPGGCLLELTTQLTIIMGGKAIWNNIQEVLLPWI-----MNLIGRFHRVSGSE--------------------------------KITPRWEQDYHLQPMGKLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKLTTQFRRLVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSVPPYGDHTSYTMEGYINNTLSIFKVADFKNKS-KGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIVMEHVIYSVKFFISYAIPDVSKRTKSKIQREKYLTQKLLHENHLKDMTK 888          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q6P9J9|ANO6_MOUSE (Anoctamin-6 OS=Mus musculus OX=10090 GN=Ano6 PE=1 SV=1)

HSP 1 Score: 523.472 bits (1347), Expect = 1.678e-170
Identity = 344/932 (36.91%), Postives = 521/932 (55.90%), Query Frame = 1
Query:   19 FREMEFQEFPNKQFQEPSS--FMD----IDFVIVYDIST---DNAKHLNQTRRKK---FEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVK--PPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQD--DVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINFITGEWEW-HMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYT------------KLLTSGLAA-----FMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISK---TNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRY------YYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFGIGGRPSNQL 2682
            FR  EF+EF  K    P S  F D    IDF++VY+  +   +N K  N+ +++K   +E NL   G++L     V D  L FV +  PW++L  +A+ M +K+PLK   +K   P   L    ++   +  V++    P ++ + + F   +   F +   + FF+ + RS I Y IL R ++  + +    GI+RL+ +G+Y AA+PLH+ +F    ++ +  SER +LY  WA PRS  + QP++LIRKY+GEKI IYFAWLG YT  L+  +++G+  F Y  ++  N               + S E+C+    G  +MCP CD  C +W L  +C  SK   IFD+  T+IF++ + +W ++FL+FWKR+Q +L++ W+T + ++ E  R +YE  C    IN IT E E        K +R       VFF I +++           +I  ++YR    I+ S T            K LT  +A       +    I+ILN +Y+ +A+ +T+FE PRTQT+Y+++LT+KM++FQF N+Y S FYIA+FKG F+G PG   Y  G +R EECDP GCL+EL+ Q+ +I  GK I NNI E+ LP +                                        +N  G  K    + K  P+WE+D+ L    +L +F EYLEM+IQ+GFVT+F A+ PLAPL AL NNI+EIR+DA+K+ T++RR +  +AQDIG W  I+Q I+I++VV+NA II++TS  +P+LVY +      Y +H  +T++GY+N TLSVFNI++F+  +   NP     N T+CRYRDFR       EY  +I YWHV+AA+LAF+IV EH+++ +   I++ IP VS   K +I++EK L  KL+ ++  + L +        IGG   N +
Sbjct:   47 FRTPEFEEFNGK----PDSLFFTDGQRRIDFILVYEDESKKENNKKGTNEKQKRKRQAYESNLICHGLQLEATRSVSDDKLVFVKVHAPWEVLCTYAEIMHIKLPLKPNDLKTRSPFGNL----NWFTKVLRVNESVIKPEQEFFTAPFEKSRMNDFYILDRDSFFNPATRSRIVYFILSRVKYQVMNNVNKFGINRLVSSGIYKAAFPLHDCRFNYESEDISCPSERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIYFAWLGYYTQMLLLAAVVGVACFLYGYLDQDN--------------CTWSKEVCDPDIGGQILMCPQCDRLCPFWRLNITCESSKKLCIFDSFGTLIFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARPEYEAQCNHVVINEITQEEERIPFTTCGKCIRVTLCASAVFFWILLII---------ASVIGIIVYRLSVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYEKVAIMITNFELPRTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYLLGKYRSEECDPGGCLLELTTQLTIIMGGKAIWNNIQEVLLPWV----------------------------------------MNLIGRYKRVSGSEKITPRWEQDYHLQPMGKLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKLTTQFRRMVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSIPPYGDHTYYTMDGYINNTLSVFNITDFKNTD-KENPYIGLGNYTLCRYRDFRNPPGHPQEYKHNIYYWHVIAAKLAFIIVMEHIIYSVKFFISYAIPDVSKITKSKIKREKYLTQKLLHESHLKDLTKNMGIIAERIGGTVDNSV 906          
BLAST of Anoctamin vs. TrEMBL
Match: A0A1S3K267 (Anoctamin OS=Lingula unguis OX=7574 GN=LOC106178187 PE=3 SV=1)

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 368/858 (42.89%), Postives = 534/858 (62.24%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVH--DKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRID--KQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDL-QDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNT--SKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSY-YYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPR-PIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLK 2628
            IDFV+ Y  S D +K   + +R  F++NL ++GV++   D     D+   F+ + +PW+++L++A+ M+MKMP+K   + P   + ++     P+ F V +    P    + +AF  +  KQ MF +   E FF+ +QRS +AYEIL R ++DD  +D  GI RLI  G + AAYPLHEGK+K      T  + +ER +L+E WA P  + +YQP++LIRKYFGEKI+IYF WLG YT  LIP S+ G+  F Y L     D                S EIC+  G G+  MCP+CD++C YW LY SC +S +   FDN  T++F++ +++W ++FL+ WKRKQ ++++ W+   +EE E+  R ++E   + ++ N +T   E  +    K  R +T+F  + FM+ +VL+ + GVI+ RI+I +L Y     ++    +L T+  AA ++L  I+ILN LYQF+A+ LT+ E  RTQTE++D+ T KM++FQ  NFY +LFYIA+FKG F+GRPG Y Y+  G+RQEECDPAGCL+EL IQ+++I VGKQ  NN  EI +P I                                       + N+  I +TNL    +WE+DF L     L +FDEYLEMV+QYGFVT+F AA PLAPLFAL NN+IEIR+DAYK +T+WRRPLA +AQDIGIW+ IL  +S++SV++NAFII +TS  VP+ +Y  +    +  L GY NF+LS F++ +FQ  +IP +P+  +F N+T C YRDFR   E +  Y+ ++ YWHVLAARLAFV+V+EHVVF L  ++ +IIP V   IKI++ +E  L  + ++ AE E+ K
Sbjct:  191 IDFVLAYKESNDVSK---EEKRMVFKRNLLDEGVEMETEDKSESTDEKTYFIKIHIPWEVMLRYAEMMRMKMPIKENDIDPTDDSEKT----CPNPFAVDEDIIKPEPNYFTAAFDRERMKQGMFVIKDKESFFTNAQRSRVAYEILARMRYDDTDKDKFGIKRLISNGAFAAAYPLHEGKYKTEHSVLTWGADNERVLLFEEWARPGRWYKYQPLDLIRKYFGEKIAIYFTWLGYYTMMLIPASICGLVVFIYGLATLSTDIP--------------SNEICDRSGPGNITMCPLCDKNCSYWRLYSSCRYSMVTYWFDNYGTMVFAVFMAVWATMFLEGWKRKQAEIEYEWDVAHFEEEEETVRPEFEATVRHKKKNPVTQTDEPFLPAWSKCFRYVTAFSVILFMLCLVLAAVFGVIIYRIVIVTLFYSTPDQLVAENARLATTATAAVINLVVIMILNRLYQFVALGLTNMELQRTQTEWEDSFTFKMFLFQCVNFYATLFYIAFFKGRFVGRPGDYDYHLLGFRQEECDPAGCLIELCIQLMIIMVGKQAFNNTKEIIIPKIMNFC----------------------------------RARNSKKIEETNLYT--RWEQDFDLGTMPPLGLFDEYLEMVLQYGFVTLFVAAFPLAPLFALINNVIEIRLDAYKFVTQWRRPLADRAQDIGIWWGILNTLSMLSVLTNAFIIGFTSEFVPKQLY-LFTQSTTGDLTGYTNFSLSSFDVKDFQNKSIPNDPKIDVFGNVTSCMYRDFR---EDHAPYNPTLTYWHVLAARLAFVLVFEHVVFLLRFIVAFIIPDVPGFIKIQMLRENYLAKEALYTAELEKSK 987          
BLAST of Anoctamin vs. TrEMBL
Match: A0A2C9JK88 (Anoctamin OS=Biomphalaria glabrata OX=6526 GN=106057607 PE=3 SV=1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 370/940 (39.36%), Postives = 550/940 (58.51%), Query Frame = 1
Query:   22 REMEFQEFPNKQFQEPSSFMD-----IDFVIVYDISTDNA-KHLNQTRRKKFEKNLFNKGVKL------SKVDGV----------------HDKALSFVLMIVPWDLLLKFADAMKMKMPL-KTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSA-FRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDV----GIDRLIKAGVYLAAYPLHEGKFKD--NLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSY-YYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIP-LNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFGIGGRPSNQLANINFPRHSNKSKRS 2727
            R+  +Q+  +++ +  S FMD     +D+V+VY + TD   ++  +T R+ F+++L  +G++L      SKV  V                 DK   +V +  PW++L K+A+   MKMPL K  M++      +S  S  P  F + + + +P    Y++A F   +   F M   E FFS +QRSL+ Y+IL+R  F+D+ D      GI  ++    Y AA+PLHEG++K   +L     +++R +LYE WA P ++ ++QP++ IR YFGEKI+IYF WLG YT  LIP  L+G+  F Y        +               S EIC++   G+Y MCP+CDE CDYW L  SC++S++  +FDN  T+ F+  ++LW +VF + WKR+  ++++ W+  D+E+ E  R +YE + + +RIN +T   E ++    K+ R  +S + V FM+ VV++ + GVI+ R+ + +LLY     II     ++TS  A+ ++L  I++L  +YQFIA  LT+FE  RT TE++D+ TLKM++FQF N + SLFYIA+FKG  +GRPG Y       RQEECDP+GC +EL IQ+ +I VGKQ  NN  E+ LP +                                      +S   N   +   + + QWEKD+ +    EL +FDEYLEMVIQYGFVT+F AA PLAPLFAL NNIIEIR+DAYK +T+WRRPL  +AQDIGIWF ILQ IS ++V+SNA II++TS  VP+LVY+Y Y+  S  +NGY+NF+LSVFN+S F+P +IP +    +F N+T CRYRDFR   E    Y  ++ +WH+L ARLAFV+V+   ++ LS LI++I+P +  ++K++I +EK L  +     E+E LK      G       S+  + +N  R  +  K +
Sbjct:  155 RDKLYQKVTHEE-ENTSLFMDDGKRRVDYVLVYLVDTDEENENQKKTWRENFQRSLEKEGLELEVTAMKSKVKPVVPINKLLKCCRSSQRGQDKKTYYVKVHAPWEVLTKYAELTNMKMPLAKNDMIE----HFQSCWSKCPSPFDIDK-EILPEIPDYFTAPFTRSRINQFIMQDKETFFSPAQRSLLTYQILLRAVFEDVGDPARNKFGIKNMLSNKSYEAAFPLHEGEYKSEHSLLTEGPRNQRHLLYETWAKPGAWYKFQPLDHIRLYFGEKIAIYFTWLGYYTGLLIPAGLVGLAIFIYGCARMPFHEA--------------SNEICSDSAPGNYTMCPLCDEHCDYWQLKSSCIYSRVTYLFDNEATVAFAAFMALWSTVFHEMWKRRAAEIEYDWDVADFEQEETIRPEYEASVRRRRINPVTKVEEPYLSFTSKLCRVTSSLWVVLFMLCVVVAAVFGVIVYRMTVRALLYAVGENIIRQRAGIITSVTASVINLIIIILLGKVYQFIAQMLTNFETHRTLTEWEDSFTLKMFLFQFVNHFASLFYIAFFKGKLVGRPGLYNRQINDSRQEECDPSGCFIELCIQLGIIMVGKQTFNNSKEVVLPKLLNWI----------------------------------KSRKINKAEEKKHEKVSQWEKDYAMDSMPELGLFDEYLEMVIQYGFVTIFVAAFPLAPLFALLNNIIEIRLDAYKFVTQWRRPLGMRAQDIGIWFGILQGISKVAVMSNAIIIAFTSEFVPKLVYQYSYSKNS-DINGYINFSLSVFNVSLFEPKSIPKVKNIELFGNVTECRYRDFRAPTEP---YDYTLEHWHILTARLAFVLVFVICIWLLSWLISYIVPDIPKAVKLQILREKYLARESAL--ESELLKNKSHHNGMEGKSHSSDPHSTVNGVRERHVDKTT 1034          
BLAST of Anoctamin vs. TrEMBL
Match: R7UV80 (Anoctamin OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_153854 PE=3 SV=1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 347/855 (40.58%), Postives = 513/855 (60.00%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLS---KVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLK---TTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSA-FRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPL-NPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQL 2625
            ID+++ Y   TD+ + ++   R KFE+NL  +G++L    K D   D    FV +  PWD+L + A+  KMKMP+K   T +           +S +P+   +     +P +  Y++A F  ++ +MF ++    FF+ +QRS I YE+L+RT++ +  D  GIDRLI+   Y AA+PLHE  F   ++  +     Q+LYE WA P  +  +QP +L+RKY+GEK+ IYF WLG YT  LIP S+LG+  F Y       +                S E+C+E G G+  MCP+CD  C YW L  SC++S++  +FDN  T+ F+  +++W ++FL+FWKRKQ +LQ+ W+  D++  E  R ++E  C+ +R+N +T   E  M +  +I R  TSF  V FMI  V+  + GVI+ R+++ +LLY      +  +  + TS  AA + L  I++LN LY+ +A+ LT+ E PRT++EY+D+ T KM++FQF N+Y SLFYIA+FKG   GRPG Y Y  G+R EECDPAGCL+EL IQ+ ++ +GKQ  NN  EI+LP I             R+ G  K                ++E+L T            +WE+D+ L     + +FDEYLEMVIQYGF T+F AA PLAPL AL NNIIEIR+DAYK+ T+ RR +A +AQDIGIW +ILQ I+ ++V++NAFII++TS  VP+LVYR  Y  +  TL+GYVN +LS F++ +FQ  +IP  N   +F ++T CRY+D RE   S   Y  +  +WH   A+LAFVI++EH+VFFL+ L+ +++P V   I++ + +E  L  +  + A    L
Sbjct:   10 IDYILAYH-DTDDIELISW--RDKFEENLKKEGLELETEHKKDS-QDGKTHFVKVHAPWDVLTRVAELTKMKMPIKEYDTNLYD------TGCLSKLPNPMLIED-GVIPEEPEYFTADFSRERMKMFIIEDQNTFFTNAQRSFIVYELLLRTRYTETSDKFGIDRLIRHAAYSAAFPLHE--FISFIQGISIGIYLQLLYETWARPGRWLYFQPTDLVRKYYGEKVGIYFTWLGFYTTMLIPASILGVIVFIYGCATLFKNPP--------------SEEVCDESGAGNLTMCPLCDRHCSYWKLKTSCMYSRLTYLFDNGGTVFFACFMAIWATLFLEFWKRKQAELQYDWDVADFDYEEHVRPEFEARCKKRRLNPVTQMMEPFMPIYSRIPRWCTSFSVVLFMICCVICAVFGVIMYRVVVVTLLYSVPNPYVQQFASITTSCTAAVISLIIIMLLNRLYEKVALFLTELERPRTESEYEDSYTFKMFLFQFINYYSSLFYIAFFKGRLAGRPGDYDYSLGYRAEECDPAGCLIELCIQLGIVMIGKQAYNNFKEITLPKIMNWM---------RSRGAKKNE--------------TEENLYT------------RWEQDYDLNAVPLMGLFDEYLEMVIQYGFTTIFVAAFPLAPLCALINNIIEIRLDAYKLTTQMRRSVALRAQDIGIWLNILQGITFMAVLTNAFIIAWTSDFVPKLVYR--YTQEPGTLDGYVNQSLSFFDVKDFQERSIPKNNASELFGDVTYCRYKDQREPPWSPNRYDYTSTHWHTFCAQLAFVIIFEHLVFFLTWLVAYLVPDVPARIRMLMLREVYLAKEAKYDASFSTL 800          
BLAST of Anoctamin vs. TrEMBL
Match: A0A2C9JK99 (Anoctamin OS=Biomphalaria glabrata OX=6526 GN=106057607 PE=3 SV=1)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 370/926 (39.96%), Postives = 544/926 (58.75%), Query Frame = 1
Query:   70 SSFMD-----IDFVIVYDISTDNA-KHLNQTRRKKFEKNLFNKGVKL------SKVDGV----------------HDKALSFVLMIVPWDLLLKFADAMKMKMPL-KTTMVKPPLSTLESLMSFVPDLFWVSQ--LDDVP-HKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDV----GIDRLIKAGVYLAAYPLHEGKFKD--NLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSY-YYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIP-LNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFGIGGRPSNQLANINFPRHSNKSKRS 2727
            S FMD     +D+V+VY + TD   ++  +T R+ F+++L  +G++L      SKV  V                 DK   +V +  PW++L K+A+   MKMPL K  M++      +S  S  P  F + +  L ++P +  A ++  RI+ Q  F M   E FFS +QRSL+ Y+IL+R  F+D+ D      GI  ++    Y AA+PLHEG++K   +L     +++R +LYE WA P ++ ++QP++ IR YFGEKI+IYF WLG YT  LIP  L+G+  F Y        +               S EIC++   G+Y MCP+CDE CDYW L  SC++S++  +FDN  T+ F+  ++LW +VF + WKR+  ++++ W+  D+E+ E  R +YE + + +RIN +T   E ++    K+ R  +S + V FM+ VV++ + GVI+ R+ + +LLY     II     ++TS  A+ ++L  I++L  +YQFIA  LT+FE  RT TE++D+ TLKM++FQF N + SLFYIA+FKG  +GRPG Y       RQEECDP+GC +EL IQ+ +I VGKQ  NN  E+ LP +                                      +S   N   +   + + QWEKD+ +    EL +FDEYLEMVIQYGFVT+F AA PLAPLFAL NNIIEIR+DAYK +T+WRRPL  +AQDIGIWF ILQ IS ++V+SNA II++TS  VP+LVY+Y Y+  S  +NGY+NF+LSVFN+S F+P +IP +    +F N+T CRYRDFR   E    Y  ++ +WH+L ARLAFV+V+   ++ LS LI++I+P +  ++K++I +EK L  +     E+E LK      G       S+  + +N  R  +  K +
Sbjct:  170 SLFMDDGKRRVDYVLVYLVDTDEENENQKKTWRENFQRSLEKEGLELEVTAMKSKVKPVVPINKLLKCCRSSQRGQDKKTYYVKVHAPWEVLTKYAELTNMKMPLAKNDMIE----HFQSCWSKCPSPFDIDKEILPEIPDYFTAPFTRSRIN-QGKFIMQDKETFFSPAQRSLLTYQILLRAVFEDVGDPARNKFGIKNMLSNKSYEAAFPLHEGEYKSEHSLLTEGPRNQRHLLYETWAKPGAWYKFQPLDHIRLYFGEKIAIYFTWLGYYTGLLIPAGLVGLAIFIYGCARMPFHEA--------------SNEICSDSAPGNYTMCPLCDEHCDYWQLKSSCIYSRVTYLFDNEATVAFAAFMALWSTVFHEMWKRRAAEIEYDWDVADFEQEETIRPEYEASVRRRRINPVTKVEEPYLSFTSKLCRVTSSLWVVLFMLCVVVAAVFGVIVYRMTVRALLYAVGENIIRQRAGIITSVTASVINLIIIILLGKVYQFIAQMLTNFETHRTLTEWEDSFTLKMFLFQFVNHFASLFYIAFFKGKLVGRPGLYNRQINDSRQEECDPSGCFIELCIQLGIIMVGKQTFNNSKEVVLPKLLNWI----------------------------------KSRKINKAEEKKHEKVSQWEKDYAMDSMPELGLFDEYLEMVIQYGFVTIFVAAFPLAPLFALLNNIIEIRLDAYKFVTQWRRPLGMRAQDIGIWFGILQGISKVAVMSNAIIIAFTSEFVPKLVYQYSYSKNS-DINGYINFSLSVFNVSLFEPKSIPKVKNIELFGNVTECRYRDFRAPTEP---YDYTLEHWHILTARLAFVLVFVICIWLLSWLISYIVPDIPKAVKLQILREKYLARESAL--ESELLKNKSHHNGMEGKSHSSDPHSTVNGVRERHVDKTT 1036          
BLAST of Anoctamin vs. TrEMBL
Match: A0A2C9JK92 (Anoctamin OS=Biomphalaria glabrata OX=6526 GN=106057607 PE=3 SV=1)

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 366/909 (40.26%), Postives = 542/909 (59.63%), Query Frame = 1
Query:   70 SSFMD-----IDFVIVYDISTDNA-KHLNQTRRKKFEKNLFNKGVKL--SKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPL-KTTMVKPPLSTLESLMSFVPDLFWVSQ--LDDVP-HKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDV----GIDRLIKAGVYLAAYPLHEGKFKD--NLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINFITGEW---EWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSY-YYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIP-LNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFGIGGRPSNQLANINFPRHSNKSKRS 2727
            S FMD     +D+V+VY + TD   ++  +T R+ F+++L  +G++L  + +    DK   +V +  PW++L K+A+   MKMPL K  M++      +S  S  P  F + +  L ++P +  A ++  RI+ Q  F M   E FFS +QRSL+ Y+IL+R  F+D+ D      GI  ++    Y AA+PLHEG++K   +L     +++R +LYE WA P ++ ++QP++ IR YFGEKI+IYF WLG YT  LIP  L+G+  F Y        +               S EIC++   G+Y MCP+CDE CDYW L  SC++S++  +FDN  T+ F+  ++LW +VF + WKR+  ++++ W+  D+E+ E  R +YE + + +RIN +T      E ++    K+ R  +S + V FM+ VV++ + GVI+ R+ + +LLY     II     ++TS  A+ ++L  I++L  +YQFIA  LT+FE  RT TE++D+ TLKM++FQF N + SLFYIA+FKG  +GRPG Y       RQEECDP+GC +EL IQ+ +I VGKQ  NN  E+ LP +                                      +S   N   +   + + QWEKD+ +    EL +FDEYLEMVIQYGFVT+F AA PLAPLFAL NNIIEIR+DAYK +T+WRRPL  +AQDIGIWF ILQ IS ++V+SNA II++TS  VP+LVY+Y Y+  S  +NGY+NF+LSVFN+S F+P +IP +    +F N+T CRYRDFR   E    Y  ++ +WH+L ARLAFV+V+   ++ LS LI++I+P +  ++K++I +EK L  +     E+E LK      G       S+  + +N  R  +  K +
Sbjct:  170 SLFMDDGKRRVDYVLVYLVDTDEENENQKKTWRENFQRSLEKEGLELEVTAMKRGQDKKTYYVKVHAPWEVLTKYAELTNMKMPLAKNDMIE----HFQSCWSKCPSPFDIDKEILPEIPDYFTAPFTRSRIN-QGKFIMQDKETFFSPAQRSLLTYQILLRAVFEDVGDPARNKFGIKNMLSNKSYEAAFPLHEGEYKSEHSLLTEGPRNQRHLLYETWAKPGAWYKFQPLDHIRLYFGEKIAIYFTWLGYYTGLLIPAGLVGLAIFIYGCARMPFHEA--------------SNEICSDSAPGNYTMCPLCDEHCDYWQLKSSCIYSRVTYLFDNEATVAFAAFMALWSTVFHEMWKRRAAEIEYDWDVADFEQEETIRPEYEASVRRRRINPVTKNGPVEEPYLSFTSKLCRVTSSLWVVLFMLCVVVAAVFGVIVYRMTVRALLYAVGENIIRQRAGIITSVTASVINLIIIILLGKVYQFIAQMLTNFETHRTLTEWEDSFTLKMFLFQFVNHFASLFYIAFFKGKLVGRPGLYNRQINDSRQEECDPSGCFIELCIQLGIIMVGKQTFNNSKEVVLPKLLNWI----------------------------------KSRKINKAEEKKHEKVSQWEKDYAMDSMPELGLFDEYLEMVIQYGFVTIFVAAFPLAPLFALLNNIIEIRLDAYKFVTQWRRPLGMRAQDIGIWFGILQGISKVAVMSNAIIIAFTSEFVPKLVYQYSYSKNS-DINGYINFSLSVFNVSLFEPKSIPKVKNIELFGNVTECRYRDFRAPTEP---YDYTLEHWHILTARLAFVLVFVICIWLLSWLISYIVPDIPKAVKLQILREKYLARESAL--ESELLKNKSHHNGMEGKSHSSDPHSTVNGVRERHVDKTT 1019          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 520.776 bits (1340), Expect = 8.339e-171
Identity = 338/909 (37.18%), Postives = 508/909 (55.89%), Query Frame = 1
Query:   49 NKQFQEPSS--FMD----IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVH--DKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDV--PHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF---DDL-QDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRA-------RYTIIGSY--TKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFF---GWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRY-YYNHKSWTLNGYVNFTLSVFNISNFQPANIP---LNPRPIFQN--ITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFG 2655
            +KQ Q   S  F D    IDFV+ Y    ++ +   Q RRK +E+N+   G++L   D     D    F+ +  PW++L  +AD +K+K+P K   + P    +     F P L      D V  P    + S F   K + F +D  E  F  S R+ I Y IL R  +   D++ +D  GI RL+  G Y +A+PLH+ ++    ++   +SER  LY YWA    F + QP+ LIRKY+GEKI IYFAWLG YT  L   +L+G+  F Y    Y  DD    K            EIC++   G  VMCP+CD+ C +W L  +C  +  + +FDN+ T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C S+R N +T E E +  +  K  R   S  TV F I+++++ I GVI  R+ + + L          +  ++GS    +L TS  A+ ++   I+ILN  Y+ +A+ +TD E P+T  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G PG Y Y F   G R EECDP GCL+EL+ Q++++  GKQ+  NI E  LP +                                           N  S    ++ P+     WE+D+ L + ++  +F EYLEMVIQ+GF+T+F A+ PLAPL AL NNI+E+R+DA+K+ T++RRP+A +A  IG W +IL +I++ SVV+NAFI+++TS  +P+LVY Y Y+     T+ GYVN +LS+FNIS     N P    NP   F N  IT CRYRD+R       EYS ++ +WH+LAA++AF+I+ EHVVF +  L+ W+IP V   ++ R+++E+ L  + +   E ++LK+   + G G
Sbjct:   13 DKQHQSKDSVYFRDGKRRIDFVLSY---IEDKEDRKQERRKLYEENMQKAGLELELEDKTESEDGKTYFLKIHAPWEVLATYADVLKIKVPFKVNDI-PENREIPVSWLFTPLLL----PDHVMRPDPDYFTSPFDKSKDDFFLIDDKETLFPPSTRNRIVYYILSRCFYNRDDNINKDKRGIKRLLNNGTYTSAFPLHDCRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATY--DDVIWTK------------EICDDDIGGQIVMCPLCDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYETKCTSRRRNKVTQEMEPYFPVTSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWL------------------------------------------KNWWSSRKARSHPESLYSRWEQDYDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENP-AWFNNSVITTCRYRDYRYPPGHEYEYSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDKLKKQLNEMGGG 856          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 520.776 bits (1340), Expect = 1.004e-170
Identity = 338/909 (37.18%), Postives = 508/909 (55.89%), Query Frame = 1
Query:   49 NKQFQEPSS--FMD----IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVH--DKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDV--PHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF---DDL-QDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRA-------RYTIIGSY--TKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFF---GWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRY-YYNHKSWTLNGYVNFTLSVFNISNFQPANIP---LNPRPIFQN--ITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFG 2655
            +KQ Q   S  F D    IDFV+ Y    ++ +   Q RRK +E+N+   G++L   D     D    F+ +  PW++L  +AD +K+K+P K   + P    +     F P L      D V  P    + S F   K + F +D  E  F  S R+ I Y IL R  +   D++ +D  GI RL+  G Y +A+PLH+ ++    ++   +SER  LY YWA    F + QP+ LIRKY+GEKI IYFAWLG YT  L   +L+G+  F Y    Y  DD    K            EIC++   G  VMCP+CD+ C +W L  +C  +  + +FDN+ T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C S+R N +T E E +  +  K  R   S  TV F I+++++ I GVI  R+ + + L          +  ++GS    +L TS  A+ ++   I+ILN  Y+ +A+ +TD E P+T  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G PG Y Y F   G R EECDP GCL+EL+ Q++++  GKQ+  NI E  LP +                                           N  S    ++ P+     WE+D+ L + ++  +F EYLEMVIQ+GF+T+F A+ PLAPL AL NNI+E+R+DA+K+ T++RRP+A +A  IG W +IL +I++ SVV+NAFI+++TS  +P+LVY Y Y+     T+ GYVN +LS+FNIS     N P    NP   F N  IT CRYRD+R       EYS ++ +WH+LAA++AF+I+ EHVVF +  L+ W+IP V   ++ R+++E+ L  + +   E ++LK+   + G G
Sbjct:   18 DKQHQSKDSVYFRDGKRRIDFVLSY---IEDKEDRKQERRKLYEENMQKAGLELELEDKTESEDGKTYFLKIHAPWEVLATYADVLKIKVPFKVNDI-PENREIPVSWLFTPLLL----PDHVMRPDPDYFTSPFDKSKDDFFLIDDKETLFPPSTRNRIVYYILSRCFYNRDDNINKDKRGIKRLLNNGTYTSAFPLHDCRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATY--DDVIWTK------------EICDDDIGGQIVMCPLCDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYETKCTSRRRNKVTQEMEPYFPVTSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWL------------------------------------------KNWWSSRKARSHPESLYSRWEQDYDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENP-AWFNNSVITTCRYRDYRYPPGHEYEYSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDKLKKQLNEMGGG 861          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 520.776 bits (1340), Expect = 2.438e-170
Identity = 338/909 (37.18%), Postives = 508/909 (55.89%), Query Frame = 1
Query:   49 NKQFQEPSS--FMD----IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVH--DKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDV--PHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF---DDL-QDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRA-------RYTIIGSY--TKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFF---GWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRY-YYNHKSWTLNGYVNFTLSVFNISNFQPANIP---LNPRPIFQN--ITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFG 2655
            +KQ Q   S  F D    IDFV+ Y    ++ +   Q RRK +E+N+   G++L   D     D    F+ +  PW++L  +AD +K+K+P K   + P    +     F P L      D V  P    + S F   K + F +D  E  F  S R+ I Y IL R  +   D++ +D  GI RL+  G Y +A+PLH+ ++    ++   +SER  LY YWA    F + QP+ LIRKY+GEKI IYFAWLG YT  L   +L+G+  F Y    Y  DD    K            EIC++   G  VMCP+CD+ C +W L  +C  +  + +FDN+ T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C S+R N +T E E +  +  K  R   S  TV F I+++++ I GVI  R+ + + L          +  ++GS    +L TS  A+ ++   I+ILN  Y+ +A+ +TD E P+T  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G PG Y Y F   G R EECDP GCL+EL+ Q++++  GKQ+  NI E  LP +                                           N  S    ++ P+     WE+D+ L + ++  +F EYLEMVIQ+GF+T+F A+ PLAPL AL NNI+E+R+DA+K+ T++RRP+A +A  IG W +IL +I++ SVV+NAFI+++TS  +P+LVY Y Y+     T+ GYVN +LS+FNIS     N P    NP   F N  IT CRYRD+R       EYS ++ +WH+LAA++AF+I+ EHVVF +  L+ W+IP V   ++ R+++E+ L  + +   E ++LK+   + G G
Sbjct:   47 DKQHQSKDSVYFRDGKRRIDFVLSY---IEDKEDRKQERRKLYEENMQKAGLELELEDKTESEDGKTYFLKIHAPWEVLATYADVLKIKVPFKVNDI-PENREIPVSWLFTPLLL----PDHVMRPDPDYFTSPFDKSKDDFFLIDDKETLFPPSTRNRIVYYILSRCFYNRDDNINKDKRGIKRLLNNGTYTSAFPLHDCRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATY--DDVIWTK------------EICDDDIGGQIVMCPLCDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYETKCTSRRRNKVTQEMEPYFPVTSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWL------------------------------------------KNWWSSRKARSHPESLYSRWEQDYDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENP-AWFNNSVITTCRYRDYRYPPGHEYEYSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDKLKKQLNEMGGG 890          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 521.161 bits (1341), Expect = 2.539e-170
Identity = 338/916 (36.90%), Postives = 512/916 (55.90%), Query Frame = 1
Query:   28 MEFQEFPNKQFQEPSS--FMD----IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVH--DKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDV--PHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF---DDL-QDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRA-------RYTIIGSY--TKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFF---GWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRY-YYNHKSWTLNGYVNFTLSVFNISNFQPANIP---LNPRPIFQN--ITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFG 2655
            ++++   +KQ Q   S  F D    IDFV+ Y    ++ +   Q RRK +E+N+   G++L   D     D    F+ +  PW++L  +AD +K+K+P K   + P    +     F P L      D V  P    + S F   K + F +D  E  F  S R+ I Y IL R  +   D++ +D  GI RL+  G Y +A+PLH+ ++    ++   +SER  LY YWA    F + QP+ LIRKY+GEKI IYFAWLG YT  L   +L+G+  F Y    Y  DD    K            EIC++   G  VMCP+CD+ C +W L  +C  +  + +FDN+ T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C S+R N +T E E +  +  K  R   S  TV F I+++++ I GVI  R+ + + L          +  ++GS    +L TS  A+ ++   I+ILN  Y+ +A+ +TD E P+T  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G PG Y Y F   G R EECDP GCL+EL+ Q++++  GKQ+  NI E  LP +                                           N  S    ++ P+     WE+D+ L + ++  +F EYLEMVIQ+GF+T+F A+ PLAPL AL NNI+E+R+DA+K+ T++RRP+A +A  IG W +IL +I++ SVV+NAFI+++TS  +P+LVY Y Y+     T+ GYVN +LS+FNIS     N P    NP   F N  IT CRYRD+R       EYS ++ +WH+LAA++AF+I+ EHVVF +  L+ W+IP V   ++ R+++E+ L  + +   E ++LK+   + G G
Sbjct:   54 LKYRSRVDKQHQSKDSVYFRDGKRRIDFVLSY---IEDKEDRKQERRKLYEENMQKAGLELELEDKTESEDGKTYFLKIHAPWEVLATYADVLKIKVPFKVNDI-PENREIPVSWLFTPLLL----PDHVMRPDPDYFTSPFDKSKDDFFLIDDKETLFPPSTRNRIVYYILSRCFYNRDDNINKDKRGIKRLLNNGTYTSAFPLHDCRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATY--DDVIWTK------------EICDDDIGGQIVMCPLCDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYETKCTSRRRNKVTQEMEPYFPVTSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWL------------------------------------------KNWWSSRKARSHPESLYSRWEQDYDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENP-AWFNNSVITTCRYRDYRYPPGHEYEYSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDKLKKQLNEMGGG 904          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 521.546 bits (1342), Expect = 6.826e-170
Identity = 338/916 (36.90%), Postives = 512/916 (55.90%), Query Frame = 1
Query:   28 MEFQEFPNKQFQEPSS--FMD----IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVH--DKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDV--PHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF---DDL-QDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRA-------RYTIIGSY--TKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFF---GWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRY-YYNHKSWTLNGYVNFTLSVFNISNFQPANIP---LNPRPIFQN--ITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFG 2655
            ++++   +KQ Q   S  F D    IDFV+ Y    ++ +   Q RRK +E+N+   G++L   D     D    F+ +  PW++L  +AD +K+K+P K   + P    +     F P L      D V  P    + S F   K + F +D  E  F  S R+ I Y IL R  +   D++ +D  GI RL+  G Y +A+PLH+ ++    ++   +SER  LY YWA    F + QP+ LIRKY+GEKI IYFAWLG YT  L   +L+G+  F Y    Y  DD    K            EIC++   G  VMCP+CD+ C +W L  +C  +  + +FDN+ T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C S+R N +T E E +  +  K  R   S  TV F I+++++ I GVI  R+ + + L          +  ++GS    +L TS  A+ ++   I+ILN  Y+ +A+ +TD E P+T  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G PG Y Y F   G R EECDP GCL+EL+ Q++++  GKQ+  NI E  LP +                                           N  S    ++ P+     WE+D+ L + ++  +F EYLEMVIQ+GF+T+F A+ PLAPL AL NNI+E+R+DA+K+ T++RRP+A +A  IG W +IL +I++ SVV+NAFI+++TS  +P+LVY Y Y+     T+ GYVN +LS+FNIS     N P    NP   F N  IT CRYRD+R       EYS ++ +WH+LAA++AF+I+ EHVVF +  L+ W+IP V   ++ R+++E+ L  + +   E ++LK+   + G G
Sbjct:   98 LKYRSRVDKQHQSKDSVYFRDGKRRIDFVLSY---IEDKEDRKQERRKLYEENMQKAGLELELEDKTESEDGKTYFLKIHAPWEVLATYADVLKIKVPFKVNDI-PENREIPVSWLFTPLLL----PDHVMRPDPDYFTSPFDKSKDDFFLIDDKETLFPPSTRNRIVYYILSRCFYNRDDNINKDKRGIKRLLNNGTYTSAFPLHDCRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATY--DDVIWTK------------EICDDDIGGQIVMCPLCDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYETKCTSRRRNKVTQEMEPYFPVTSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWL------------------------------------------KNWWSSRKARSHPESLYSRWEQDYDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENP-AWFNNSVITTCRYRDYRYPPGHEYEYSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDKLKKQLNEMGGG 948          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 446.817 bits (1148), Expect = 3.986e-144
Identity = 308/858 (35.90%), Postives = 479/858 (55.83%), Query Frame = 1
Query:   67 PSSFMDIDFVIVYDISTDNAKHLNQ--TRRKKFEKNLFNKGVKLSKVDGVHDKA-LSFVLMIVPWDLLLKFADAMKMKMPLKT-TMVKPPLSTLESLMSFV--PDLFWVSQLDDVPHK-QAYWSAF-RIDKQEMF-NMDPAELFFSKSQRSLIAYEILMRTQFDDLQD-DVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSK--SERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWL-GLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLM 2601
            PS FM +    + +  T   + +++  + RK F  NL   G+ + +     +K  + ++ +  PW +L  +A+ + ++MPL+   M K   S  E L+ F+  P++       D+P + Q Y++ F R  K + F   D  E FFS +QR +I  EIL  T +   +  +VG+DR+++  ++ AA+PLHEG +         +  + RQVLY+YWA    + +YQP++ IR+YFGEKI+ YFAWL G YT +L+P +L+G+  F    +   ND              S   EIC E G   Y MCP+CD  C  W L  +C  +K+  IFD   TI +SI ISLW   FL++WKRK + L + W      E E  R +Y       R N ITGE E +    D+  R +T    +F MI+VVL  +  VIL + +++  +++     + +    + +     + L  I+I+  LY  IA  LT +E  RTQ+E+++ LT+K+++FQ  N+Y S  Y+ +FKG F G PG+Y   FG R E C   GCL+EL+ Q+ +I VGKQI+NN+ E+ LPII           + R +                     DE      + + N+     WE D+ LL    L  FDEYLEMV+Q+GF+T+F  A PLAPLFAL NN +EIR+DA K + ++RR +  + + IG+WFDIL  ++ IS++SNAF+I++TS  +P+L+YRY Y     +L+GYV+FTL+      + P +       +  N T+CRYRDFR+      + ++++ YW +LA RL+FVI++EH+VF ++  I+W+I  V+P +K++I++E+ L  + +
Sbjct:    1 PSDFMLVWEEEMENEETVPPQSMDEHDSLRKIFLTNLSKIGLLIEEDIMQGEKINIHYLKLHAPWQVLQCYAEEINLRMPLQIHPMTKTHFS--ERLLKFLHLPNIMHA----DLPRQPQEYYNCFFRKSKLDRFLGSDHPETFFSSTQRHVIVKEILNTTPYGKRKKAEVGLDRMLRDHIFSAAFPLHEGSYDGTYLGLAPEQMTRRQVLYKYWARWGCWFKYQPLDHIREYFGEKIAFYFAWLLGFYTCWLLPPALVGLVVFFVGWLTLHND--------------STVKEIC-ENG-SHYQMCPLCD-TCKVWNLSNTCNMAKMGHIFDYPGTIFYSIFISLWSVSFLEYWKRKSSSLTYHWGCTLVHEEERPRPEYAALAPLIRENPITGEKEPYFSEDDRTPRTVTGSIVLFLMISVVLIFLVTVILYQALLSISIFKTGNWFLATQATNIANMTGTLVFLVLIVIMARLYTTIADYLTRWEMHRTQSEHENALTVKVFIFQLVNYYSSPVYVGFFKGKFNGYPGNYGNLFGTRNENCPQGGCLIELAQQLFIIMVGKQILNNLQELILPII-------QQWRQRRKL---------------------DEIRGKRLVQELNI-----WEDDYELLHNTGL--FDEYLEMVMQFGFITIFVMAFPLAPLFALMNNWVEIRLDARKFVCRYRRSVVERVRGIGVWFDILSGLAHISIISNAFLIAFTSDFLPRLLYRYTYKS---SLDGYVDFTLA------YAPRDY------VVANHTMCRYRDFRD-----QDGNLTLFYWKLLAVRLSFVIIFEHLVFLVARAIDWLIVDVAPDLKVKIKREEYLAKQAL 780          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000399.1 (pep scaffold:Pmarinus_7.0:GL477564:2673:43187:-1 gene:ENSPMAG00000000358.1 transcript:ENSPMAT00000000399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 371.703 bits (953), Expect = 1.462e-115
Identity = 266/765 (34.77%), Postives = 417/765 (54.51%), Query Frame = 1
Query:  148 RKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTM-VKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWS------AFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYV-MCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYEKNC--QSQRINF---ITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFF-GWRQEECDPAGCLMELSIQMLVIFVGKQIM-NNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYR 2394
            R++FE+NL +  ++L   +    +   ++ +  PW +L++ A+ +K+KMP K    +K     L  L + +          +VPH Q   S       F  DKQ++F++   + FF  + RS I +EIL R +       +GI  LI  GVY +A+PLH+G+      + +  ++R++L++ WA+   F +YQP+ELI+KYFGEKI +YFAWLG+YT  LIP S++GI  F Y  +    D                  E C    IG  + MCP CD+ C Y  L E+C   + + +FDN  T++FSI ++LW + FL+ WKR +T L ++W+ N  EE E + R +YE     + ++++     T   E+ +  +D++   L +   + FM+ +  +++ G+I  RI +  LL  +    + S    +    A  ++L  ILIL+ +Y  IA  LT  E P+T+ E++  L  K ++ +F N Y S+ Y+A+ KG   G P  YYY    +R EEC P GCL EL++Q+ +I +GKQ++ NN+ E+ +P IKK   +   K  H+               E G+ +                       KD+ L     L+   EY+EMVIQ+GFVT+F A+ PLAP FAL NN+IEIR+D  K +T+ RRP A +A+DIG W+ IL  ++ ++V+ NA +I+ TS  VP+L+Y Y+Y+    +L GYVN+TLS FN+S++ P  I      I  N T+CRY+
Sbjct:   91 REEFEQNLMDARLELEWDEEDQAEGHGYLRIHAPWLVLIREAEFLKIKMPTKKVFEMKQSSGVLHGLGARINHALQ----PNVPHSQEALSQKKLSFPFSRDKQKLFDIKSEDSFFDSATRSRIVFEILKRVKCTKGPYKMGITSLIANGVYTSAFPLHDGEL-----HGSEVNDRKLLHDEWASYNKFYKYQPLELIKKYFGEKIGLYFAWLGVYTQMLIPPSVVGIAVFLYGWLAAEKDIP--------------GFETCV---IGQNITMCPTCDKLCKYKRLSENCDRVRSSHLFDNITTVLFSIFMALWATTFLEHWKRIETRLNYTWDLNGMEESEQQLRPEYEAKLLEKKRKVDIKLAKTQTEEYGLSWRDQLPSFLINCSCILFMVLLSFAIVVGMIFYRITMNVLLANSTDPYLKSNRSAIIMATAFLINLVIILILDEIYGSIARWLTVIEVPKTEEEFETRLIFKSFMLKFVNSYTSIIYVAFLKGRITGYPKKYYYILPNYRMEECAPGGCLQELALQLCIIMLGKQLLQNNLFEVGIPKIKKLCRYLHKKDHHKKAS--------HLKEEDGMELGC---------------------KDYELEPFTGLN--PEYMEMVIQFGFVTLFVASFPLAPFFALLNNVIEIRLDGKKFVTELRRPTAVRAKDIGTWYVILNGVAKLAVIINALVIALTSDFVPRLIYMYFYSPDG-SLRGYVNYTLSYFNVSDYAPGII------IESNYTLCRYK 791          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano3 (anoctamin 3 [Source:ZFIN;Acc:ZDB-GENE-111031-3])

HSP 1 Score: 318.161 bits (814), Expect = 9.194e-99
Identity = 212/541 (39.19%), Postives = 327/541 (60.44%), Query Frame = 1
Query: 1066 GSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYE-KNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYN-------HKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITV-CRYRDFREGVESNPE--YSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTG 2649
             +VFL+FWKR++++L + W+  D+EE E+  R  +E K  Q +R+N I+G+ E +    DK  R + S   +F MI +V+  + GV++ R+++ S+   +    + SY++  T+G    ++   I++LN++Y+ +AV LT+ E  RT+ E++++ TLKM++FQF N   S+FY+A+F G F G PG Y   F  WR EEC P+GCL++L +QM +I V KQ  NN ME+  P++             +N    K  +  +  TE  + +                  LPQWE+D+ L   N   +FDEYLEM++Q+GF T+F AA PLAPL AL NNIIEIR+DAYK +T+WRR LA +A+DIG+W+ IL+ I ++SV++NAF+I+ TS  +P+LVY Y Y         +   L GYVN +LSVF            NP    Q I   C YRD+RE   ++ E  Y  ++ +WHVLAARLAF+IV+EH+V+F+  +I ++IP +   +K R+ +EK L  +++ +A+ + L++    TG
Sbjct:    7 ATVFLEFWKRRKSELAYEWDLLDWEEEEEEIRPQFEAKYSQKERLNAISGKPEPYQSFHDKCSRLVVSASGIFLMICLVIVAVFGVVVYRVVMLSVFTTSELVFVRSYSQFFTAGTGVCINFVIIMLLNMIYEKVAVFLTNLEQCRTEAEWENSFTLKMFLFQFVNLNSSIFYVAFFLGRFTGHPGKYEKLFHIWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGFPLL-------------QNWWAKKKLQHEMETTEDDMAL------------------LPQWEQDYSLQQINTYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRSLACRAKDIGVWYGILEGIGVVSVITNAFVIAVTSDFIPRLVYFYQYGPCARMRESERDCLEGYVNSSLSVF------------NPSTYCQIIKCYCIYRDYREAPSTHREEPYKFTLQFWHVLAARLAFIIVFEHLVYFIKLIIAYMIPDIPKGLKERMHREKFLVQEMVHEADLDALRKERKKTG 504          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 268.47 bits (685), Expect = 1.685e-81
Identity = 170/446 (38.12%), Postives = 271/446 (60.76%), Query Frame = 1
Query: 1270 TVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEM--VIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLM 2601
             +  M++VV+  +  VI+ R I++ ++Y+    ++ +    + +  ++ ++L  IL++  +Y  +A +LT +E  RTQT+Y+D  T K++VFQF NFY S FY+A+FKG F+G PG Y    G R E+C P GCL+EL+ Q+++I VGKQ++NNI E   P IK            R +               G  +  + S               +WE+D+ L+    L  F+EYLEM  V+Q+GF+T+F AA PLAPLFAL NN +E+R+DA K + ++RRP+A +AQDIG+WF+IL  +  ISV+ NAF+I++TS+ +P+L+Y+Y Y+     L GY+NFTLS      + P +  +N      N T CRY+D+R+    +     ++ YW +LA RL F+I +EHVVFF+S +I+W++P V  S++I++++E+ L  + +
Sbjct:    4 VIILMLSVVMIFLVTVIMYRGIVSVVMYKTGNAVLMTQAANIANISSSMVNLILILVMGQVYSSLAEQLTKWEMHRTQTQYEDAFTFKVFVFQFVNFYSSPFYVAFFKGRFVGYPGHYKKLLGTRNEDCGPGGCLIELAQQLIIIMVGKQVINNIQEFVFPKIKAWLQ-------KRKLAAL-----------RGSHVAPESS---------------RWEEDYELIPCEGL--FEEYLEMGPVLQFGFITIFVAAFPLAPLFALLNNWVELRLDAQKFVCEYRRPVAERAQDIGVWFNILDALVNISVIINAFLIAFTSNFLPKLLYQYTYDR---NLRGYINFTLS------YAPDDYVVN------NYTHCRYKDYRDQDGKH-----TLFYWKLLAIRLGFIIAFEHVVFFISRMIDWLVPDVPESLEIKMKRERYLAKQAL 394          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 266.544 bits (680), Expect = 7.959e-81
Identity = 163/400 (40.75%), Postives = 248/400 (62.00%), Query Frame = 1
Query: 1408 AAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEM--VIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLM 2601
            ++ ++L  IL++  +Y  +A +LT +E  RTQT+Y+D  T K++VFQF NFY S FY+A+FKG F+G PG Y    G R E+C P GCL+EL+ Q+++I VGKQ++NNI E   P+          +   R +      R    L  S V   S                  +WE+D+ L+    L  F+EYLEM  V+Q+GF+T+F AA PLAPLFAL NN +E+R+DA K + ++RRP+A +AQDIG+WF+IL  +  ISV+ NAF+I++TS+ +P+L+Y+Y Y+     L GY+NFTLS      + P +  +N      N T CRY+D+R+    +     ++ YW +LA RL F+I +EHVVFF+S +I+W++P V  S++I++++E+ L  + +
Sbjct:   45 SSMVNLILILVMGQVYSSLAEQLTKWEMHRTQTQYEDAFTFKVFVFQFVNFYSSPFYVAFFKGRFVGYPGHYKKLLGTRNEDCGPGGCLIELAQQLIIIMVGKQVINNIQEFVFPL---TLPPPAPRSCRRKIKAWLQKRKLAALRGSHVAPESS-----------------RWEEDYELIPCEGL--FEEYLEMGPVLQFGFITIFVAAFPLAPLFALLNNWVELRLDAQKFVCEYRRPVAERAQDIGVWFNILDALVNISVIINAFLIAFTSNFLPKLLYQYTYDR---NLRGYINFTLS------YAPDDYVVN------NYTHCRYKDYRDQDGKH-----TLFYWKLLAIRLGFIIAFEHVVFFISRMIDWLVPDVPESLEIKMKRERYLAKQAL 402          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO49855 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REV0])

HSP 1 Score: 488.034 bits (1255), Expect = 1.142e-159
Identity = 317/853 (37.16%), Postives = 492/853 (57.68%), Query Frame = 1
Query:   88 DFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKA--LSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSF-VPDLFWVSQLDDVPHKQA--YWSAFRIDKQEMF-NMDPAELFFSKSQRSLIAYEILMRTQFDDLQ-DDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSE-----RQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDED--CDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLM 2601
            DFV+VY+    +    +   R+KF +NL    ++  + +   DK   L F+ + VPW++LL +A+ +  + PL+  +      +   L  F +P++F     ++VP+     +   F+ +K   F   D  + +F+  +R+ +AYEIL    +   Q  ++GI+RL++ GV+ A YPLH   +     N    S       QVL EYW     + +YQP++ IR YFGEKI IYFAWLG YT +LI  S LG+  F Y +    + D +          P+L  E+C+     ++ MCP+CDE+  C YW L+ SC   KIA +FDN+ T+ F++ +S W   FL++WKRK+  L + W+  +YEE  +R R  +     +   N +TG  E H   + +  R  +    VF M+++VL  + GVI+ ++++   L  AR     +Y   + +   AF++L  I+IL+ +Y+ +A+ LT +E  RTQTEY+D+LT K++VFQF NFY S+FY+A+FKG  +G PG Y   FG RQEEC P GCLMEL+ Q+++I VGKQ++NN+ EI++P++K+                                          G SK  +K  P+WE+DF L++   L  F EYLEM++Q+GF+T+F AA PLAP FAL NNI EIRID+ K + + RRP+A +AQDIGIWF+IL  ++ I+V+SNAF+I++TS+ +P+L+YRY  + ++++L GY N+TL+      + P N  L P         CRY++FR     +PE   ++ YWH+LA RL FVI++EHVVFF+  LI+ ++P +   ++I I++E  L  + +
Sbjct:    1 DFVLVYEEGEKDPPPQSIEYRQKFLENLAKSQLEFEE-EITQDKKVKLHFIKIHVPWEVLLFYAEELSFRAPLEVGLNTKVNWSERMLEKFHMPNIF----KEEVPNPPPDFFTCTFQANKLNKFIGSDDPDSYFTDVERTRVAYEILETAPYGKRQRGEIGIERLVEEGVFKAGYPLHVNCYL----NQQGYSPFLIYVSQVLKEYWGRWGKWLKYQPLDHIRDYFGEKIGIYFAWLGQYTAWLIMPSFLGLLVFLYGVATINSSDNK----------PAL--EVCDNPP-WTFRMCPLCDEELGCQYWDLHISCKSGKIAYLFDNASTVFFAVFVSFWSCFFLEYWKRKEVTLAYHWDVLEYEEEAERPRPTFAALAPTVERNPVTGILEPHFPDEKRKPRLFSGIAIVFTMVSLVLVFMVGVIVYKLLVYRPL--ARNPSTRAYALQIANSTGAFVNLTIIMILSRVYERVALALTHWEMHRTQTEYEDSLTFKVFVFQFANFYSSIFYVAFFKGKLVGYPGHYRRLFGLRQEECSPGGCLMELAQQLVIIMVGKQMINNVQEIAIPLVKQWIKR-----------------------------------KKRGTSKDEIK--PRWEQDFELVENEGL--FQEYLEMILQFGFITIFVAAFPLAPFFALANNIFEIRIDSDKFVCEVRRPIADRAQDIGIWFNILDSVAKIAVISNAFLIAFTSTFLPKLLYRYAVS-ENFSLEGYTNYTLA------WAPRNTTLKP---------CRYQEFR-----DPEGHFTVFYWHLLALRLGFVIMFEHVVFFVMRLIDMMVPDIPTELEIIIKREAYLAKQAL 769          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO48307 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RJQ8])

HSP 1 Score: 449.129 bits (1154), Expect = 7.607e-145
Identity = 308/855 (36.02%), Postives = 484/855 (56.61%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHL------NQTRRKKFEKNLFNKGVKLSKVDGVHDKALS--FVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVP------HKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDY-EEMEDRRLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFI-GRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLM 2601
            +DFV+VY+ +    +            R+ FE++L  +G+ L   D   ++ ++  FVL+  PWD+L +FA+ M ++ PL+     P     + +   + +  W S++ D P       K+     F  DK++ F +   + FFS   RS I   IL   +F    DD GIDRL+  GVY AAYPLHEG    +   ++S + R+ L   WA+ R + R+QP+  I+ YFG ++  YFAWLG Y   L+  +L+G+F F   L +  +            F P  + EIC++              + +YW L+ SC +SKI  +FD+  T+ F+  ++LW S+FL+ WKR+QT L F W+  D+ EE+E  R  + +  + +R N ITG  E  +    +++++  +F  V  MI +V++ + GVI+ R  +++ L+      +    +++TS  A+ ++L AI IL+ +Y +IAV LT++ENPRT+T+Y D LT KM++FQ  N Y SLFYIA+FK + I G PG Y    G R E CDP+GCL+EL IQ+ +I  GKQ ++ I++I LP +    + +  +   RN+             E+G                     L +WE D+ L    +  +F EY +MV+Q+GFVTMF AA PLAPLFAL NNI+E+RIDA   +   RRP+A +A++IG W  ILQ +S  +++ N+F+I++TS  +P+LVY   Y+    +LNGYVN +LS FN+ +F+  ++P +P   FQN+       ++E  ES   Y  S  +++VLAARLAFVI+++++V F   LINW++P V  S++IR++ EK +  K++
Sbjct:    1 VDFVMVYEETKGKDEEEIRDEEEKAEMRRNFEEHLIKEGLLLQHTDSDLNEEVNKVFVLIHAPWDVLTRFAEKMLLRFPLREASPPPAAQGFDKIPELISN--W-SKIFDPPSCGITKEKRFVHGLFSRDKKDSFLISDKDKFFSDIDRSRIVARILRLCRFSSEPDDFGIDRLLHRGVYGAAYPLHEG-LSTSYPTDSSANHREYLQYSWASFRQWYRFQPLNEIKSYFGTRVGFYFAWLGTYNLMLVIAALVGLFCFIGGLASVES------------FVP--AKEICDK-------------ANENYWSLHTSCRYSKITHLFDHEGTVFFAAFMALWSSLFLEVWKRQQTSLAFEWDMLDFDEELEPARPQFVEAVKERRPNPITGILEPFVPYAKQLIKQTCAFVVVLLMILLVIAAVVGVIVYRAAMSAALHSYPREDVRRGARVITSITASTINLVAITILSYVYNYIAVFLTNWENPRTRTQYTDALTFKMFLFQSVNMYSSLFYIAFFKSAMIVGVPGRYTRIGGGRLEGCDPSGCLIELCIQLAIILGGKQAISLIIKIVLPCL----WRWWNRRSQRNL------------LETG--------------------ELDRWELDYLLNPEPDFRMFYEYHDMVLQFGFVTMFVAAFPLAPLFALLNNILELRIDAINFVVTTRRPVAERARNIGSWLGILQTLSRFAILVNSFVIAFTSEFIPRLVYTVAYSPDG-SLNGYVNNSLSSFNVRDFERQSLPQDP---FQNLPYN--NTYKEYFESTSPYMYSRQFYYVLAARLAFVIIFQYLVIFTVFLINWLVPDVPYSLEIRMKHEKYIAQKML 782          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO48048 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU7])

HSP 1 Score: 429.483 bits (1103), Expect = 1.571e-136
Identity = 290/874 (33.18%), Postives = 481/874 (55.03%), Query Frame = 1
Query:   85 IDFVIVYDISTDN--------AKHLN-QTRRKKFEKNLFNKGVKLSK---VDGVHDKA-LSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHK----QAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYW-ILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXL-------YRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSF-IGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKS--WTLNGYVNFTLSVFNIS---NFQPANIPLNP-RPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMF 2604
            +D+V+VY+   +         AK  + + +R  FE  L  +G+ + +       +DK    FV + VPW  L   A+ + +K PL+   +      L++    + D F +     +P K     AY+   ++DK  M   +P E  F+   R  +   I   T+F +    VG+ +L+  G Y A YPLH+G      +++   ++RQ L + W++ +   +YQP++ ++ Y+G  I++YFAWLG YT  LIP++++G+  F Y + +                 P++  + C+      + MCP+CD  C YW ++  +C+++++   FDN  T+  +I  S+W ++FL+FWKR+Q  L + W+  ++EE E++ R ++     + + N ITG+ E H+  +    R       V FMI +V++ + GV++ R  + + L        RARY +I   ++++TS  AA ++L  I IL + Y  +AV LT++ENPRT+T+Y+D+ T KMY+FQF N Y S+FYIA+FK    +G PG Y    G +R E C   GC +EL +QML+I VG+QI+ NI E+++P I                                +T   +     N       K LPQ+E+D+ L    E ++F EYLE+V+QYGFVTMF AA PLAPLF+L N+I+EIR+DA   ++++RRP    A+DIG W+ IL+ ++ +SV+ NAF++S+TS  +P+LVY+  Y  +    TL GY+N +LS  N++    ++P   PLNP + +    T CRY+ + +       +  +  YWHV+AARLAFV V+++ V+ ++  I W +P    S+++R ++E+ L  K+++
Sbjct:   24 VDYVLVYETCQEREDKDPKFAAKMADFERKRDAFEAALSEQGLVIERESITSPQNDKVKRHFVKLHVPWRTLSSKAEELMLKAPLQENDID-----LKTTGEKIFDPFRIKD-SSIPEKPKCFMAYFKERKVDKY-MGKAEP-EKMFTALDRHYVVQRICYATRFAEGPKGVGLKQLVYEGAYCANYPLHDGDDDVIGESSYPSNDRQRLKKDWSSMKRIFKYQPLDTVKGYYGTAIALYFAWLGFYTAMLIPLAIVGLLVFIYGIGSSATS-------------PTVR-DACDTNN--KFYMCPLCDRTCSYWDLVSTTCMYARVTHFFDNDGTVFLAIFTSVWATLFLEFWKRRQAVLAYEWHVANFEEEEEQIRPEFAATAPTLKKNIITGKLEPHIPRRTLYQRYGAIGSVVAFMILLVIAAVIGVVVYRAAVFAALSGNSDSTIRARYAMIAIGSRIITSMTAALINLLCINILKLFYNRLAVWLTNWENPRTKTDYEDSFTYKMYLFQFVNTYASIFYIAFFKSEIVVGTPGRYKRIAGKYRLEGCSAQGCFLELCVQMLIIMVGQQIIGNITEVAIPAI--------------------------------MTWIKERKEPKN-------KQLPQFEQDYNLQPQEEHNLFWEYLEIVLQYGFVTMFIAAFPLAPLFSLLNSIVEIRVDAINFVSQFRRPDTMIAEDIGAWYRILETLTRLSVLINAFVLSFTSEFIPKLVYKLKYAPEGSEGTLEGYLNNSLSAINVTVMEEWEPGTAPLNPTKNLNYTETFCRYKGYHDNTYP---FKFNKQYWHVIAARLAFVFVFQYTVYAITSFIAWAVPDQPRSLELRSKREEHLTKKILY 831          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO48050 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU9])

HSP 1 Score: 419.853 bits (1078), Expect = 2.170e-133
Identity = 292/846 (34.52%), Postives = 461/846 (54.49%), Query Frame = 1
Query:  145 RRKKFEKNLFNKGVKLSKVDGVHDKALS-FVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMS-FVP-----DLFWVSQLDDVPHKQAYWSAFR-------IDKQEMF-NMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYEKNCQSQRINFITGEWEWHMKLKDKI--LRKLTSFFT-VFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSF-IGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNF-QPANIPLNPRP------IFQNIT--VCRYRDFREGVESNPE--YSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLL 2586
            +R+ +E+NL   G++L   +G + K  + FV +  PWD+L   A+ M MK P++ + ++    + + L   FV      D   +      P K+ + + FR       + K++ F        FFS ++RS +   I  + +F + + D GI RLI  G Y AAYPLH G  + + K + S +ERQ L   WA    + +YQP + I+ YFG +I +YFAWLG Y   L+P ++ G+  F Y +                   P +  +ICN+     + MCP+CD+ C YW L  +C ++     FDN  T++F+I +S+W +VFL+FWKR+Q  L + W+   YE+ E++ R ++     + + +    +W   +    K+   RKL    + V FMI +VLS + GV++ R  +   L       +    K+ TS  AA ++L  I +L  +Y+ +A+ LT++ENPRT+T++ D+ T KMY+FQF N Y S+FYIA+FK +  IG PG+Y  F G +R + C   GCLM+L IQ+++I VG+QI+ NI EI++P +                                      +        K   + +P+WE D++L    E  +F EYLE+V+Q+GFVTMF AA PLAPLFAL N + E+R+DA   + ++RRP  R+AQDIG W  I+Q ++ ISV+ NAF+I++TS  +P+LVY   Y+    TL GY+N +LS FN+ ++ +   I    +P         N T   CRY  + E     PE  Y VS  YWHV+AARLAFV  ++++V+ +++ + W++P     +++RI++++ L
Sbjct:   22 KRRVYEENLKKAGLELEHEEGDNKKRKTHFVKIHTPWDVLAATAEEMMMKSPIRDSDIEIKSWSEKHLSEEFVTSIRSRDPLKIHDSCITPPKKQFVAYFRKVINNPRLQKKQFFVGYHDKNTFFSAAERSRMTERICSQQRFGEERFDQGIKRLIHQGTYTAAYPLHSGPEEVSRKGHPS-NERQKLRRDWARFGRWFKYQPYDAIKDYFGTEIGLYFAWLGFYAAMLVPAAIFGVAVFIYGIAQS-------------TIFPPVK-DICNKAYEAEFYMCPLCDKQCPYWSLVVNCPYAIWVHAFDNDSTVVFAIFMSIWATVFLEFWKRRQAVLAYEWHMMHYEDQEEQPRPEFIVTVTTLKKD-KASQWGGMVPHVPKLQQYRKLAGVVSLVAFMIALVLSAVVGVVIYRASVYGSLMAYPDPQVRKQAKMTTSITAAILNLICINLLKFVYEKLAMFLTEWENPRTETDFKDSFTYKMYLFQFVNNYASIFYIAFFKLNLVIGTPGNYRRFAGEYRLDGCSSGGCLMDLCIQLVIIMVGQQIIGNITEIAIPGLL-------------------------------------KWWKMRQAQKEAFEEIPRWEVDYKLNTLPEHHLFWEYLEVVLQFGFVTMFVAAFPLAPLFALVNAVFELRVDAINFVCQFRRPTPRRAQDIGAWMSIMQGLANISVLVNAFVIAFTSDFIPRLVYTTAYSPDG-TLRGYLNNSLSYFNVKDYDRMGAIGAREKPGDNYAYTVLNYTREYCRYPGYHE-----PEFPYEVSKQYWHVIAARLAFVFAFQYIVYAVTKFVAWLVPDRPRHLELRIKRQEYL 808          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO49854 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REU8])

HSP 1 Score: 415.616 bits (1067), Expect = 6.688e-133
Identity = 279/752 (37.10%), Postives = 424/752 (56.38%), Query Frame = 1
Query:  385 DDVPHKQA--YWSAFRIDKQEMF-NMDPAELFFSKSQRSLIAYEILMRTQFDDLQ-DDVGIDRLIKAGVYLAAYPLHEGKF-KDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYF-----GEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQ 2607
            DDVP+     + + F+ +K   F   D  + +F+ ++R+ +A EIL    +   Q  ++GI RL+  G Y AAYPLH G    D +K N     RQVL EYWA   ++ +YQP++ IR+ +     G KI+IYFAWLG YT +LI  S++G+  F Y+       +            P+L  E+C+     +Y MCP C+  C  W L +SC  +K A +FDN  T+ +SI +S W  +FL+FWKRK+  +  +W+  ++E  E+R R  +     +   N ITG  E +   + +  R L+    +  M+++V+  + GVI+ ++++   LY+     +  Y     SG  A ++L  I+IL+ +Y+ +A+ L  +E  RTQTEY+DNLTLK+++FQF NFY S+FYIA+FKG F+G PG+Y   FG R EEC P GCL+EL+ Q+ VI +GKQ++ NI E+ +P +KK                                 +       N   +  +K  P+WE D+ LLD   L  F EYLEMVIQYGF+T+F AA PLAP FAL NN+ EIRIDA K +   RR  A +AQDIG+WF IL  I+ ++V+SNAF+I++TS  +P+L+Y    +    +L GY+N++L+      + P N    P         CRYR FR+      + + +  +WH+L  RL FVI++EH VF +S LI+  +P +  +++  I++EK + T+ + +
Sbjct:   13 DDVPNTPPDYFTTTFKSNKLNKFLGSDNPDTYFTDTERARVASEILETAVYGRRQKGEIGISRLVDEGTYSAAYPLHVGPHGPDEMKLNM----RQVLKEYWARWGAWYKYQPLDHIRQAYEREGGGLKIAIYFAWLGQYTAWLIMPSVVGLIVFIYSFATINGPNNM----------PAL--EMCDHPA-WTYPMCPNCEVGCSVWDLKKSCSRAKHAYLFDNPMTVAYSIFVSFWAVLFLEFWKRKEVTIGHAWDVLEFESEEERPRPTFAALAPAVERNPITGLLEPYFPDEKRSPRVLSGIAIICGMVSLVMLFMVGVIVYKLLVIHPLYKN--PNLQPYANQFASGTGAVLNLIIIMILSRVYEKLALLLNHWEMHRTQTEYEDNLTLKVFIFQFTNFYSSIFYIAFFKGKFVGYPGNYGTIFGLRNEECSPGGCLIELAQQLAVIMIGKQVIGNIQEVFIPELKK---------------------------------YLKNRKRQNSKDEDEIK--PRWEADYELLDNEGL--FQEYLEMVIQYGFITLFVAAFPLAPFFALANNVFEIRIDADKFVNDLRRSTADRAQDIGVWFTILDSITKLAVISNAFLIAFTSEFLPKLLYAGVVSPNQ-SLEGYLNYSLA------WAPPNTTSQP---------CRYRGFRD-----EDGNFTRFFWHLLTMRLVFVILFEHFVFGISTLIDVAVPDIPRALEDTIKREKYVATQALAE 687          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano3 (anoctamin 3 [Source:NCBI gene;Acc:101164148])

HSP 1 Score: 528.48 bits (1360), Expect = 1.261e-172
Identity = 320/876 (36.53%), Postives = 496/876 (56.62%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKT-------------TMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDN--LKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYE-KNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-WRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKN-LPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYY--------NHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQ 2631
            ID+++VY  S+   +     +R  FEKNL  +G+ L K   + +  +  V +   WD L K+A+ M ++MP +              +        +++     P       L D+     Y + F   +   F +   E FFS S RS I + +L RT+++D +  +GI+RL+    Y AA+P HEG +K    +K +  ++ R +LYE WA    + +YQP++LIR+YFGEKI +YFAWLG YT  LIP +L+G+F F Y L    +                +S EIC      + +MCPMC+E C+ W L +SC+++K+  +FDN  T+ F+I +++W +VFL+FWKR++ +L + W+  D+EE E+  R  +E K  + +R+N I+G+ E      DK+ R + S   +FFMI++VL+ +  V++ R+I        R+  +    +  TSG    ++   I+ LNV+Y+ +A  LT+ E+PRT++E++++  LKM++FQF N   S FYIA+F G F GRPG Y   F  WR EEC P+GCL++L +QM VI   KQI NN ME+  P+++                                  +S   +   G    N++  LPQW+KD+ L   N   + DEYLEMV+Q+GF T+F AA PLAPL AL NNIIEIR+DAYK +T+WRRP+  +A DIGIW  IL+ I +++V++NAF+I+ TS  +P+ VY + Y        +H++  L GYVN +LSVF++     +++             CRYRD+R    S+  Y  ++ +WHVLAARLAF+IV+EH+VF +   I ++IP +   +  R+ +EK L  ++M++AE E L++
Sbjct:  145 IDYILVYKKSSPQVE-----KRCTFEKNLRAEGLMLEKEHSLTNNDIMLVKVHASWDTLCKYAERMNIRMPFRKKCYFSDKRSKGLGSRFHLRCQQIKNWFPKNPMKLDKEALPDLEESDCYTAPFSRARMHHFTISNRETFFSNSTRSRIVHHVLQRTKYEDGKSKMGINRLLGNNTYEAAFPPHEGGYKSRHPIKTHGPQNHRHLLYERWARWGIWYKYQPLDLIRRYFGEKIGLYFAWLGWYTGMLIPAALVGVFVFLYGLFTMDSSQ--------------VSKEICE---ANTTIMCPMCEETCEPWTLSDSCVYAKVTHLFDNGGTVFFAIFMAIWATVFLEFWKRRRAELTYDWDLIDWEEEEEELRPQFEAKYSRKERVNPISGKPEPFQPFSDKLSRLMVSVSGIFFMISLVLTAVFAVVVFRLIAMEKFASFRWHFVKKNLQFATSGTGVCLNFMIIMSLNVVYEKVAYLLTNLEHPRTESEWENSFALKMFLFQFVNLNSSTFYIAFFLGRFAGRPGKYSKLFNRWRLEECHPSGCLIDLCLQMGVIMFFKQIWNNFMELGYPLLQ--------------------------------NWWSRRKIKKGGGGGQNVETQLPQWDKDWNLQPMNAHGLVDEYLEMVLQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPMPARATDIGIWHGILEGIGVLAVITNAFVIAITSDYIPRFVYAFKYGPCMDKGQHHENECLQGYVNSSLSVFDMWEVNNSSMS----------RYCRYRDYRAPPWSSVPYKFTLQFWHVLAARLAFIIVFEHLVFGIKSFIAYLIPDMPKDLCDRMRREKYLMQEMMYEAELEHLQK 956          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:101164640])

HSP 1 Score: 520.776 bits (1340), Expect = 6.288e-171
Identity = 325/879 (36.97%), Postives = 498/879 (56.66%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVH--DKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF--DDL--QDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYR-------ARYTIIGSY--TKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-W---RQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKS-WTLNGYVNFTLSVFNISNFQPANIP---LNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLK 2628
            IDFV+ Y    D  +   Q RR+ FE NL   G++L   D     D+   FV +  PW++L  +AD +K+K+P K   +       E  M+++   F + +    P    + + F   K + F ++  + FF  S R+ I Y IL R  +  D+   +D  GI RL+    Y AA+PLH+ ++    K+    S+R  LY+YWA   SF + QP+ LIRKY+GEKI +YFAWLG YT  L   +++G   F Y ++ Y +++               S EIC++   G+ VMCP+CD+ C +W L  +C  S  + +FDN  T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C S+++N IT E E ++ +  K  R   S  TV   I+++++ I GVI  R+ + +           +   ++G Y   +L TS  A+ ++   I+ILN++Y+ +AV +TD E P+T  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G PG Y Y FG W   R EECDP GCL+EL+ Q++++  GKQ+  NI E  +P +                                           N  +    ++ P+     WE+D  L    +L +F EYLEMVIQ+GF+T+F A+ PLAPL ALFNNIIEIR+DA+K+ T++RRP+A +A  IG W +IL  ++++SVV+NAFI+++TS  +P+LVY Y Y  +    + GY+N +LSVFNIS     N P    NP     +IT CRYRD+R       +YS ++ +WH+LAA+LAF+I+ EHVVF +   + W+IP V   +K R+++E+ L  + +   E E+LK
Sbjct:   22 IDFVLSYVDDKDGER--KQERRRVFEANLVKVGLELEIEDKSESDDRKTYFVKIHAPWEVLATYADVLKIKVPFKANDIP---DNSEMPMNWLSTPFRLPEPIMQPEPDFFTAPFDKSKSDFFLIEDRDKFFLPSTRNRIVYYILSRCSYIRDECGERDKKGIKRLLNNSTYTAAFPLHDSRYWTKSKDVNCDSDRYNLYKYWAGFFSFFKEQPLNLIRKYYGEKIGLYFAWLGFYTEMLFFAAVVGTLCFVYGVLTYDDNE--------------WSKEICSDEIGGNIVMCPLCDKKCGFWKLNTTCNSSWQSHLFDNVGTVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYETKCNSRKLNRITQEMEPYLPITSKCARICLSGATVLLWISLIIACIIGVIAYRLAVYAAFASIMKDSPTSNLEVVGPYITPQLATSVTASCINFVIIMILNLMYERVAVWITDMEIPKTHLEYENKLTVKMFLFQFVNYYSSCFYVAFFKGKFVGYPGDYAYMFGKWSKLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALVPWLM------------------------------------------NWWASRKARSYPESLYSRWEQDHDLQGFGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNIIEIRVDAWKLTTQFRRPVAAKAHCIGAWEEILNGMAVLSVVTNAFIVAFTSDMIPRLVYMYAYQPEGEMNMKGYINNSLSVFNISEIPLPNRPEDGENPLWFNSSITTCRYRDYRNPPGHENQYSHTMQFWHILAAKLAFIIIMEHVVFLVKYFVAWMIPDVPSDVKARVKRERYLVQEYLHNYEVEKLK 839          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:101164640])

HSP 1 Score: 521.546 bits (1342), Expect = 1.236e-170
Identity = 325/879 (36.97%), Postives = 498/879 (56.66%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVH--DKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF--DDL--QDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYR-------ARYTIIGSY--TKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-W---RQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKS-WTLNGYVNFTLSVFNISNFQPANIP---LNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLK 2628
            IDFV+ Y    D  +   Q RR+ FE NL   G++L   D     D+   FV +  PW++L  +AD +K+K+P K   +       E  M+++   F + +    P    + + F   K + F ++  + FF  S R+ I Y IL R  +  D+   +D  GI RL+    Y AA+PLH+ ++    K+    S+R  LY+YWA   SF + QP+ LIRKY+GEKI +YFAWLG YT  L   +++G   F Y ++ Y +++               S EIC++   G+ VMCP+CD+ C +W L  +C  S  + +FDN  T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C S+++N IT E E ++ +  K  R   S  TV   I+++++ I GVI  R+ + +           +   ++G Y   +L TS  A+ ++   I+ILN++Y+ +AV +TD E P+T  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G PG Y Y FG W   R EECDP GCL+EL+ Q++++  GKQ+  NI E  +P +                                           N  +    ++ P+     WE+D  L    +L +F EYLEMVIQ+GF+T+F A+ PLAPL ALFNNIIEIR+DA+K+ T++RRP+A +A  IG W +IL  ++++SVV+NAFI+++TS  +P+LVY Y Y  +    + GY+N +LSVFNIS     N P    NP     +IT CRYRD+R       +YS ++ +WH+LAA+LAF+I+ EHVVF +   + W+IP V   +K R+++E+ L  + +   E E+LK
Sbjct:   66 IDFVLSYVDDKDGER--KQERRRVFEANLVKVGLELEIEDKSESDDRKTYFVKIHAPWEVLATYADVLKIKVPFKANDIP---DNSEMPMNWLSTPFRLPEPIMQPEPDFFTAPFDKSKSDFFLIEDRDKFFLPSTRNRIVYYILSRCSYIRDECGERDKKGIKRLLNNSTYTAAFPLHDSRYWTKSKDVNCDSDRYNLYKYWAGFFSFFKEQPLNLIRKYYGEKIGLYFAWLGFYTEMLFFAAVVGTLCFVYGVLTYDDNE--------------WSKEICSDEIGGNIVMCPLCDKKCGFWKLNTTCNSSWQSHLFDNVGTVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYETKCNSRKLNRITQEMEPYLPITSKCARICLSGATVLLWISLIIACIIGVIAYRLAVYAAFASIMKDSPTSNLEVVGPYITPQLATSVTASCINFVIIMILNLMYERVAVWITDMEIPKTHLEYENKLTVKMFLFQFVNYYSSCFYVAFFKGKFVGYPGDYAYMFGKWSKLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALVPWLM------------------------------------------NWWASRKARSYPESLYSRWEQDHDLQGFGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNIIEIRVDAWKLTTQFRRPVAAKAHCIGAWEEILNGMAVLSVVTNAFIVAFTSDMIPRLVYMYAYQPEGEMNMKGYINNSLSVFNISEIPLPNRPEDGENPLWFNSSITTCRYRDYRNPPGHENQYSHTMQFWHILAAKLAFIIIMEHVVFLVKYFVAWMIPDVPSDVKARVKRERYLVQEYLHNYEVEKLK 883          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:101164640])

HSP 1 Score: 522.702 bits (1345), Expect = 2.054e-170
Identity = 325/879 (36.97%), Postives = 498/879 (56.66%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVH--DKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF--DDL--QDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYR-------ARYTIIGSY--TKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-W---RQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKS-WTLNGYVNFTLSVFNISNFQPANIP---LNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLK 2628
            IDFV+ Y    D  +   Q RR+ FE NL   G++L   D     D+   FV +  PW++L  +AD +K+K+P K   +       E  M+++   F + +    P    + + F   K + F ++  + FF  S R+ I Y IL R  +  D+   +D  GI RL+    Y AA+PLH+ ++    K+    S+R  LY+YWA   SF + QP+ LIRKY+GEKI +YFAWLG YT  L   +++G   F Y ++ Y +++               S EIC++   G+ VMCP+CD+ C +W L  +C  S  + +FDN  T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C S+++N IT E E ++ +  K  R   S  TV   I+++++ I GVI  R+ + +           +   ++G Y   +L TS  A+ ++   I+ILN++Y+ +AV +TD E P+T  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G PG Y Y FG W   R EECDP GCL+EL+ Q++++  GKQ+  NI E  +P +                                           N  +    ++ P+     WE+D  L    +L +F EYLEMVIQ+GF+T+F A+ PLAPL ALFNNIIEIR+DA+K+ T++RRP+A +A  IG W +IL  ++++SVV+NAFI+++TS  +P+LVY Y Y  +    + GY+N +LSVFNIS     N P    NP     +IT CRYRD+R       +YS ++ +WH+LAA+LAF+I+ EHVVF +   + W+IP V   +K R+++E+ L  + +   E E+LK
Sbjct:  126 IDFVLSYVDDKDGER--KQERRRVFEANLVKVGLELEIEDKSESDDRKTYFVKIHAPWEVLATYADVLKIKVPFKANDIP---DNSEMPMNWLSTPFRLPEPIMQPEPDFFTAPFDKSKSDFFLIEDRDKFFLPSTRNRIVYYILSRCSYIRDECGERDKKGIKRLLNNSTYTAAFPLHDSRYWTKSKDVNCDSDRYNLYKYWAGFFSFFKEQPLNLIRKYYGEKIGLYFAWLGFYTEMLFFAAVVGTLCFVYGVLTYDDNE--------------WSKEICSDEIGGNIVMCPLCDKKCGFWKLNTTCNSSWQSHLFDNVGTVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYETKCNSRKLNRITQEMEPYLPITSKCARICLSGATVLLWISLIIACIIGVIAYRLAVYAAFASIMKDSPTSNLEVVGPYITPQLATSVTASCINFVIIMILNLMYERVAVWITDMEIPKTHLEYENKLTVKMFLFQFVNYYSSCFYVAFFKGKFVGYPGDYAYMFGKWSKLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALVPWLM------------------------------------------NWWASRKARSYPESLYSRWEQDHDLQGFGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNIIEIRVDAWKLTTQFRRPVAAKAHCIGAWEEILNGMAVLSVVTNAFIVAFTSDMIPRLVYMYAYQPEGEMNMKGYINNSLSVFNISEIPLPNRPEDGENPLWFNSSITTCRYRDYRNPPGHENQYSHTMQFWHILAAKLAFIIIMEHVVFLVKYFVAWMIPDVPSDVKARVKRERYLVQEYLHNYEVEKLK 943          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:101164640])

HSP 1 Score: 522.702 bits (1345), Expect = 1.319e-169
Identity = 325/879 (36.97%), Postives = 498/879 (56.66%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVH--DKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQF--DDL--QDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR---RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYR-------ARYTIIGSY--TKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFG-W---RQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQ-----WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKS-WTLNGYVNFTLSVFNISNFQPANIP---LNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLK 2628
            IDFV+ Y    D  +   Q RR+ FE NL   G++L   D     D+   FV +  PW++L  +AD +K+K+P K   +       E  M+++   F + +    P    + + F   K + F ++  + FF  S R+ I Y IL R  +  D+   +D  GI RL+    Y AA+PLH+ ++    K+    S+R  LY+YWA   SF + QP+ LIRKY+GEKI +YFAWLG YT  L   +++G   F Y ++ Y +++               S EIC++   G+ VMCP+CD+ C +W L  +C  S  + +FDN  T+ F+I + +W ++FL+FWKR+Q  L++ W+  D+EE + +   R +YE  C S+++N IT E E ++ +  K  R   S  TV   I+++++ I GVI  R+ + +           +   ++G Y   +L TS  A+ ++   I+ILN++Y+ +AV +TD E P+T  EY++ LT+KM++FQF N+Y S FY+A+FKG F+G PG Y Y FG W   R EECDP GCL+EL+ Q++++  GKQ+  NI E  +P +                                           N  +    ++ P+     WE+D  L    +L +F EYLEMVIQ+GF+T+F A+ PLAPL ALFNNIIEIR+DA+K+ T++RRP+A +A  IG W +IL  ++++SVV+NAFI+++TS  +P+LVY Y Y  +    + GY+N +LSVFNIS     N P    NP     +IT CRYRD+R       +YS ++ +WH+LAA+LAF+I+ EHVVF +   + W+IP V   +K R+++E+ L  + +   E E+LK
Sbjct:  191 IDFVLSYVDDKDGER--KQERRRVFEANLVKVGLELEIEDKSESDDRKTYFVKIHAPWEVLATYADVLKIKVPFKANDIP---DNSEMPMNWLSTPFRLPEPIMQPEPDFFTAPFDKSKSDFFLIEDRDKFFLPSTRNRIVYYILSRCSYIRDECGERDKKGIKRLLNNSTYTAAFPLHDSRYWTKSKDVNCDSDRYNLYKYWAGFFSFFKEQPLNLIRKYYGEKIGLYFAWLGFYTEMLFFAAVVGTLCFVYGVLTYDDNE--------------WSKEICSDEIGGNIVMCPLCDKKCGFWKLNTTCNSSWQSHLFDNVGTVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYETKCNSRKLNRITQEMEPYLPITSKCARICLSGATVLLWISLIIACIIGVIAYRLAVYAAFASIMKDSPTSNLEVVGPYITPQLATSVTASCINFVIIMILNLMYERVAVWITDMEIPKTHLEYENKLTVKMFLFQFVNYYSSCFYVAFFKGKFVGYPGDYAYMFGKWSKLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALVPWLM------------------------------------------NWWASRKARSYPESLYSRWEQDHDLQGFGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNIIEIRVDAWKLTTQFRRPVAAKAHCIGAWEEILNGMAVLSVVTNAFIVAFTSDMIPRLVYMYAYQPEGEMNMKGYINNSLSVFNISEIPLPNRPEDGENPLWFNSSITTCRYRDYRNPPGHENQYSHTMQFWHILAAKLAFIIIMEHVVFLVKYFVAWMIPDVPSDVKARVKRERYLVQEYLHNYEVEKLK 1008          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000027271.1 (SMESG000027271.1)

HSP 1 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 533/533 (100.00%), Postives = 533/533 (100.00%), Query Frame = 1
Query: 1144 MEDRRLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFGIGGRPSNQLANINFPRHSNKSKRSLEGKY 2742
            MEDRRLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLSVITGVILIRIIITSLLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIKKKWFFYLYKFKHRNMGKSKLSRSSLRLTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTMFAAAMPLAPLFALFNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQVISIISVVSNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFGIGGRPSNQLANINFPRHSNKSKRSLEGKY
Sbjct:    1 MEDRRLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLSVITGVILIRIIITSLLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIKKKWFFYLYKFKHRNMGKSKLSRSSLRLTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTMFAAAMPLAPLFALFNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQVISIISVVSNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFGIGGRPSNQLANINFPRHSNKSKRSLEGKY 533          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000027273.1 (SMESG000027273.1)

HSP 1 Score: 504.597 bits (1298), Expect = 1.218e-173
Identity = 245/245 (100.00%), Postives = 245/245 (100.00%), Query Frame = 1
Query:   28 MEFQEFPNKQFQEPSSFMDIDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAW 762
            MEFQEFPNKQFQEPSSFMDIDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAW
Sbjct:    1 MEFQEFPNKQFQEPSSFMDIDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFNMDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAW 245          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000052528.1 (SMESG000052528.1)

HSP 1 Score: 478.404 bits (1230), Expect = 1.311e-154
Identity = 334/869 (38.43%), Postives = 495/869 (56.96%), Query Frame = 1
Query:   85 IDFVIVYDI--------STDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMI-VPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESL-MSFVPDLFWVSQLDDVPHKQAYWSA-FRIDKQEMF-NMDPAELFFSKSQRSLIAYEILMRTQFDDLQD-DVGIDRLIKAGVYLAAYPLHEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDED--CDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLD-YEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISK--TNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEY-SVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLL--QTKLMFQAEAEQLK 2628
            ID++I ++         S +N KH  Q  RK+FE+NL    V++ + D   DK +   + I +PWDLL  +A+ M ++ PL+        +T + L + ++P++    QL+      AY++  F+    + +      E FF+ +QR  +AYEIL    +   +  ++GIDRL++ G+Y AAYPLH+G F+   KN  S +ERQ+LYE WA    + +YQP++ IR+Y+GEKI +YFAWLG+YT +L+P S++GI  F Y L+    +                S EIC      +Y MCP+C+ED  C YW L + C +SKI  +FD+  T+ FSI ++ W   FL+ WKRK   L + W+   +EE E R    Y   C S ++N +TG  E H     K  R LT    +  M  ++L  I  VI+ R++I   L++    ++ S   +  +  AAF++L  I+ L  +Y+ +A +LT +E  RTQTE+DD+L LK+Y+FQF NFY S+FYIA+FKG F G PG+Y  FFG R EEC    CL EL+ Q+ +I VGKQI+NN  EI +P I                                +T F   S   + +S    N + +  W +D++LL    L  F+EYLEMV+Q+GF+T+F AA PLAPLFAL NN +EIR+DA K++ + RRP++ +AQDIG W  IL  I  +SV+SNAF+I++TS  +P+L+Y+Y Y+ +   L GYVNFTLS      + P      P         CRYR  R+      EY S +IIYW +LA R  FVI++EHVVF ++ LI+ +IP +S ++++R+ +E  L  Q  L F+ + ++ K
Sbjct:   82 IDYIIAWEEEKNGSNVNSIENVKH--QNYRKRFEENLKKISVEMEQDDEESDKIIIHCVKIHIPWDLLCHYAEEMNLRAPLQMRNEGRENNTEKLLKLLYIPNIM---QLNIPRRPMAYFTCNFKKSNLDRYIGCKNQETFFTATQRQQVAYEILATQVYGKRRKAEIGIDRLLEEGIYSAAYPLHDGPFQQCGKNADSLNERQMLYENWAKWSMWYKYQPLDHIREYYGEKIGLYFAWLGMYTVWLLPASIIGILVFIYGLLTINKNVP--------------SNEICQSNQ--TYRMCPLCNEDIGCPYWYLSDVCFYSKITYMFDHPGTVFFSIFMAFWAVSFLENWKRKNASLAYHWDVIHFEEEEQRPRPEYAALCPSVKMNPVTGLMEPHFPTMRKAFRFLTGICVISIMFVLILIFIIAVIIYRVLIAIPLFQN--PLLRSKAIIFANTSAAFVNLILIMCLGRVYEKLAYKLTQWEMHRTQTEFDDHLILKVYLFQFVNFYSSIFYIAFFKGRFNGYPGNYSLFFGLRNEECSNGSCLFELAQQLAIIMVGKQIINNFQEIFVPKI--------------------------------LTWFYQCSKGLDKVSNLDENKELIKFWAEDYKLLPYEGL--FEEYLEMVLQFGFITIFVAAFPLAPLFALLNNWVEIRLDAKKLVCETRRPISERAQDIGKWSVILDAIVHLSVISNAFLIAFTSEFLPKLIYKYRYDDQ---LRGYVNFTLS------WAPNGSLTEP---------CRYRALRD------EYGSYTIIYWQLLALRFGFVIIFEHVVFSVAHLIDIVIPDISYNLQVRMRRENYLAKQALLEFKKKTDKRK 869          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000053932.1 (SMESG000053932.1)

HSP 1 Score: 460.299 bits (1183), Expect = 4.561e-148
Identity = 319/864 (36.92%), Postives = 496/864 (57.41%), Query Frame = 1
Query:   85 IDFVIVYD-----ISTDNAKHLNQTR-RKKFEKNLFNKGVKLSKVDGVHDKAL-SFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMF-NMDPAELFFSKSQRSLIAYEILMRTQFD-DLQDDVGIDRLIKAGVYLAAYPLHEGKFK---DNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMC--DEDCDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNL-PQ-WEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAEAEQL 2625
            ID+VIV++     I+ D  +    T  RK+F++ L   G+   +     +K + +F+ + +P++++  +A+A+  ++PL+      P  +   L  F+   F  ++L   P   A  +AF+ D+ E +      + FFS +QR  +A EIL  T +    + ++GIDR+I   +Y AAYPLHEG  +   D L      + RQ+L+EYWA    F +YQPIE IR+Y+GEKI+IYFAWLGLYT +L P SL+GIF F Y ++   +               ++S EIC+     ++ MCP+C  ++ C YW L + C +S++  +FD+  T+ FSI +S+W   FL+ WKRK  +L + W+T DYEE +++ R +Y      +R+N +TG  E +  +  ++ R LT    +  M  +V+  I GVI+ RI+I   L+     ++ S   +  S  AA ++L  I+ L ++Y+ +A +LT +E  RT+TE++D+LT+K+Y+F+F NFY S+FYIA+FKG F G PG Y  FFG R E+C    CL EL+ QM +I VG QI+NNI EI LP +                                VT F       N + + + K++ P+ W +D++LL    L  FDEYLEM++Q+GF+T+F AA PLAP FAL NN +EIR+DA K++   RRP+A +AQD+G WF IL +I  +S++SNAF+I++TS  +P+ VY+Y +N   + L+GYVNFTL+      + P N    P         CRYRDFR+         ++  YW +LA RL FVIV+EH+VF ++ LI+ +IP V  S++I + ++  +  + +      ++
Sbjct:   44 IDYVIVWEQDRIAINVDPERRRRITEYRKRFQEKLLKMGLSCEEEIEESEKMMINFIKIHIPFNIMCIYAEALNFRVPLQIGPPHTPHFSERVLKFFLIPNFMKNELPYSPDCFAT-AAFKTDQLEKYLGYTNEDTFFSTTQRHQVAREILATTVYGRQTKGEIGIDRMIDEEIYSAAYPLHEGPAEVPTDLLGKVDLWNRRQILFEYWAKWSKFYKYQPIENIREYYGEKIAIYFAWLGLYTAWLFPASLVGIFVFVYGILTMKSY--------------TISKEICDTNN--TFKMCPLCNYEKGCRYWNLSDICFYSQMTYLFDHPGTVFFSIFMSVWAVAFLENWKRKNAELSYRWDTVDYEEEDEKPRPEYVALATEKRVNPVTGIEEPYFPVNLRMKRMLTGVMCIVVMFMIVIIFIIGVIIYRILIAIPLFDN--PLLRSKALIFASVSAAIVNLILIMSLGLVYEKLAYKLTQWEMHRTETEFEDHLTVKVYLFEFVNFYSSIFYIAFFKGRFNGYPGKYSLFFGLRNEDCSNGSCLFELAQQMAIIMVGNQIINNIQEIFLPKL--------------------------------VTWFHRFKKGLNNMVQLSGKDVEPKLWSEDYKLLPYEGL--FDEYLEMIVQFGFITIFVAAFPLAPFFALINNWLEIRLDASKLVLSTRRPVAERAQDMGTWFIILNLIVKLSIISNAFLIAFTSDFIPKQVYKYSHN---FLLDGYVNFTLA------WAPNNSLSEP---------CRYRDFRD-----VNGKLTRFYWRLLAIRLTFVIVFEHIVFGVAYLIDILIPDVPESLQIEMRRKNYMAKQALLNMTKNEM 831          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000006381.1 (SMESG000006381.1)

HSP 1 Score: 452.981 bits (1164), Expect = 2.096e-145
Identity = 302/855 (35.32%), Postives = 483/855 (56.49%), Query Frame = 1
Query:   85 IDFVIVYDISTDNAKHLNQTRRKKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPLKTTMVKPPLSTLESLMSF-VPDLFWVSQLDDVPHKQA--YWSAFRIDKQEMFNMDPAEL-FFSKSQRSLIAYEILMRTQF--DDLQDDVGIDRLIKAGVYLAAYPLHEGKF---KDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISIYFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*IKTM*YDF*PSLSMEICNERGIGSYVMCPMCDED--CDYWILYESCLFSKIAGIFDNSFTIIFSICISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDR-RLDYEKNCQSQRINFITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLXXXXXXXXXXXXXXXXLYRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRTQTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQEECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIXXXXXXXXXXXXHRNMGXXXXXXXXXXXTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLLDTNELDIFDEYLEMVIQYGFVTXXXXXXXXXXXXXXXNNIIEIRIDAYKMLTKWRRPLARQAQDIGIWFDILQXXXXXXXXXNAFIISYTSSAVPQLVYRYYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDFREGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSPSIKIRIEQEKLLQTKLMFQAE 2613
            IDF++ +    +   H     RKKFE NL   G++L + D        ++ + VPW+++ +FA+ + ++ PL+         ++++L    +P++ ++    D P+K    Y   F+  K   F     +L +FS +QR  +  EIL  TQ      + ++GI R++   +Y +AYPLHEG +   K  L+     + RQ+LYEYWA    + +YQP++ IR+YFGEKI  YFAW+GLYT +L+P S++GIF F Y +  +  +                + EIC   G  S+ MCP+CDE   C YW L + C+F KIA +FD+  TI +SI +++W   FL++WKRK   L   W+  DYEE E+R R  Y   C   + N +TG  E +   + ++ R LT    +  M+TVV+  I  VI+ R++I   +++    ++ +      +G AA ++L  I+ L  +Y+ IA++LT++E  RTQ+++D+ L  K+++FQF NFY S+FYIA+FKG F+G PG+Y YFFG R E+C   GCL+EL++Q+ +I VGKQI++NI E+ +P +          + +R              + SG+ I+ +                     D +L+    L   DEYLE+V+Q+GF+T+F AA PLAP FAL NN +EIR+DA K++ + +RP+A +A+DIG+WF IL+ I+ I+ +SNAF++++TS  +P+L YRY ++    +L+GY N +LS      + P N  + P         CRY  +R+      +Y     +W +LA RL FVIV+EH V  + +L++ +IP V   + I+I++E  L  + +  A+
Sbjct:   47 IDFILAWS-EKEKEPHSKALYRKKFESNLKKAGLELEE-DFDETGKFHYIKIYVPWEIMCRFAEKLALRAPLQAHPNPSDDWSMKALNCLHIPNIMYL----DAPNKPPDFYTCEFKQSKIHRFLGSNNKLTYFSSTQRHQVVNEIL-ETQLYGRRRKGEIGIKRMVDDEIYDSAYPLHEGPYECSKTELEQPEKLNSRQILYEYWARYGRWYQYQPLDHIREYFGEKIGFYFAWMGLYTAWLLPASIIGIFVFLYGVFTFDRNIS--------------AKEIC--AGNNSFYMCPLCDEKIGCQYWELKDVCMFIKIAYLFDHPGTIFYSIFMAMWAVTFLEYWKRKNASLAHHWDVMDYEEEEERPRAQYAALCSIFQKNPVTGVIEPYFPKERRLPRILTGIVCILLMMTVVIIFIIAVIIYRVLIEIPMFQN--PLLRNNAVTFANGTAAIVNLVLIMCLAKVYEIIALKLTEWEMHRTQSDFDNQLIFKVFLFQFVNFYSSIFYIAFFKGRFVGYPGNYSYFFGLRNEDCQNGGCLIELAMQLAIIMVGKQIISNIQEVIVPKL--------QTWFYRFSKGLGEQVQHDSCSNSGLIIYKE---------------------DNKLIPYEGL--LDEYLEIVLQFGFITIFVAAFPLAPFFALLNNWMEIRLDAQKLVCETQRPVAERAKDIGVWFVILESITTIACISNAFLLAFTSEFLPKLYYRYRFD----SLDGYTNHSLS------WSPKNSTVIP---------CRYPGYRDNDGILKQY-----FWELLAVRLGFVIVFEHTVAGIGKLLDLLIPDVPKELYIKIKRETYLAKQALQDAD 821          
The following BLAST results are available for this feature:
BLAST of Anoctamin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANO41.383e-17836.46anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837][more]
ANO42.827e-17836.46anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837][more]
ANO42.149e-17636.46anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837][more]
ANO63.146e-17237.67anoctamin 6 [Source:HGNC Symbol;Acc:HGNC:25240][more]
ANO67.627e-17237.67anoctamin 6 [Source:HGNC Symbol;Acc:HGNC:25240][more]
back to top
BLAST of Anoctamin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
anoh-12.017e-4426.05Anoctamin [Source:UniProtKB/TrEMBL;Acc:C0P286][more]
anoh-12.361e-4425.79Anoctamin [Source:UniProtKB/TrEMBL;Acc:C0P286][more]
anoh-29.408e-923.67Anoctamin [Source:UniProtKB/TrEMBL;Acc:H2L2L3][more]
anoh-29.976e-923.67Anoctamin [Source:UniProtKB/TrEMBL;Acc:H2L2L3][more]
back to top
BLAST of Anoctamin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
subdued7.539e-15235.05gene:FBgn0038721 transcript:FBtr0083806[more]
subdued7.539e-15235.05gene:FBgn0038721 transcript:FBtr0334921[more]
subdued1.368e-15035.05gene:FBgn0038721 transcript:FBtr0083805[more]
subdued3.748e-14934.11gene:FBgn0038721 transcript:FBtr0334922[more]
subdued1.322e-14734.37gene:FBgn0038721 transcript:FBtr0302492[more]
back to top
BLAST of Anoctamin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano31.822e-17436.51anoctamin 3 [Source:ZFIN;Acc:ZDB-GENE-111031-3][more]
ano5a1.142e-17037.54anoctamin 5a [Source:ZFIN;Acc:ZDB-GENE-091013-2][more]
ano5a5.545e-17037.06anoctamin 5a [Source:ZFIN;Acc:ZDB-GENE-091013-2][more]
ano5b2.079e-16736.80anoctamin 5b [Source:ZFIN;Acc:ZDB-GENE-061215-108][more]
ano61.348e-15737.12anoctamin 6 [Source:ZFIN;Acc:ZDB-GENE-081104-64][more]
back to top
BLAST of Anoctamin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANO52.837e-17937.01anoctamin 5 [Source:NCBI gene;Acc:100489787][more]
ANO52.993e-17937.01anoctamin 5 [Source:NCBI gene;Acc:100489787][more]
ANO56.884e-17837.64anoctamin 5 [Source:NCBI gene;Acc:100489787][more]
ANO51.230e-17736.89anoctamin 5 [Source:NCBI gene;Acc:100489787][more]
ANO42.233e-17436.29major histocompatibility complex class I-related g... [more]
back to top
BLAST of Anoctamin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ano42.267e-17936.69anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344][more]
Ano42.267e-17936.69anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344][more]
Ano43.093e-17936.69anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344][more]
Ano62.399e-17136.91anoctamin 6 [Source:MGI Symbol;Acc:MGI:2145890][more]
Ano64.610e-17136.91anoctamin 6 [Source:MGI Symbol;Acc:MGI:2145890][more]
back to top
BLAST of Anoctamin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8C5H1|ANO4_MOUSE2.163e-17836.69Anoctamin-4 OS=Mus musculus OX=10090 GN=Ano4 PE=1 ... [more]
sp|Q32M45|ANO4_HUMAN1.358e-17736.46Anoctamin-4 OS=Homo sapiens OX=9606 GN=ANO4 PE=2 S... [more]
sp|A6QLE6|ANO4_BOVIN5.007e-17736.46Anoctamin-4 OS=Bos taurus OX=9913 GN=ANO4 PE=2 SV=... [more]
sp|Q4KMQ2|ANO6_HUMAN3.663e-17137.67Anoctamin-6 OS=Homo sapiens OX=9606 GN=ANO6 PE=1 S... [more]
sp|Q6P9J9|ANO6_MOUSE1.678e-17036.91Anoctamin-6 OS=Mus musculus OX=10090 GN=Ano6 PE=1 ... [more]
back to top
BLAST of Anoctamin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K2670.000e+042.89Anoctamin OS=Lingula unguis OX=7574 GN=LOC10617818... [more]
A0A2C9JK880.000e+039.36Anoctamin OS=Biomphalaria glabrata OX=6526 GN=1060... [more]
R7UV800.000e+040.58Anoctamin OS=Capitella teleta OX=283909 GN=CAPTEDR... [more]
A0A2C9JK990.000e+039.96Anoctamin OS=Biomphalaria glabrata OX=6526 GN=1060... [more]
A0A2C9JK920.000e+040.26Anoctamin OS=Biomphalaria glabrata OX=6526 GN=1060... [more]
back to top
BLAST of Anoctamin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano5a8.339e-17137.18anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
ano5a1.004e-17037.18anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
ano5a2.438e-17037.18anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
ano5a2.539e-17036.90anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
ano5a6.826e-17036.90anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
back to top
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano113.986e-14435.90anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
ENSPMAT00000000399.11.462e-11534.77pep scaffold:Pmarinus_7.0:GL477564:2673:43187:-1 g... [more]
ano39.194e-9939.19anoctamin 3 [Source:ZFIN;Acc:ZDB-GENE-111031-3][more]
ano111.685e-8138.12anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
ano117.959e-8140.75anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
back to top
BLAST of Anoctamin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anoctamin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498551.142e-15937.16Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REV0][more]
EDO483077.607e-14536.02Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RJQ8][more]
EDO480481.571e-13633.18Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU7][more]
EDO480502.170e-13334.52Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU9][more]
EDO498546.688e-13337.10Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REU8][more]
back to top
BLAST of Anoctamin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano31.261e-17236.53anoctamin 3 [Source:NCBI gene;Acc:101164148][more]
ano5a6.288e-17136.97anoctamin 5 [Source:NCBI gene;Acc:101164640][more]
ano5a1.236e-17036.97anoctamin 5 [Source:NCBI gene;Acc:101164640][more]
ano5a2.054e-17036.97anoctamin 5 [Source:NCBI gene;Acc:101164640][more]
ano5a1.319e-16936.97anoctamin 5 [Source:NCBI gene;Acc:101164640][more]
back to top
BLAST of Anoctamin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027271.10.000e+0100.00SMESG000027271.1[more]
SMESG000027273.11.218e-173100.00SMESG000027273.1[more]
SMESG000052528.11.311e-15438.43SMESG000052528.1[more]
SMESG000053932.14.561e-14836.92SMESG000053932.1[more]
SMESG000006381.12.096e-14535.32SMESG000006381.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012337 ID=SMED30012337|Name=Anoctamin|organism=Schmidtea mediterranea sexual|type=transcript|length=2831bp
TTCCTATATCAATTTCCTTTTAGAGAAATGGAATTCCAAGAATTTCCGAA
TAAACAGTTCCAGGAACCTTCTAGTTTTATGGATATTGACTTTGTCATTG
TCTACGATATCAGCACAGACAACGCAAAGCACCTCAATCAGACTCGAAGA
AAAAAATTTGAAAAAAATCTTTTTAATAAAGGAGTTAAATTGTCAAAAGT
TGACGGAGTACATGATAAAGCACTGTCCTTTGTTTTGATGATTGTTCCGT
GGGATTTGCTATTGAAATTCGCGGATGCTATGAAAATGAAAATGCCTCTG
AAGACAACAATGGTGAAACCACCACTTTCAACTTTGGAGTCTTTAATGAG
CTTTGTGCCTGATTTGTTTTGGGTTTCGCAACTGGACGATGTCCCACATA
AACAAGCGTATTGGAGTGCTTTCCGGATAGATAAACAGGAAATGTTCAAC
ATGGATCCTGCGGAATTATTTTTCTCAAAATCTCAAAGAAGCTTAATAGC
GTATGAAATCTTGATGAGGACTCAGTTCGATGACCTACAGGATGACGTGG
GAATCGATCGACTTATAAAGGCGGGAGTATACCTCGCAGCATATCCTCTA
CACGAAGGTAAATTTAAGGATAATTTGAAGAATAATACAAGTAAAAGCGA
AAGACAAGTTCTCTACGAATATTGGGCAACGCCGAGAAGTTTCTGCCGAT
ATCAACCAATTGAGTTAATCAGGAAATATTTTGGTGAAAAAATATCTATA
TACTTTGCATGGTTGGGCTTGTATACGTTTTTCTTGATTCCAATTTCGTT
GCTAGGAATCTTTGGATTTGGGTACAATCTCATTAATTATGGCAATGATG
ATCAGAGGTAGATCAAGACAATGTGATACGATTTTTAGCCATCATTAAGT
ATGGAAATATGCAACGAGAGAGGGATCGGATCCTATGTCATGTGTCCCAT
GTGCGATGAAGACTGTGATTACTGGATTTTGTATGAGAGCTGTCTGTTTT
CGAAAATCGCTGGGATATTTGATAATTCGTTTACGATTATATTTTCGATT
TGCATTTCCTTGTGGGGGTCAGTATTCCTTCAGTTTTGGAAAAGGAAACA
AACAGATCTTCAATTCTCGTGGAATACTAATGACTATGAGGAAATGGAAG
ACCGTAGATTGGATTATGAAAAGAACTGTCAAAGTCAAAGAATTAATTTT
ATTACTGGGGAATGGGAATGGCATATGAAATTAAAGGATAAAATTCTAAG
AAAACTAACATCATTTTTTACGGTTTTTTTCATGATAACTGTTGTGCTGA
GTGTAATCACAGGGGTCATTCTTATTAGAATAATAATCACTAGCTTGCTA
TACAGGGCCAGGTACACTATAATCGGGAGCTATACAAAATTATTAACTTC
TGGTTTGGCAGCTTTTATGGATCTATGCGCCATTCTTATATTAAATGTGC
TTTACCAATTTATTGCAGTTCGTCTGACAGATTTTGAAAACCCTCGGACA
CAAACCGAATACGATGATAACCTCACTTTGAAGATGTATGTGTTCCAATT
TTTTAACTTCTATTGCTCATTGTTTTACATCGCATACTTCAAAGGATCAT
TCATTGGACGGCCAGGAAGCTATTATTACTTTTTCGGTTGGAGGCAAGAA
GAATGTGATCCTGCAGGTTGTCTAATGGAACTTTCAATTCAAATGCTCGT
GATTTTTGTGGGTAAACAGATCATGAATAATATCATGGAAATTTCTCTAC
CGATCATCAAAAAGAAATGGTTCTTTTATCTCTACAAATTCAAACATAGA
AACATGGGAAAATCGAAATTATCTCGGTCGAGTCTACGTTTGACGGAATC
GGGCGTCACGATTTTTTCTGACGAATCCTTGAACACGAACGGAATATCGA
AAACGAATTTGAAAAACCTTCCACAATGGGAAAAGGATTTTCGTTTACTG
GATACCAACGAACTCGATATTTTTGATGAATATTTAGAAATGGTGATTCA
ATATGGATTCGTGACCATGTTTGCAGCAGCAATGCCTTTGGCACCTTTAT
TTGCTCTTTTTAATAATATCATAGAAATCCGTATTGATGCCTATAAAATG
CTGACGAAATGGAGACGACCACTTGCAAGGCAAGCACAAGACATAGGGAT
ATGGTTTGACATTCTTCAGGTCATTTCTATTATTTCTGTGGTTTCCAATG
CATTTATAATAAGTTACACATCCAGTGCAGTTCCACAGTTGGTTTATCGT
TATTATTACAACCATAAATCTTGGACTCTAAATGGATATGTCAACTTTAC
GCTGTCAGTTTTCAATATATCAAATTTCCAACCTGCCAATATTCCCCTAA
ATCCCAGACCAATATTTCAGAATATAACCGTTTGCAGATATCGGGATTTT
CGAGAGGGAGTAGAATCCAATCCGGAATATTCGGTCTCCATAATCTATTG
GCATGTTTTGGCTGCACGACTGGCTTTTGTAATCGTATATGAACATGTCG
TATTTTTCTTGTCGGAACTCATCAACTGGATCATCCCGACAGTTTCTCCG
TCTATTAAAATACGAATTGAACAAGAGAAACTTTTACAGACAAAACTGAT
GTTTCAGGCCGAAGCGGAACAATTGAAACAAGTATTTGTTGATACCGGAT
TTGGTATCGGAGGAAGGCCGAGCAATCAGCTGGCAAACATAAATTTTCCA
AGACATTCAAACAAAAGTAAACGGAGCTTGGAAGGGAAATACTGACTTTC
TGTTGCTACTTTGAAATTCAGTAGTGTAAACTGTGTTACCTTTCGCACTT
TTTCGCCACCCCTAAGACTTATTAAATAGTT
back to top

protein sequence of SMED30012337-orf-1

>SMED30012337-orf-1 ID=SMED30012337-orf-1|Name=SMED30012337-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=287bp
FLYQFPFREMEFQEFPNKQFQEPSSFMDIDFVIVYDISTDNAKHLNQTRR
KKFEKNLFNKGVKLSKVDGVHDKALSFVLMIVPWDLLLKFADAMKMKMPL
KTTMVKPPLSTLESLMSFVPDLFWVSQLDDVPHKQAYWSAFRIDKQEMFN
MDPAELFFSKSQRSLIAYEILMRTQFDDLQDDVGIDRLIKAGVYLAAYPL
HEGKFKDNLKNNTSKSERQVLYEYWATPRSFCRYQPIELIRKYFGEKISI
YFAWLGLYTFFLIPISLLGIFGFGYNLINYGNDDQR*
back to top

protein sequence of SMED30012337-orf-2

>SMED30012337-orf-2 ID=SMED30012337-orf-2|Name=SMED30012337-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=615bp
MEICNERGIGSYVMCPMCDEDCDYWILYESCLFSKIAGIFDNSFTIIFSI
CISLWGSVFLQFWKRKQTDLQFSWNTNDYEEMEDRRLDYEKNCQSQRINF
ITGEWEWHMKLKDKILRKLTSFFTVFFMITVVLSVITGVILIRIIITSLL
YRARYTIIGSYTKLLTSGLAAFMDLCAILILNVLYQFIAVRLTDFENPRT
QTEYDDNLTLKMYVFQFFNFYCSLFYIAYFKGSFIGRPGSYYYFFGWRQE
ECDPAGCLMELSIQMLVIFVGKQIMNNIMEISLPIIKKKWFFYLYKFKHR
NMGKSKLSRSSLRLTESGVTIFSDESLNTNGISKTNLKNLPQWEKDFRLL
DTNELDIFDEYLEMVIQYGFVTMFAAAMPLAPLFALFNNIIEIRIDAYKM
LTKWRRPLARQAQDIGIWFDILQVISIISVVSNAFIISYTSSAVPQLVYR
YYYNHKSWTLNGYVNFTLSVFNISNFQPANIPLNPRPIFQNITVCRYRDF
REGVESNPEYSVSIIYWHVLAARLAFVIVYEHVVFFLSELINWIIPTVSP
SIKIRIEQEKLLQTKLMFQAEAEQLKQVFVDTGFGIGGRPSNQLANINFP
RHSNKSKRSLEGKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR007632Anoctamin
IPR032394Anoct_dimer
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 79..99
NoneNo IPR availablePANTHERPTHR12308:SF31ANOCTAMINcoord: 26..575
NoneNo IPR availableTMHMMTMhelixcoord: 415..437
NoneNo IPR availableTMHMMTMhelixcoord: 37..59
NoneNo IPR availableTMHMMTMhelixcoord: 365..387
NoneNo IPR availableTMHMMTMhelixcoord: 170..192
NoneNo IPR availableTMHMMTMhelixcoord: 514..536
NoneNo IPR availableTMHMMTMhelixcoord: 213..235
NoneNo IPR availableTMHMMTMhelixcoord: 119..141
IPR007632AnoctaminPFAMPF04547Anoctamincoord: 38..558
e-value: 2.8E-124
score: 415.4
IPR007632AnoctaminPANTHERPTHR12308NGEP-RELATEDcoord: 26..575