EGR-1

Overview
NameEGR-1 (AFD29624.1)
Smed IDSMED30012332
Length (bp)1460
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EGR-1 (SMED30012332) t-SNE clustered cells

Violin plots show distribution of expression levels for EGR-1 (SMED30012332) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EGR-1 (SMED30012332) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EGR-1 (SMED30012332) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012332

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 27

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30012332SMESG000034285.1 SMED30012332smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30012332SMESG000034285.1 SmedASXL_008042SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30012332SMESG000034285.1 SmedASXL_065460SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30012332SMESG000034285.1 SmedASXL_008042SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30012332SMESG000034285.1 SmedASXL_008042SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012332SMESG000034285.1 SmedASXL_008042SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymaSMED30012332SMESG000034285.1 SmedASXL_008042SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30012332SMESG000034285.1 SmedASXL_065460SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012332SMESG000034285.1 SmedASXL_065460SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Category 2 cellSMED30012332SMESG000034285.1 SMED30012332smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Category 3 cellSMED30012332SMESG000034285.1 SMED30012332smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30012332SMESG000034285.1 SMED30012332smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30012332SMESG000034285.1 SMED30012332smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30012332SMESG000034285.1 dd_Smed_v4_3935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012332SMESG000034285.1 dd_Smed_v4_3935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012332SMESG000034285.1 dd_Smed_v4_3935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012332SMESG000034285.1 Contig48378uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012332SMESG000034285.1 Contig48378newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30012332SMESG000034285.1 JQ425156smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30012332SMESG000034285.1 JQ425156smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult fluorescence in situ hybridization evidence
Category 2 cellSMED30012332SMESG000034285.1 dd_Smed_v6_3935_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012332SMESG000034285.1 SMED_00244_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30012332SMESG000034285.1 SMED_00244_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30012332SMESG000034285.1 SmWIOct06_019211GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30012332SMESG000034285.1 SmWIOct06_008915GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30012332SMESG000034285.1 SMED30012332smed_20140614PMID:22385657
Wagner et al., 2012
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30012332SMESG000034285.1 SMED30012332smed_20140614PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EGR-1 vs. Ensembl Human
Match: EGR3 (early growth response 3 [Source:HGNC Symbol;Acc:HGNC:3240])

HSP 1 Score: 105.145 bits (261), Expect = 4.318e-24
Identity = 49/85 (57.65%), Postives = 59/85 (69.41%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
             C  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP++CE C + FARSDER RH +IH K   +K +K
Sbjct:  281 GCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKAEK 365          

HSP 2 Score: 52.373 bits (124), Expect = 1.126e-6
Identity = 23/57 (40.35%), Postives = 30/57 (52.63%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEK 838
            K F C  C   F+R D L  H + HTG K   C +C + F RSD R+ H + H  +K
Sbjct:  303 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQK 359          
BLAST of EGR-1 vs. Ensembl Human
Match: EGR1 (early growth response 1 [Source:HGNC Symbol;Acc:HGNC:3238])

HSP 1 Score: 106.686 bits (265), Expect = 4.699e-24
Identity = 53/102 (51.96%), Postives = 67/102 (65.69%), Query Frame = 2
Query:  611 RISREEKSKSGKSNQLPPDKSFTCS--NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIH 910
            + SR  K  +  S   P ++ + C   +C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+IC + FARSDER RHT+IH
Sbjct:  317 KPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIH 418          
BLAST of EGR-1 vs. Ensembl Human
Match: EGR3 (early growth response 3 [Source:HGNC Symbol;Acc:HGNC:3240])

HSP 1 Score: 103.99 bits (258), Expect = 8.407e-24
Identity = 49/85 (57.65%), Postives = 59/85 (69.41%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
             C  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP++CE C + FARSDER RH +IH K   +K +K
Sbjct:  243 GCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKAEK 327          

HSP 2 Score: 51.6026 bits (122), Expect = 1.637e-6
Identity = 23/57 (40.35%), Postives = 30/57 (52.63%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEK 838
            K F C  C   F+R D L  H + HTG K   C +C + F RSD R+ H + H  +K
Sbjct:  265 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQK 321          
BLAST of EGR-1 vs. Ensembl Human
Match: EGR2 (early growth response 2 [Source:HGNC Symbol;Acc:HGNC:3239])

HSP 1 Score: 103.605 bits (257), Expect = 4.319e-23
Identity = 57/120 (47.50%), Postives = 71/120 (59.17%), Query Frame = 2
Query:  590 PLHDPISRISREEKSKSGKSNQLPPDKSFTCS--NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKP 943
            P H P+  I R  K  +  S     ++ + C    C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+ C + FARSDER RHT+IH +   RK   P
Sbjct:  312 PHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAP 431          
BLAST of EGR-1 vs. Ensembl Human
Match: EGR2 (early growth response 2 [Source:HGNC Symbol;Acc:HGNC:3239])

HSP 1 Score: 103.605 bits (257), Expect = 4.319e-23
Identity = 57/120 (47.50%), Postives = 71/120 (59.17%), Query Frame = 2
Query:  590 PLHDPISRISREEKSKSGKSNQLPPDKSFTCS--NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKP 943
            P H P+  I R  K  +  S     ++ + C    C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+ C + FARSDER RHT+IH +   RK   P
Sbjct:  312 PHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAP 431          
BLAST of EGR-1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 106.301 bits (264), Expect = 1.267e-25
Identity = 51/86 (59.30%), Postives = 60/86 (69.77%), Query Frame = 2
Query:  665 DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSK 916
            D+ + C    C  +F+R DEL RH +IHTG K   C  C + F RSDH  TH+RTHTGEKPYSC+IC K FAR DERTRHT+IH K
Sbjct:  175 DRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKK 260          
BLAST of EGR-1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 106.301 bits (264), Expect = 1.565e-25
Identity = 53/93 (56.99%), Postives = 62/93 (66.67%), Query Frame = 2
Query:  665 DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRK 937
            D+ + C    C  +F+R DEL RH +IHTG K   C  C + F RSDH  TH+RTHTGEKPYSC+IC K FAR DERTRHT+IH K    K K
Sbjct:  175 DRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKSGPGKHK 267          

HSP 2 Score: 49.2914 bits (116), Expect = 2.781e-6
Identity = 25/65 (38.46%), Postives = 30/65 (46.15%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICC 862
            K F C  C  RF+R D L  H + HTG K   C  C K F R D R  H + H    P   ++ C
Sbjct:  206 KPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKSGPGKHKMKC 270          
BLAST of EGR-1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 100.138 bits (248), Expect = 3.587e-25
Identity = 51/86 (59.30%), Postives = 60/86 (69.77%), Query Frame = 2
Query:  665 DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSK 916
            D+ + C    C  +F+R DEL RH +IHTG K   C  C + F RSDH  TH+RTHTGEKPYSC+IC K FAR DERTRHT+IH K
Sbjct:   10 DRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKK 95          
BLAST of EGR-1 vs. Ensembl Celegans
Match: egrh-1 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:Q18250])

HSP 1 Score: 107.071 bits (266), Expect = 1.012e-24
Identity = 51/92 (55.43%), Postives = 65/92 (70.65%), Query Frame = 2
Query:  644 KSNQLP-PDKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIH 910
            KS+++P  D+ + C    C  RF+R DEL RH +IHTG K   C  C + F RSDH  TH+RTHTGEKP+SC+IC + FARSDER RHT++H
Sbjct:  363 KSSKMPLQDRPYKCPRDGCDRRFSRSDELTRHIRIHTGQKPFQCRICMRAFSRSDHLTTHVRTHTGEKPFSCDICGRKFARSDERKRHTKVH 454          

HSP 2 Score: 61.6178 bits (148), Expect = 5.334e-10
Identity = 27/54 (50.00%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  764 CP--YCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            CP   CD+ F RSD    HIR HTG+KP+ C IC + F+RSD  T H R H+ +
Sbjct:  376 CPRDGCDRRFSRSDELTRHIRIHTGQKPFQCRICMRAFSRSDHLTTHVRTHTGE 429          
BLAST of EGR-1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 99.3673 bits (246), Expect = 1.087e-24
Identity = 53/93 (56.99%), Postives = 62/93 (66.67%), Query Frame = 2
Query:  665 DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRK 937
            D+ + C    C  +F+R DEL RH +IHTG K   C  C + F RSDH  TH+RTHTGEKPYSC+IC K FAR DERTRHT+IH K    K K
Sbjct:   10 DRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKSGPGKHK 102          
BLAST of EGR-1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0330050)

HSP 1 Score: 111.694 bits (278), Expect = 1.458e-25
Identity = 50/93 (53.76%), Postives = 65/93 (69.89%), Query Frame = 2
Query:  665 DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRK 937
            ++ + C   NC  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP+SC+IC + FARSDE+ RH ++H K  ++K K
Sbjct: 1033 ERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQRIKKEK 1125          
BLAST of EGR-1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0083542)

HSP 1 Score: 111.309 bits (277), Expect = 1.910e-25
Identity = 50/93 (53.76%), Postives = 65/93 (69.89%), Query Frame = 2
Query:  665 DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRK 937
            ++ + C   NC  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP+SC+IC + FARSDE+ RH ++H K  ++K K
Sbjct: 1033 ERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQRIKKEK 1125          
BLAST of EGR-1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0301615)

HSP 1 Score: 110.153 bits (274), Expect = 3.349e-25
Identity = 50/93 (53.76%), Postives = 65/93 (69.89%), Query Frame = 2
Query:  665 DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRK 937
            ++ + C   NC  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP+SC+IC + FARSDE+ RH ++H K  ++K K
Sbjct:  564 ERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQRIKKEK 656          
BLAST of EGR-1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0344633)

HSP 1 Score: 109.768 bits (273), Expect = 5.083e-25
Identity = 50/93 (53.76%), Postives = 65/93 (69.89%), Query Frame = 2
Query:  665 DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRK 937
            ++ + C   NC  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP+SC+IC + FARSDE+ RH ++H K  ++K K
Sbjct:  753 ERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQRIKKEK 845          
BLAST of EGR-1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0083543)

HSP 1 Score: 109.768 bits (273), Expect = 5.083e-25
Identity = 50/93 (53.76%), Postives = 65/93 (69.89%), Query Frame = 2
Query:  665 DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRK 937
            ++ + C   NC  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP+SC+IC + FARSDE+ RH ++H K  ++K K
Sbjct:  753 ERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQRIKKEK 845          
BLAST of EGR-1 vs. Ensembl Zebrafish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:30498])

HSP 1 Score: 108.997 bits (271), Expect = 4.797e-25
Identity = 56/110 (50.91%), Postives = 70/110 (63.64%), Query Frame = 2
Query:  617 SREEKSKSGKSNQLPPDKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
            SR  K  +  S   P ++ + C    C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++CEIC + FARSDER RHT+IH +   +K +K
Sbjct:  292 SRMRKYPNRPSKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMRQKDKKAEK 401          
BLAST of EGR-1 vs. Ensembl Zebrafish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:30498])

HSP 1 Score: 108.997 bits (271), Expect = 4.797e-25
Identity = 56/110 (50.91%), Postives = 70/110 (63.64%), Query Frame = 2
Query:  617 SREEKSKSGKSNQLPPDKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
            SR  K  +  S   P ++ + C    C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++CEIC + FARSDER RHT+IH +   +K +K
Sbjct:  292 SRMRKYPNRPSKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMRQKDKKAEK 401          
BLAST of EGR-1 vs. Ensembl Zebrafish
Match: egr3 (early growth response 3 [Source:ZFIN;Acc:ZDB-GENE-040718-394])

HSP 1 Score: 106.301 bits (264), Expect = 1.692e-24
Identity = 52/86 (60.47%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKP 943
            NC  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP+SCE C + FARSDER RH ++H K   +K KKP
Sbjct:  303 NCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAKVHLK---QKDKKP 385          

HSP 2 Score: 51.2174 bits (121), Expect = 1.864e-6
Identity = 23/57 (40.35%), Postives = 30/57 (52.63%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEK 838
            K F C  C   F+R D L  H + HTG K   C +C + F RSD R+ H + H  +K
Sbjct:  325 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAKVHLKQK 381          
BLAST of EGR-1 vs. Ensembl Zebrafish
Match: egr4 (early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-080204-90])

HSP 1 Score: 104.76 bits (260), Expect = 2.493e-24
Identity = 51/94 (54.26%), Postives = 65/94 (69.15%), Query Frame = 2
Query:  665 DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
            +K F+C   +C  RF+R DEL RH +IHTG K   C  C + F RSDH  TH+RTHTGEKP+SC++C + FARSDER RH R+H K   R ++K
Sbjct:  247 EKPFSCPVESCERRFSRSDELNRHVRIHTGHKPFQCRVCLRCFSRSDHLTTHMRTHTGEKPFSCDVCARRFARSDERKRHMRVHLKQRERMQQK 340          
BLAST of EGR-1 vs. Ensembl Zebrafish
Match: egr2a (early growth response 2a [Source:ZFIN;Acc:ZDB-GENE-030723-6])

HSP 1 Score: 101.293 bits (251), Expect = 6.414e-24
Identity = 60/132 (45.45%), Postives = 77/132 (58.33%), Query Frame = 2
Query:  542 PLDSSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPPDKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRK 931
            PLD +   N  N+ L P+  P    +R  K+          ++ + C    C  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP+SC+ C + FARSDER RHT+IH +   RK
Sbjct:  114 PLDGT---NPQNVPLRPILRPRKYPNRPCKTPVH-------ERPYPCPAEGCDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRHTKIHQRHKDRK 235          
BLAST of EGR-1 vs. Ensembl Xenopus
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100038164])

HSP 1 Score: 108.227 bits (269), Expect = 1.160e-24
Identity = 54/104 (51.92%), Postives = 68/104 (65.38%), Query Frame = 2
Query:  605 ISRISREEKSKSGKSNQLPPDKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIH 910
            I + SR  K  +  S   P ++ + C   +C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+IC + FARSDER RHT+IH
Sbjct:  284 IIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIH 387          
BLAST of EGR-1 vs. Ensembl Xenopus
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100038164])

HSP 1 Score: 107.842 bits (268), Expect = 1.246e-24
Identity = 54/104 (51.92%), Postives = 68/104 (65.38%), Query Frame = 2
Query:  605 ISRISREEKSKSGKSNQLPPDKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIH 910
            I + SR  K  +  S   P ++ + C   +C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+IC + FARSDER RHT+IH
Sbjct:  257 IIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIH 360          
BLAST of EGR-1 vs. Ensembl Xenopus
Match: usp31 (ubiquitin specific peptidase 31 [Source:Xenbase;Acc:XB-GENE-920956])

HSP 1 Score: 105.145 bits (261), Expect = 1.711e-23
Identity = 50/96 (52.08%), Postives = 63/96 (65.62%), Query Frame = 2
Query:  659 PPDKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
            P +K+F C   +C   F R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP+SC++C + FARSDE+ RH ++H K   R  +K
Sbjct:  435 PHEKAFACPVESCIRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHIRTHTGEKPFSCDLCGRRFARSDEKKRHGKVHMKQKARTEEK 530          
BLAST of EGR-1 vs. Ensembl Xenopus
Match: serpinb4 (serpin peptidase inhibitor, clade B (ovalbumin), member 4 [Source:Xenbase;Acc:XB-GENE-5787878])

HSP 1 Score: 100.908 bits (250), Expect = 9.518e-23
Identity = 45/75 (60.00%), Postives = 54/75 (72.00%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIH 910
             C  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP++C+ C + FARSDER RH +IH
Sbjct:  278 GCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHAKIH 352          

HSP 2 Score: 50.8322 bits (120), Expect = 3.123e-6
Identity = 22/53 (41.51%), Postives = 28/53 (52.83%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTH 826
            K F C  C   F+R D L  H + HTG K   C +C + F RSD R+ H + H
Sbjct:  300 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHAKIH 352          
BLAST of EGR-1 vs. Ensembl Xenopus
Match: tbl1x (transducin beta like 1 X-linked [Source:Xenbase;Acc:XB-GENE-982285])

HSP 1 Score: 100.523 bits (249), Expect = 1.987e-22
Identity = 48/82 (58.54%), Postives = 57/82 (69.51%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRK 931
             C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+ C + FARSDER RHT+IH +   RK
Sbjct:  267 GCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERK 348          
BLAST of EGR-1 vs. Ensembl Mouse
Match: Egr3 (early growth response 3 [Source:MGI Symbol;Acc:MGI:1306780])

HSP 1 Score: 105.145 bits (261), Expect = 3.080e-24
Identity = 49/85 (57.65%), Postives = 59/85 (69.41%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
             C  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP++CE C + FARSDER RH +IH K   +K +K
Sbjct:  281 GCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKSEK 365          

HSP 2 Score: 52.373 bits (124), Expect = 7.866e-7
Identity = 23/57 (40.35%), Postives = 30/57 (52.63%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEK 838
            K F C  C   F+R D L  H + HTG K   C +C + F RSD R+ H + H  +K
Sbjct:  303 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQK 359          
BLAST of EGR-1 vs. Ensembl Mouse
Match: Egr1 (early growth response 1 [Source:MGI Symbol;Acc:MGI:95295])

HSP 1 Score: 106.686 bits (265), Expect = 3.594e-24
Identity = 53/102 (51.96%), Postives = 67/102 (65.69%), Query Frame = 2
Query:  611 RISREEKSKSGKSNQLPPDKSFTCS--NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIH 910
            + SR  K  +  S   P ++ + C   +C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+IC + FARSDER RHT+IH
Sbjct:  315 KPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIH 416          
BLAST of EGR-1 vs. Ensembl Mouse
Match: Egr1 (early growth response 1 [Source:MGI Symbol;Acc:MGI:95295])

HSP 1 Score: 106.686 bits (265), Expect = 3.594e-24
Identity = 53/102 (51.96%), Postives = 67/102 (65.69%), Query Frame = 2
Query:  611 RISREEKSKSGKSNQLPPDKSFTCS--NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIH 910
            + SR  K  +  S   P ++ + C   +C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+IC + FARSDER RHT+IH
Sbjct:  315 KPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIH 416          
BLAST of EGR-1 vs. Ensembl Mouse
Match: Egr3 (early growth response 3 [Source:MGI Symbol;Acc:MGI:1306780])

HSP 1 Score: 103.99 bits (258), Expect = 5.501e-24
Identity = 49/85 (57.65%), Postives = 59/85 (69.41%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
             C  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP++CE C + FARSDER RH +IH K   +K +K
Sbjct:  243 GCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKSEK 327          

HSP 2 Score: 51.6026 bits (122), Expect = 1.124e-6
Identity = 23/57 (40.35%), Postives = 30/57 (52.63%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEK 838
            K F C  C   F+R D L  H + HTG K   C +C + F RSD R+ H + H  +K
Sbjct:  265 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQK 321          
BLAST of EGR-1 vs. Ensembl Mouse
Match: Egr2 (early growth response 2 [Source:MGI Symbol;Acc:MGI:95296])

HSP 1 Score: 104.76 bits (260), Expect = 1.164e-23
Identity = 59/131 (45.04%), Postives = 74/131 (56.49%), Query Frame = 2
Query:  545 LDSSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPPDKSFTCS--NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRK 931
            L  S  +  T     P H P+  I R  K  +  S     ++ + C    C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+ C + FARSDER RHT+IH +   RK
Sbjct:  294 LPGSGSAAVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERK 424          
BLAST of EGR-1 vs. UniProt/SwissProt
Match: sp|P26632|EGR1_DANRE (Early growth response protein 1 OS=Danio rerio OX=7955 GN=egr1 PE=2 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 3.621e-24
Identity = 56/110 (50.91%), Postives = 70/110 (63.64%), Query Frame = 2
Query:  617 SREEKSKSGKSNQLPPDKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
            SR  K  +  S   P ++ + C    C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++CEIC + FARSDER RHT+IH +   +K +K
Sbjct:  292 SRMRKYPNRPSKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMRQKDKKAEK 401          
BLAST of EGR-1 vs. UniProt/SwissProt
Match: sp|A4II20|EGR1_XENTR (Early growth response protein 1 OS=Xenopus tropicalis OX=8364 GN=egr1 PE=2 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 6.146e-24
Identity = 54/104 (51.92%), Postives = 68/104 (65.38%), Query Frame = 2
Query:  605 ISRISREEKSKSGKSNQLPPDKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIH 910
            I + SR  K  +  S   P ++ + C   +C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+IC + FARSDER RHT+IH
Sbjct:  284 IIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIH 387          
BLAST of EGR-1 vs. UniProt/SwissProt
Match: sp|Q6NTY6|EGR1B_XENLA (Early growth response protein 1-B OS=Xenopus laevis OX=8355 GN=egr1-b PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.028e-23
Identity = 56/114 (49.12%), Postives = 72/114 (63.16%), Query Frame = 2
Query:  605 ISRISREEKSKSGKSNQLPPDKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
            I + SR  K  +  S   P ++ + C   +C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+IC + FARSDER RHT+IH +   +K  K
Sbjct:  261 IIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADK 374          
BLAST of EGR-1 vs. UniProt/SwissProt
Match: sp|Q6GQH4|EGR1A_XENLA (Early growth response protein 1-A OS=Xenopus laevis OX=8355 GN=egr1-a PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.128e-23
Identity = 56/114 (49.12%), Postives = 72/114 (63.16%), Query Frame = 2
Query:  605 ISRISREEKSKSGKSNQLPPDKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
            I + SR  K  +  S   P ++ + C   +C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+IC + FARSDER RHT+IH +   +K  K
Sbjct:  283 IIKPSRMRKYPNRPSKTPPHERPYGCPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADK 396          
BLAST of EGR-1 vs. UniProt/SwissProt
Match: sp|O73693|EGR1_TAEGU (Early growth response protein 1 (Fragment) OS=Taeniopygia guttata OX=59729 GN=EGR1 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.816e-23
Identity = 49/84 (58.33%), Postives = 60/84 (71.43%), Query Frame = 2
Query:  689 CPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
            C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+IC + FARSDER RHT+IH +   +K +K
Sbjct:    1 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKVEK 84          
BLAST of EGR-1 vs. TrEMBL
Match: H9CXV3 (EGR-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 388/389 (99.74%), Postives = 388/389 (99.74%), Query Frame = 2
Query:  131 MILDETANDDPTDYVHNSSHNSSFEVHSKQFENLLSIPAYNDHCGFIQNMEFXXXXXXXXXXXXXXXXXXXXXXDHSNDLLQMLQNDPFISTDCRFITDSQSQYFHPYQQYMCRIAXXXXXXXXXYAIYDNSKLKPIPLDSSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKPXXXXXXXXXDYTKSAIIDLDSLKSNLPLVQNKEPFVESYYQIHPEIFIRESLKDPSRYNPAFDNNSLIRNKDATTKSKAFIKIEPHINDAISDMTANIAKYYHFSDKSSSPSTEISID 1297
            MILDETANDDPTDYVHNSSHNSSFEVHSKQFENLLSIPAYNDHCGFIQNMEFNGGGYQYSSNNGNYSLLQQLNSDHSNDLLQMLQNDPFISTDCRFITDSQSQYFHPYQQYMCRIANNNFHNVNNYAIYDNSKLKPIPLDSSQISNQTNIKLEPLHDPIS ISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKPNANNNTSNNDYTKSAIIDLDSLKSNLPLVQNKEPFVESYYQIHPEIFIRESLKDPSRYNPAFDNNSLIRNKDATTKSKAFIKIEPHINDAISDMTANIAKYYHFSDKSSSPSTEISID
Sbjct:    1 MILDETANDDPTDYVHNSSHNSSFEVHSKQFENLLSIPAYNDHCGFIQNMEFNGGGYQYSSNNGNYSLLQQLNSDHSNDLLQMLQNDPFISTDCRFITDSQSQYFHPYQQYMCRIANNNFHNVNNYAIYDNSKLKPIPLDSSQISNQTNIKLEPLHDPISTISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKPNANNNTSNNDYTKSAIIDLDSLKSNLPLVQNKEPFVESYYQIHPEIFIRESLKDPSRYNPAFDNNSLIRNKDATTKSKAFIKIEPHINDAISDMTANIAKYYHFSDKSSSPSTEISID 389          
BLAST of EGR-1 vs. TrEMBL
Match: I1ZI72 (Early growth response-4 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.454e-32
Identity = 67/130 (51.54%), Postives = 92/130 (70.77%), Query Frame = 2
Query:  542 PLDSSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRK 931
            P++ S I N+ + +    +  + + + EEK+      +   +++F C  CP++F+R+DEL+RHEKIH+G K L CPYCDK F+RSDHR THIRTHTGEKPYSC+IC K FARSDE+ RH RIH K+  +K
Sbjct:  155 PIEESSIYNRRSQRPPTDNKTLRKQAHEEKAHKIIIRKPNIERNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKRIHLKEKSKK 284          
BLAST of EGR-1 vs. TrEMBL
Match: A0A0B7BZD2 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF216007 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 8.005e-27
Identity = 61/140 (43.57%), Postives = 89/140 (63.57%), Query Frame = 2
Query:  644 KSNQLPP-DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKPXXXXXXXXXDYTKSAIIDLDSLKSNLPLVQNKEPFVE 1054
            + +++PP ++ ++C   NC  RF+R DEL RH +IHTG K   CP C ++F RSDH  TH RTHTGEKP+SC+IC + FARSDE+ RH ++H K  ++K  K      +     + S +  LD++ S +PLV +   FV+
Sbjct:  143 RPSKIPPHERPYSCLVENCDRRFSRSDELTRHMRIHTGQKPFPCPICGRSFSRSDHLTTHKRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQRIKKDAK---LVTSQPVSASSSTMDSLDNIVSTIPLVVSSPSFVD 279          
BLAST of EGR-1 vs. TrEMBL
Match: A0A3Q3E8P3 (Uncharacterized protein OS=Labrus bergylta OX=56723 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 3.430e-25
Identity = 64/137 (46.72%), Postives = 83/137 (60.58%), Query Frame = 2
Query:  530 LKPIPLDSSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPP-DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRK 931
            L  I   SSQI  Q++       D I++ SR  KS +G+  + PP ++ + C    C  RF+R DEL RH ++HTG K   C  C ++F RSDH  THIRTHTGEKP+SC  C + FARSDER RH +IH +   RK
Sbjct:   50 LSTIKAFSSQIQTQSHTP----QDQIAKTSRSRKSPAGRQCKTPPHERPYACPADGCDRRFSRSDELTRHVRVHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCGECGRKFARSDERKRHAKIHQRQRERK 182          
BLAST of EGR-1 vs. TrEMBL
Match: G1CSV5 (EGR-like protein 1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.114e-24
Identity = 55/118 (46.61%), Postives = 74/118 (62.71%), Query Frame = 2
Query:  551 SSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTR 904
            S++++  T   L  +  P+S IS + + +          K FTC+ C   F R+DEL+RHE+IHTG + L C +CDK F+RSDH  TH+R HTGEKPY C  C + F+RSDER RH R
Sbjct:   74 STKLNPNTKKSLRIISSPLSEISEKSQFRI---------KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 182          

HSP 2 Score: 57.3806 bits (137), Expect = 7.547e-6
Identity = 28/63 (44.44%), Postives = 35/63 (55.56%), Query Frame = 2
Query:  731 EKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            EK    IK   C  C K+F R D  + H R HTGE+P +C  C K F RSD  + H RIH+ +
Sbjct:   97 EKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGE 159          
BLAST of EGR-1 vs. Ensembl Cavefish
Match: egr3 (early growth response 3 [Source:NCBI gene;Acc:103035480])

HSP 1 Score: 106.301 bits (264), Expect = 1.553e-24
Identity = 52/86 (60.47%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKP 943
            NC  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP+SCE C + FARSDER RH ++H K   +K KKP
Sbjct:  308 NCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAKVHLK---QKDKKP 390          

HSP 2 Score: 51.2174 bits (121), Expect = 1.513e-6
Identity = 23/57 (40.35%), Postives = 30/57 (52.63%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEK 838
            K F C  C   F+R D L  H + HTG K   C +C + F RSD R+ H + H  +K
Sbjct:  330 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAKVHLKQK 386          
BLAST of EGR-1 vs. Ensembl Cavefish
Match: egr4 (early growth response protein 1-B [Source:NCBI gene;Acc:103025429])

HSP 1 Score: 105.145 bits (261), Expect = 2.119e-24
Identity = 59/139 (42.45%), Postives = 80/139 (57.55%), Query Frame = 2
Query:  533 KPIPLDSSQISNQTNIKLEPLHDPISRISREEKSKSG-KSNQLPPDKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
            +P+ LDS  +S            P +  +   K+  G K+     +K F C   NC  RF+R DEL RH ++HTG +   C  C + F RSDH  TH+RTHTGEKP+SC++C + FARSDER RH R+H K   R ++K
Sbjct:  237 EPLTLDSLLLSGAL---------PATNRAHAPKATGGRKAAGARREKPFPCPVENCERRFSRSDELNRHVRVHTGHRPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHARVHIKQRERAQQK 366          
BLAST of EGR-1 vs. Ensembl Cavefish
Match: egr4 (early growth response protein 1-B [Source:NCBI gene;Acc:103025429])

HSP 1 Score: 104.375 bits (259), Expect = 2.782e-24
Identity = 50/94 (53.19%), Postives = 64/94 (68.09%), Query Frame = 2
Query:  665 DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
            +K F C   NC  RF+R DEL RH ++HTG +   C  C + F RSDH  TH+RTHTGEKP+SC++C + FARSDER RH R+H K   R ++K
Sbjct:  234 EKPFPCPVENCERRFSRSDELNRHVRVHTGHRPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHARVHIKQRERAQQK 327          
BLAST of EGR-1 vs. Ensembl Cavefish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:103036296])

HSP 1 Score: 105.531 bits (262), Expect = 6.256e-24
Identity = 51/92 (55.43%), Postives = 64/92 (69.57%), Query Frame = 2
Query:  644 KSNQLPP-DKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIH 910
            + ++ PP ++ + C    C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++CEIC + FARSDER RHT+IH
Sbjct:  307 RPSKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIH 398          
BLAST of EGR-1 vs. Ensembl Cavefish
Match: egr2b (early growth response 2 [Source:NCBI gene;Acc:103046494])

HSP 1 Score: 101.293 bits (251), Expect = 6.576e-23
Identity = 48/82 (58.54%), Postives = 57/82 (69.51%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRK 931
             C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+ C + FARSDER RHT+IH +   RK
Sbjct:  302 GCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTKIHLRQKERK 383          
BLAST of EGR-1 vs. Ensembl Sea Lamprey
Match: egr4 (early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-080204-90])

HSP 1 Score: 99.3673 bits (246), Expect = 9.828e-24
Identity = 48/86 (55.81%), Postives = 58/86 (67.44%), Query Frame = 2
Query:  668 KSFTCS--NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            + F C    C  RF+R DEL RH +IHTG K   C  C ++F RSDH  TH+RTHTGEKP++C+ C + FARSDER RH RIH K 
Sbjct:  170 RPFPCPAEGCDRRFSRTDELTRHIRIHTGHKPFTCRICMRSFSRSDHLTTHVRTHTGEKPFACDFCGRRFARSDERKRHGRIHLKG 255          
BLAST of EGR-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005004.1 (pep scaffold:Pmarinus_7.0:GL484587:30140:35096:1 gene:ENSPMAG00000004537.1 transcript:ENSPMAT00000005004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 1.094e-17
Identity = 41/117 (35.04%), Postives = 68/117 (58.12%), Query Frame = 2
Query:  665 DKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKPXXXXXXXXXDYTKSAIIDLDSLKS 1015
            +K++ CS C  RF +K  L+RHEKIH+G K   C  C   FI+  H   H RTH+GEKPY C+ C + ++R+D+  +H R+  + P+  +      ++ +  D+T      +D+L++
Sbjct:   31 EKAYQCSQCTMRFIQKYLLQRHEKIHSGEKPFTCEQCGMRFIQKYHLERHKRTHSGEKPYECDYCHQYYSRTDQLAKHKRMCHEGPLAGK------HDMNAGDFTAGINGGMDALQA 141          

HSP 2 Score: 61.2326 bits (147), Expect = 2.135e-10
Identity = 32/84 (38.10%), Postives = 42/84 (50.00%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            K F C  C + F     L+RH  IHTG K   C  C   FI+    + H + H+GEKP++CE C   F +     RH R HS +
Sbjct:    4 KKFVCERCCAAFRTNYHLQRHVLIHTGEKAYQCSQCTMRFIQKYLLQRHEKIHSGEKPFTCEQCGMRFIQKYHLERHKRTHSGE 87          
BLAST of EGR-1 vs. Ensembl Sea Lamprey
Match: wt1a (WT1 transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-558])

HSP 1 Score: 78.5666 bits (192), Expect = 1.826e-16
Identity = 42/86 (48.84%), Postives = 55/86 (63.95%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGI---KTLCCPYCDKTFIRSDHRRTHIRTHTG---EKPYSCEI--CCKCFARSDERTRHTRIHSKD 919
            +C  RF+R D+L+RH++ HTG+   K   C  CD+ F RSDH +TH RTHTG   EKP+ C    C K FARSDE  RH  +H ++
Sbjct:  207 DCGRRFSRSDQLKRHQRRHTGVTGVKPFQCKMCDRKFARSDHLKTHTRTHTGKPSEKPFVCRWPNCQKKFARSDELVRHHNMHQRN 292          

HSP 2 Score: 57.7658 bits (138), Expect = 1.711e-9
Identity = 38/107 (35.51%), Postives = 56/107 (52.34%), Query Frame = 2
Query:  632 SKSGKSNQLPPDKSFTCS--NCPSRFTRKDELRRHEKIHTGIKTLCCPY--CDKTFIRSDHRRTHIRTHTGE---KPYSCEICCKCFARSDERTRHTRIHSKDPVRK 931
            S  G++++ P    + C+   C  R+ +   L+ H + HTG +   C Y  C + F RSD  + H R HTG    KP+ C++C + FARSD    HTR H+  P  K
Sbjct:  161 SGRGRADRRP----YMCNYPGCSKRYFKLSHLQMHCRKHTGERPYQCDYKDCGRRFSRSDQLKRHQRRHTGVTGVKPFQCKMCDRKFARSDHLKTHTRTHTGKPSEK 263          
BLAST of EGR-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000923.1 (pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 gene:ENSPMAG00000000839.1 transcript:ENSPMAT00000000923.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 1.117e-15
Identity = 30/80 (37.50%), Postives = 43/80 (53.75%), Query Frame = 2
Query:  665 DKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTR 904
            ++ + C +C  RF R     RH ++HTG +   C  C + F +  H   H R HTGE+PY+C  C + FA+    TRH R
Sbjct:   19 ERPYACGDCGRRFARGANEERHRRVHTGERPYACAACGRRFRQKPHLAAHTRLHTGERPYACAACGRRFAKPYSLTRHLR 98          

HSP 2 Score: 51.6026 bits (122), Expect = 9.638e-9
Identity = 22/58 (37.93%), Postives = 31/58 (53.45%), Query Frame = 2
Query:  740 HTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHS 913
            HTG +   C  C + F R  +   H R HTGE+PY+C  C + F +      HTR+H+
Sbjct:   16 HTGERPYACGDCGRRFARGANEERHRRVHTGERPYACAACGRRFRQKPHLAAHTRLHT 73          

HSP 3 Score: 43.1282 bits (100), Expect = 9.085e-6
Identity = 17/35 (48.57%), Postives = 24/35 (68.57%), Query Frame = 2
Query:  809 THIRTHTGEKPYSCEICCKCFARSDERTRHTRIHS 913
            ++IR HTGE+PY+C  C + FAR     RH R+H+
Sbjct:   11 SNIRNHTGERPYACGDCGRRFARGANEERHRRVHT 45          
BLAST of EGR-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004792.1 (pep scaffold:Pmarinus_7.0:GL479046:11287:22931:1 gene:ENSPMAG00000004344.1 transcript:ENSPMAT00000004792.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 1.465e-15
Identity = 35/81 (43.21%), Postives = 49/81 (60.49%), Query Frame = 2
Query:  677 TCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            TC+   +R +   E  RH +IH G++   C  CDK F + +  +TH+R HTGEKPY CE+C K FA+  +   HTR+H  D
Sbjct:   20 TCACVVTRSSSHAEPLRHARIHKGLRPFICSLCDKAFTQGNQLKTHMRIHTGEKPYVCEVCGKAFAQKCQLVFHTRMHHGD 100          

HSP 2 Score: 58.5362 bits (140), Expect = 4.555e-10
Identity = 44/130 (33.85%), Postives = 60/130 (46.15%), Query Frame = 2
Query:  524 SKLKPIPLDSSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTG-EKPYSCEICCKCFARSDERTRHTRIH 910
            S+ KP+    + +  +++   EPL     R +R  K        L P   F CS C   FT+ ++L+ H +IHTG K   C  C K F +      H R H G EKPY C++C   FA S     H R H
Sbjct:   12 SRRKPVCQTCACVVTRSSSHAEPL-----RHARIHKG-------LRP---FICSLCDKAFTQGNQLKTHMRIHTGEKPYVCEVCGKAFAQKCQLVFHTRMHHGDEKPYGCDVCGLRFATSSNLKIHVRKH 126          

HSP 3 Score: 55.4546 bits (132), Expect = 4.847e-9
Identity = 34/113 (30.09%), Postives = 46/113 (40.71%), Query Frame = 2
Query:  665 DKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCP----------------------------YCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            +K + C  C  RF     L+ H + H  +  L CP                            +C   F++S    TH R HTGEKPY C  C KCF  S E  +H+R H+ +
Sbjct:  101 EKPYGCDVCGLRFATSSNLKIHVRKHRDVNNLACPVQGNGPSRHHHHYRPVKRHQGHVNWAANFCSIFFLQSSSLITHARKHTGEKPYICNTCGKCFCSSGELKKHSRSHTGE 213          

HSP 4 Score: 47.7506 bits (112), Expect = 1.972e-6
Identity = 24/57 (42.11%), Postives = 30/57 (52.63%), Query Frame = 2
Query:  689 CPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEIC 859
            C   F +   L  H + HTG K   C  C K F  S   + H R+HTGE+P+ CEIC
Sbjct:  165 CSIFFLQSSSLITHARKHTGEKPYICNTCGKCFCSSGELKKHSRSHTGERPFICEIC 221          
BLAST of EGR-1 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 74.3294 bits (181), Expect = 1.757e-14
Identity = 41/123 (33.33%), Postives = 59/123 (47.97%), Query Frame = 2
Query:  548 DSSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSK 916
            D   + NQT   L P  + +  + + + +++ ++      K   C  C   F++   L  H + H G K   C YC K F +  + RTH R HTGEKPYSC+IC K F+R      H   H K
Sbjct:  556 DGDLLFNQTMDILPPKSELVGGVEKPKGTQNTRA-----VKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQK 673          

HSP 2 Score: 65.855 bits (159), Expect = 6.835e-12
Identity = 32/84 (38.10%), Postives = 43/84 (51.19%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEI--CCKCFAR-SDERTRHTRIH 910
            K F C  C  RFT+   LR HE++HTG K   C  CDK F R  +   H+ TH   KP+ C++  C K F +  + +    R H
Sbjct:  619 KPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFH 702          
BLAST of EGR-1 vs. Ensembl Yeast
Match: MIG1 (Transcription factor involved in glucose repression; sequence specific DNA binding protein containing two Cys2His2 zinc finger motifs; regulated by the SNF1 kinase and the GLC7 phosphatase; regulates filamentous growth along with Mig2p in response to glucose depletion; activated in stochastic pulses of nuclear localization, shuttling between cytosol and nucleus depending on external glucose levels and its phosphorylation state [Source:SGD;Acc:S000003003])

HSP 1 Score: 69.707 bits (169), Expect = 2.816e-13
Identity = 38/96 (39.58%), Postives = 56/96 (58.33%), Query Frame = 2
Query:  761 CCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEI--CCKCFARSDERTRHTRIHSKD---PVRKRKKPXXXXXXXXXDYTKSAIIDLDSLKSNLPLVQ 1033
             CP C + F R +H+  H+R HTGEKP++C+   C K F+RSDE TRH RIH+       R RKK    +  ++   + ++I DL++   + PL Q
Sbjct:   39 ACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRGRKKKVVGSPINSASSSATSIPDLNTANFSPPLPQ 134          
BLAST of EGR-1 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 67.3958 bits (163), Expect = 2.434e-12
Identity = 33/83 (39.76%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSK 916
            K + C  C   F+ ++ L +H + H+G K   C  C+K F  S   + HIRTHTGEKP  C+IC K F  S   ++H + H K
Sbjct:  766 KPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQK 848          

HSP 2 Score: 57.3806 bits (137), Expect = 2.946e-9
Identity = 30/78 (38.46%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            +C   F ++ +L RH K+H+  K   C  C + F   +    H RTH+GEKPY C IC K FA S     H R H+ +
Sbjct:  744 DCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGE 821          
BLAST of EGR-1 vs. Ensembl Yeast
Match: MIG3 (Transcriptional regulator; partially nonfunctional in S288C strains but has a major role in catabolite repression and ethanol response in some other strains; involved in response to toxic agents; phosphorylation by Snf1p or the Mec1p pathway inactivates Mig3p, allowing induction of damage response genesenvironment [Source:SGD;Acc:S000000830])

HSP 1 Score: 63.1586 bits (152), Expect = 2.863e-11
Identity = 30/61 (49.18%), Postives = 39/61 (63.93%), Query Frame = 2
Query:  764 CPYCDKTFIRSDHRRTHIRTHTGEKPYSCEI--CCKCFARSDERTRHTRIHSKDPVRKRKK 940
            C  C + F R +H++ H RTHTGEKP+ C +  C K F+RSDE  RH R H+K   R+R K
Sbjct:   19 CEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGVQRRRIK 79          
BLAST of EGR-1 vs. Ensembl Yeast
Match: MIG2 (Zinc finger transcriptional repressor; cooperates with Mig1p in glucose-induced gene repression; under low glucose conditions relocalizes to mitochondrion, where it interacts with Ups1p, antagonizes mitochondrial fission factor Dnm1p, indicative of a role in mitochondrial fusion or regulating morphology; regulates filamentous growth in response to glucose depletion; activated in stochastic pulses of nuclear localization in response to low glucose [Source:SGD;Acc:S000003177])

HSP 1 Score: 62.7734 bits (151), Expect = 3.150e-11
Identity = 29/61 (47.54%), Postives = 38/61 (62.30%), Query Frame = 2
Query:  764 CPYCDKTFIRSDHRRTHIRTHTGEKPYSCEI--CCKCFARSDERTRHTRIHSKDPVRKRKK 940
            C  C + F R +H++ H+RTHTGEKP+ C    C K F+RSDE  RH R H+    R+ KK
Sbjct:   19 CDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQRRLKK 79          

HSP 2 Score: 51.2174 bits (121), Expect = 1.792e-7
Identity = 25/59 (42.37%), Postives = 34/59 (57.63%), Query Frame = 2
Query:  665 DKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCC--PYCDKTFIRSDHRRTHIRTHTGE 835
            ++ F C  C   F R +  +RH + HTG K   C  P C K+F RSD  + H+RTHTG+
Sbjct:   14 NRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQ 72          
BLAST of EGR-1 vs. Ensembl Nematostella
Match: EDO49112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGT8])

HSP 1 Score: 93.9745 bits (232), Expect = 1.383e-23
Identity = 46/78 (58.97%), Postives = 55/78 (70.51%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
             CP RF+R DEL RH + HTG K   C  C + F RSDH  THIRTHTGEKP++CE C + FARSDER RH +IH ++
Sbjct:   10 TCPRRFSRSDELTRHMRTHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACETCGRRFARSDERRRHMKIHLRE 87          
BLAST of EGR-1 vs. Ensembl Nematostella
Match: EDO29702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2W2])

HSP 1 Score: 78.1814 bits (191), Expect = 2.648e-16
Identity = 38/82 (46.34%), Postives = 50/82 (60.98%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHS 913
            K + C  C   F +  +L+RH KIHTG K   C  C K F RS+  +TH+R H+G+KPY C++C KCF+ S    RH  IHS
Sbjct:   90 KPYKCDECGKCFIQYVDLKRHLKIHTGQKPYECGECGKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHS 171          

HSP 2 Score: 70.0922 bits (170), Expect = 1.448e-13
Identity = 33/82 (40.24%), Postives = 47/82 (57.32%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHS 913
            K + C  C   FTR + L+ H +IH+G K   C  C K F  S + + H+  H+G+KPY C++C KCF+ S    +H  IHS
Sbjct:  118 KPYECGECGKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIHS 199          

HSP 3 Score: 69.707 bits (169), Expect = 2.267e-13
Identity = 34/82 (41.46%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHS 913
            K + C  C   FT+   L RH +IH+G K   C  C K F +S + +TH+R H+G+KPY C+ C KCF +  +  RH +IH+
Sbjct:   34 KPYRCDECGKGFTQSGALNRHLRIHSGQKPYKCDECGKCFNQSANLKTHLRIHSGQKPYKCDECGKCFIQYVDLKRHLKIHT 115          

HSP 4 Score: 68.1662 bits (165), Expect = 7.761e-13
Identity = 43/123 (34.96%), Postives = 57/123 (46.34%), Query Frame = 2
Query:  680 CSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKPXXXXXXXXXDYTKSAIIDLDSLKSNLPLVQNKEPF 1048
            C  C   FTR   L+RH  IH+G K   C  C K F +S     H+R H+G+KPY C+ C KCF +S     H RIHS       +KP         D      I    LK +L +   ++P+
Sbjct:   10 CGECGMGFTRHAYLKRHLMIHSGQKPYRCDECGKGFTQSGALNRHLRIHSGQKPYKCDECGKCFNQSANLKTHLRIHSG------QKP------YKCDECGKCFIQYVDLKRHLKIHTGQKPY 120          

HSP 5 Score: 67.0106 bits (162), Expect = 1.914e-12
Identity = 34/82 (41.46%), Postives = 45/82 (54.88%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHS 913
            K + C  C   F +   L+ H +IH+G K   C  C K FI+    + H++ HTG+KPY C  C KCF RS+    H RIHS
Sbjct:   62 KPYKCDECGKCFNQSANLKTHLRIHSGQKPYKCDECGKCFIQYVDLKRHLKIHTGQKPYECGECGKCFTRSERLKTHLRIHS 143          

HSP 6 Score: 54.299 bits (129), Expect = 2.553e-8
Identity = 27/68 (39.71%), Postives = 37/68 (54.41%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCF 871
            K + C  C   F+    L+RH  IH+G K   C  C K F  S + + H+  H+G+KPY C+ C KCF
Sbjct:  146 KPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCF 213          

HSP 7 Score: 48.1358 bits (113), Expect = 2.759e-6
Identity = 27/74 (36.49%), Postives = 40/74 (54.05%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRT---HIRTHTGEKPYSCEICCKCFARS 880
            K + C  C   F+    L++H  IH+G K   C  C K FI   + +T   H+  H+G+KP+ C+ C KCF +S
Sbjct:  174 KPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCFILYRNLKTHLIHLMIHSGQKPHKCDECGKCFHQS 247          
BLAST of EGR-1 vs. Ensembl Nematostella
Match: EDO38793 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBW1])

HSP 1 Score: 72.0182 bits (175), Expect = 1.789e-15
Identity = 33/84 (39.29%), Postives = 49/84 (58.33%), Query Frame = 2
Query:  656 LPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRI 907
            L P+K + C  C   F+  +ELR H  +H   K   C YC ++F  +     HIRTHTGEKP+ CE C K F+++ + ++H +I
Sbjct:   22 LVPNKPYHCGYCSESFSNPNELRNHSIVHANEKPFRCGYCSRSFSGATTLNNHIRTHTGEKPFMCEACGKTFSQASQLSKHQKI 105          
BLAST of EGR-1 vs. Ensembl Nematostella
Match: EDO43177 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ64])

HSP 1 Score: 73.559 bits (179), Expect = 2.330e-15
Identity = 43/125 (34.40%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  545 LDSSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
               S +S + N+ ++  HD       EE           PD S TC  C   ++R   L+ H ++HTG K   CP C K+F +  + + H+R H+ EKP+ C IC + FA+S   T H RIHS +
Sbjct:    2 FQGSDMSYRNNVAVQNNHDGRMEDHLEE-----------PDYSITCHVCHKIYSRPSTLKAHLRVHTGKKPFRCPTCQKSFSQDANLKAHLRVHSKEKPFKCHICHRRFAQSSSVTTHMRIHSGE 115          

HSP 2 Score: 63.5438 bits (153), Expect = 5.726e-12
Identity = 33/84 (39.29%), Postives = 45/84 (53.57%), Query Frame = 2
Query:  665 DKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSK 916
            +K F C  C  RF +   +  H +IH+G +   C  C + F  S      +RTHTGEKPY C IC   F++S   +RH RI+ K
Sbjct:   87 EKPFKCHICHRRFAQSSSVTTHMRIHSGERPYKCKVCARGFSDSSTLTKRLRTHTGEKPYQCRICGMSFSQSGNLSRHMRIYRK 170          
BLAST of EGR-1 vs. Ensembl Nematostella
Match: EDO31838 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWT3])

HSP 1 Score: 77.0258 bits (188), Expect = 4.093e-15
Identity = 39/84 (46.43%), Postives = 49/84 (58.33%), Query Frame = 2
Query:  662 PDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHS 913
            P K   C  C   F +   L+RH KIHTG K   C  C K F RS+  +TH+R H+G+KPY C++C KCF+ S    RH  IHS
Sbjct:  342 PYKPHKCDECGKCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHS 425          

HSP 2 Score: 73.1738 bits (178), Expect = 5.941e-14
Identity = 35/85 (41.18%), Postives = 51/85 (60.00%), Query Frame = 2
Query:  665 DKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            +K + C +C  RFT    ++ H +IH+G K   C  C K F  S + +TH+  H+GEKPY C+ C KCF +S +  RH RIH+ +
Sbjct:  116 EKPYECDDCGKRFTLSGNMKTHLRIHSGKKPYKCDECGKCFTESGNLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGE 200          

HSP 3 Score: 70.8626 bits (172), Expect = 3.592e-13
Identity = 37/85 (43.53%), Postives = 49/85 (57.65%), Query Frame = 2
Query:  665 DKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            +K   C +C  RFTR  +L+ H +IHTG K   C  C K F  S + +TH+R H+G+KPY C+ C KCF  S     H  IHS +
Sbjct:   88 EKPHKCDDCGKRFTRSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKTHLRIHSGKKPYKCDECGKCFTESGNLKTHLMIHSGE 172          

HSP 4 Score: 68.5514 bits (166), Expect = 1.928e-12
Identity = 46/127 (36.22%), Postives = 61/127 (48.03%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKPXXXXXXXXXDYTKSAIIDLDSLKSNLPLVQNKEPF 1048
            K + C  C   F+   +L+RH  IHTG K   C  C K F RS   +TH+R HTGEKPY C+ C K F  S     H RIHS       KKP         D       +  +LK++L +   ++P+
Sbjct:   61 KPYKCDECGKCFSESGKLKRHLMIHTGEKPHKCDDCGKRFTRSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKTHLRIHSG------KKP------YKCDECGKCFTESGNLKTHLMIHSGEKPY 175          

HSP 5 Score: 67.781 bits (164), Expect = 3.578e-12
Identity = 33/82 (40.24%), Postives = 47/82 (57.32%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHS 913
            K + C  C   FTR + L+ H +IH+G K   C  C K F  S + + H+  H+G+KPY C++C KCF+ S    +H  IHS
Sbjct:  372 KPYECGECSKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIHS 453          

HSP 6 Score: 67.0106 bits (162), Expect = 6.697e-12
Identity = 34/82 (41.46%), Postives = 46/82 (56.10%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHS 913
            K + C  C   FT  + L+ H  IH+G K   C  C K F +S + + H+  H+G+KPY C++C KCF RS   T H  IHS
Sbjct:  257 KPYKCDECGKCFTELETLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHS 338          

HSP 7 Score: 66.6254 bits (161), Expect = 8.650e-12
Identity = 35/84 (41.67%), Postives = 48/84 (57.14%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            K + C  C   FTR  +L+ H  IH+G K   C  C K F  + H  TH+R H+G+KPY C+ C KCF+ S +  RH  IH+ +
Sbjct:    7 KRYNCDECGKCFTRHAQLKEHLVIHSGKKPYKCDECGKCF--TQHANTHLRIHSGKKPYKCDECGKCFSESGKLKRHLMIHTGE 88          

HSP 8 Score: 64.3142 bits (155), Expect = 4.496e-11
Identity = 35/86 (40.70%), Postives = 47/86 (54.65%), Query Frame = 2
Query:  665 DKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPY---SCEICCKCFARSDERTRHTRIHS 913
            +K + C  C   FT+   L+RH  IH+G K   C  C K F RS    TH+  H+G+KPY    C+ C KCF +S    RH +IH+
Sbjct:  284 EKPYKCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQKPYKPHKCDECGKCFNQSGHLKRHLKIHT 369          

HSP 9 Score: 64.3142 bits (155), Expect = 4.699e-11
Identity = 32/85 (37.65%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  665 DKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            +K + C +C  RFT    +++H KIH+G K   C  C K+F    + +TH+  H+G+KPY C+ C KCF   +    H  IHS +
Sbjct:  200 EKPYECDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCDECGKCFTELETLKTHLMIHSGE 284          

HSP 10 Score: 63.1586 bits (152), Expect = 9.586e-11
Identity = 41/128 (32.03%), Postives = 63/128 (49.22%), Query Frame = 2
Query:  665 DKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKPXXXXXXXXXDYTKSAIIDLDSLKSNLPLVQNKEPF 1048
            +K + C  C   FT+  +L+RH +IHTG K   C  C K F  S + + H++ H+G+KPY C+ C K F        H  IHS       KKP         D       +L++LK++L +   ++P+
Sbjct:  172 EKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECGKSFTEHAYLKTHLIIHSG------KKP------YKCDECGKCFTELETLKTHLMIHSGEKPY 287          

HSP 11 Score: 62.7734 bits (151), Expect = 1.259e-10
Identity = 43/127 (33.86%), Postives = 59/127 (46.46%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKPXXXXXXXXXDYTKSAIIDLDSLKSNLPLVQNKEPF 1048
            K + C  C   FT    L+ H  IH+G K   C  C K F +S   + H+R HTGEKPY C+ C K F  S    +H +IHS       KKP         D    +  +   LK++L +   K+P+
Sbjct:  145 KPYKCDECGKCFTESGNLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKIHSG------KKP------YKCDECGKSFTEHAYLKTHLIIHSGKKPY 259          

HSP 12 Score: 62.3882 bits (150), Expect = 1.654e-10
Identity = 34/82 (41.46%), Postives = 43/82 (52.44%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHS 913
            K + C  C   FT    L+ H  IH+G K   C  C K F   +  +TH+  H+GEKPY C+ C KCF +S    RH  IHS
Sbjct:  229 KPYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCDECGKCFTELETLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMIHS 310          

HSP 13 Score: 55.4546 bits (132), Expect = 2.522e-8
Identity = 31/83 (37.35%), Postives = 42/83 (50.60%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSK 916
            K + C  C   F+    L+RH  IH+G K   C  C K F  S + + H+  H+G+KPY C+ C KCF        H  IHS+
Sbjct:  400 KPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCFILYRNLKTHLSIHSR 482          

HSP 14 Score: 52.373 bits (124), Expect = 2.603e-7
Identity = 32/84 (38.10%), Postives = 43/84 (51.19%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            K + C  C   FT+      H +IH+G K   C  C K F  S   + H+  HTGEKP+ C+ C K F RS +   H RIH+ +
Sbjct:   35 KPYKCDECGKCFTQ--HANTHLRIHSGKKPYKCDECGKCFSESGKLKRHLMIHTGEKPHKCDDCGKRFTRSGDLKTHLRIHTGE 116          
BLAST of EGR-1 vs. Ensembl Medaka
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100272163])

HSP 1 Score: 108.227 bits (269), Expect = 8.336e-25
Identity = 56/110 (50.91%), Postives = 70/110 (63.64%), Query Frame = 2
Query:  617 SREEKSKSGKSNQLPPDKSFTC--SNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
            SR  K  +  S   P ++ + C    C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++CEIC + FARSDER RHT+IH +   +K +K
Sbjct:  294 SRMRKYPTRPSKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHLRQKDKKAEK 403          
BLAST of EGR-1 vs. Ensembl Medaka
Match: egr3 (early growth response 3 [Source:NCBI gene;Acc:100272164])

HSP 1 Score: 105.145 bits (261), Expect = 3.199e-24
Identity = 49/85 (57.65%), Postives = 60/85 (70.59%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
            NC  RF+R DEL RH +IHTG K   C  C ++F RSDH  THIRTHTGEKP+SCE C + FARSDER RH ++H K   +K+ +
Sbjct:  302 NCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAKVHLKQKDKKQAE 386          

HSP 2 Score: 51.2174 bits (121), Expect = 1.417e-6
Identity = 23/57 (40.35%), Postives = 30/57 (52.63%), Query Frame = 2
Query:  668 KSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEK 838
            K F C  C   F+R D L  H + HTG K   C +C + F RSD R+ H + H  +K
Sbjct:  324 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAKVHLKQK 380          
BLAST of EGR-1 vs. Ensembl Medaka
Match: ENSORLT00000000940.2 (early growth response protein 1 [Source:NCBI gene;Acc:101160576])

HSP 1 Score: 103.99 bits (258), Expect = 1.352e-23
Identity = 58/132 (43.94%), Postives = 77/132 (58.33%), Query Frame = 2
Query:  551 SSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPP-DKSFTCS--NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRK 937
            S+QI  Q    L      +++  + +KS  G+  + PP ++   C    C  RF+R DEL RH ++HTG K   C  C ++F RSDH  THIRTHTGEKP+ C  C + FARSDER RH +IH +   R RK
Sbjct:  247 SAQIQPQGPGGL------LAKSCQSKKSPGGRQCRTPPHERPHVCPADGCERRFSRSDELTRHVRVHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFPCSECGRKFARSDERKRHAKIHQRQ--RDRK 370          
BLAST of EGR-1 vs. Ensembl Medaka
Match: egr2b (early growth response 2 [Source:NCBI gene;Acc:101170128])

HSP 1 Score: 100.908 bits (250), Expect = 1.248e-22
Identity = 48/82 (58.54%), Postives = 57/82 (69.51%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRK 931
             C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP++C+ C + FARSDER RHT+IH +   RK
Sbjct:  336 GCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTKIHLRQKERK 417          
BLAST of EGR-1 vs. Ensembl Medaka
Match: ENSORLT00000034291.1 (early growth response protein 2b [Source:NCBI gene;Acc:101164744])

HSP 1 Score: 98.5969 bits (244), Expect = 4.770e-22
Identity = 48/85 (56.47%), Postives = 60/85 (70.59%), Query Frame = 2
Query:  686 NCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKK 940
            +C  RF+R DEL RH +IHTG K   C  C + F RSDH  THIRTHTGEKP+SC+ C + FARSDER RH +IH    +R+++K
Sbjct:  310 SCDRRFSRSDELSRHLRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFSCQQCGRKFARSDERRRHMKIH----LRQKEK 390          
BLAST of EGR-1 vs. Planmine SMEST
Match: SMESG000034285.1 (SMESG000034285.1)

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 384/389 (98.71%), Postives = 384/389 (98.71%), Query Frame = 2
Query:  131 MILDETANDDPTDYVHNSSHNSSFEVHSKQFENLLSIPAYNDHCGFIQNMEFXXXXXXXXXXXXXXXXXXXXXXDHSNDLLQMLQNDPFISTDCRFITDSQSQYFHPYQQYMCRIAXXXXXXXXXYAIYDNSKLKPIPLDSSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKPXXXXXXXXXDYTKSAIIDLDSLKSNLPLVQNKEPFVESYYQIHPEIFIRESLKDPSRYNPAFDNNSLIRNKDATTKSKAFIKIEPHINDAISDMTANIAKYYHFSDKSSSPSTEISID 1297
            MILDE ANDDPTDYVHNSSHNSS EVHSKQFENLLSIPAYNDHC FIQNMEFNGGGYQYSSNNGNYSLLQQLNSDHSNDLLQMLQNDPFISTDCRFITDSQSQYFHPYQQYMCRIANNNFHNVNNYAIYDNSKLKPIPLDSSQISNQTNIKLE LHDPIS ISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKPNANNNTSNNDYTKSAIIDLDSLKSNLPLVQNKEPFVESYYQIHPEIFIRESLKDPSRYNPAFDNNSLIRNKDATTKSKAFIKIEPHINDAISDMTANIAKYYHFSDKSSSPSTEISID
Sbjct:    1 MILDENANDDPTDYVHNSSHNSSCEVHSKQFENLLSIPAYNDHCEFIQNMEFNGGGYQYSSNNGNYSLLQQLNSDHSNDLLQMLQNDPFISTDCRFITDSQSQYFHPYQQYMCRIANNNFHNVNNYAIYDNSKLKPIPLDSSQISNQTNIKLEALHDPISTISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRKRKKPNANNNTSNNDYTKSAIIDLDSLKSNLPLVQNKEPFVESYYQIHPEIFIRESLKDPSRYNPAFDNNSLIRNKDATTKSKAFIKIEPHINDAISDMTANIAKYYHFSDKSSSPSTEISID 389          
BLAST of EGR-1 vs. Planmine SMEST
Match: SMESG000028801.1 (SMESG000028801.1)

HSP 1 Score: 135.961 bits (341), Expect = 4.374e-36
Identity = 67/130 (51.54%), Postives = 92/130 (70.77%), Query Frame = 2
Query:  542 PLDSSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRK 931
            P++ S I N+ + +    +  + + + EEK+      +   +++F C  CP++F+R+DEL+RHEKIH+G K L CPYCDK F+RSDHR THIRTHTGEKPYSC+IC K FARSDE+ RH RIH K+  +K
Sbjct:  134 PIEESSIYNRRSQRPPTDNKTLRKQAHEEKAHKIIIRKPNIERNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKRIHLKEKSKK 263          
BLAST of EGR-1 vs. Planmine SMEST
Match: SMESG000028801.1 (SMESG000028801.1)

HSP 1 Score: 136.346 bits (342), Expect = 6.680e-36
Identity = 67/130 (51.54%), Postives = 92/130 (70.77%), Query Frame = 2
Query:  542 PLDSSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKDPVRK 931
            P++ S I N+ + +    +  + + + EEK+      +   +++F C  CP++F+R+DEL+RHEKIH+G K L CPYCDK F+RSDHR THIRTHTGEKPYSC+IC K FARSDE+ RH RIH K+  +K
Sbjct:  159 PIEESSIYNRRSQRPPTDNKTLRKQAHEEKAHKIIIRKPNIERNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKRIHLKEKSKK 288          
BLAST of EGR-1 vs. Planmine SMEST
Match: SMESG000042500.1 (SMESG000042500.1)

HSP 1 Score: 138.272 bits (347), Expect = 6.978e-36
Identity = 60/82 (73.17%), Postives = 70/82 (85.37%), Query Frame = 2
Query:  665 DKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIH 910
            +K+F CS C  +FTR+DELRRHEKIH+G K L CPYCDK FIRSDHR+THIRTHTGEKPY+C+IC K FARSDE+ RHT+ H
Sbjct:  265 EKTFCCSTCDVKFTRRDELRRHEKIHSGEKPLSCPYCDKCFIRSDHRKTHIRTHTGEKPYACDICLKRFARSDEKLRHTKTH 346          

HSP 2 Score: 67.0106 bits (162), Expect = 1.007e-11
Identity = 31/69 (44.93%), Postives = 39/69 (56.52%), Query Frame = 2
Query:  713 DELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            D+  + +K+    KT CC  CD  F R D  R H + H+GEKP SC  C KCF RSD R  H R H+ +
Sbjct:  253 DKPVKTKKVVQTEKTFCCSTCDVKFTRRDELRRHEKIHSGEKPLSCPYCDKCFIRSDHRKTHIRTHTGE 321          
BLAST of EGR-1 vs. Planmine SMEST
Match: SMESG000000960.1 (SMESG000000960.1)

HSP 1 Score: 110.923 bits (276), Expect = 3.097e-28
Identity = 55/118 (46.61%), Postives = 74/118 (62.71%), Query Frame = 2
Query:  551 SSQISNQTNIKLEPLHDPISRISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRHEKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTR 904
            S++++  T   L  +  P+S IS + + +          K FTC+ C   F R+DEL+RHE+IHTG + L C +CDK F+RSDH  TH+R HTGEKPY C  C + F+RSDER RH R
Sbjct:   74 STKLNPNTKKSLRIISSPLSEISEKSQFRI---------KQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIR 182          

HSP 2 Score: 57.3806 bits (137), Expect = 2.099e-9
Identity = 28/63 (44.44%), Postives = 35/63 (55.56%), Query Frame = 2
Query:  731 EKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARSDERTRHTRIHSKD 919
            EK    IK   C  C K+F R D  + H R HTGE+P +C  C K F RSD  + H RIH+ +
Sbjct:   97 EKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGE 159          
The following BLAST results are available for this feature:
BLAST of EGR-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EGR34.318e-2457.65early growth response 3 [Source:HGNC Symbol;Acc:HG... [more]
EGR14.699e-2451.96early growth response 1 [Source:HGNC Symbol;Acc:HG... [more]
EGR38.407e-2457.65early growth response 3 [Source:HGNC Symbol;Acc:HG... [more]
EGR24.319e-2347.50early growth response 2 [Source:HGNC Symbol;Acc:HG... [more]
EGR24.319e-2347.50early growth response 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of EGR-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egrh-21.267e-2559.30EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-21.565e-2556.99EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-23.587e-2559.30EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-11.012e-2455.43EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-21.087e-2456.99EGR (Early Growth factor Response factor) Homolog ... [more]
back to top
BLAST of EGR-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sr1.458e-2553.76gene:FBgn0003499 transcript:FBtr0330050[more]
sr1.910e-2553.76gene:FBgn0003499 transcript:FBtr0083542[more]
sr3.349e-2553.76gene:FBgn0003499 transcript:FBtr0301615[more]
sr5.083e-2553.76gene:FBgn0003499 transcript:FBtr0344633[more]
sr5.083e-2553.76gene:FBgn0003499 transcript:FBtr0083543[more]
back to top
BLAST of EGR-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr14.797e-2550.91early growth response 1 [Source:NCBI gene;Acc:3049... [more]
egr14.797e-2550.91early growth response 1 [Source:NCBI gene;Acc:3049... [more]
egr31.692e-2460.47early growth response 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
egr42.493e-2454.26early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
egr2a6.414e-2445.45early growth response 2a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of EGR-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr11.160e-2451.92early growth response 1 [Source:NCBI gene;Acc:1000... [more]
egr11.246e-2451.92early growth response 1 [Source:NCBI gene;Acc:1000... [more]
usp311.711e-2352.08ubiquitin specific peptidase 31 [Source:Xenbase;Ac... [more]
serpinb49.518e-2360.00serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
tbl1x1.987e-2258.54transducin beta like 1 X-linked [Source:Xenbase;Ac... [more]
back to top
BLAST of EGR-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Egr33.080e-2457.65early growth response 3 [Source:MGI Symbol;Acc:MGI... [more]
Egr13.594e-2451.96early growth response 1 [Source:MGI Symbol;Acc:MGI... [more]
Egr13.594e-2451.96early growth response 1 [Source:MGI Symbol;Acc:MGI... [more]
Egr35.501e-2457.65early growth response 3 [Source:MGI Symbol;Acc:MGI... [more]
Egr21.164e-2345.04early growth response 2 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of EGR-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26632|EGR1_DANRE3.621e-2450.91Early growth response protein 1 OS=Danio rerio OX=... [more]
sp|A4II20|EGR1_XENTR6.146e-2451.92Early growth response protein 1 OS=Xenopus tropica... [more]
sp|Q6NTY6|EGR1B_XENLA1.028e-2349.12Early growth response protein 1-B OS=Xenopus laevi... [more]
sp|Q6GQH4|EGR1A_XENLA1.128e-2349.12Early growth response protein 1-A OS=Xenopus laevi... [more]
sp|O73693|EGR1_TAEGU1.816e-2358.33Early growth response protein 1 (Fragment) OS=Taen... [more]
back to top
BLAST of EGR-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXV30.000e+099.74EGR-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
I1ZI721.454e-3251.54Early growth response-4 OS=Schmidtea mediterranea ... [more]
A0A0B7BZD28.005e-2743.57Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A3Q3E8P33.430e-2546.72Uncharacterized protein OS=Labrus bergylta OX=5672... [more]
G1CSV51.114e-2446.61EGR-like protein 1 OS=Schmidtea mediterranea OX=79... [more]
back to top
BLAST of EGR-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr31.553e-2460.47early growth response 3 [Source:NCBI gene;Acc:1030... [more]
egr42.119e-2442.45early growth response protein 1-B [Source:NCBI gen... [more]
egr42.782e-2453.19early growth response protein 1-B [Source:NCBI gen... [more]
egr16.256e-2455.43early growth response 1 [Source:NCBI gene;Acc:1030... [more]
egr2b6.576e-2358.54early growth response 2 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of EGR-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr49.828e-2455.81early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000005004.11.094e-1735.04pep scaffold:Pmarinus_7.0:GL484587:30140:35096:1 g... [more]
wt1a1.826e-1648.84WT1 transcription factor a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000000923.11.117e-1537.50pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 ... [more]
ENSPMAT00000004792.11.465e-1543.21pep scaffold:Pmarinus_7.0:GL479046:11287:22931:1 g... [more]
back to top
BLAST of EGR-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AZF11.757e-1433.33Zinc-finger transcription factor; involved in diau... [more]
MIG12.816e-1339.58Transcription factor involved in glucose repressio... [more]
ZAP12.434e-1239.76Zinc-regulated transcription factor; binds to zinc... [more]
MIG32.863e-1149.18Transcriptional regulator; partially nonfunctional... [more]
MIG23.150e-1147.54Zinc finger transcriptional repressor; cooperates ... [more]
back to top
BLAST of EGR-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491121.383e-2358.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297022.648e-1646.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387931.789e-1539.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431772.330e-1534.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318384.093e-1546.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EGR-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr18.336e-2550.91early growth response 1 [Source:NCBI gene;Acc:1002... [more]
egr33.199e-2457.65early growth response 3 [Source:NCBI gene;Acc:1002... [more]
ENSORLT00000000940.21.352e-2343.94early growth response protein 1 [Source:NCBI gene;... [more]
egr2b1.248e-2258.54early growth response 2 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000034291.14.770e-2256.47early growth response protein 2b [Source:NCBI gene... [more]
back to top
BLAST of EGR-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034285.10.000e+098.71SMESG000034285.1[more]
SMESG000028801.14.374e-3651.54SMESG000028801.1[more]
SMESG000028801.16.680e-3651.54SMESG000028801.1[more]
SMESG000042500.16.978e-3673.17SMESG000042500.1[more]
SMESG000000960.13.097e-2846.61SMESG000000960.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012332
GenBankAFD29624.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012332 ID=SMED30012332|Name=EGR-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1460bp
GATCTAATAAAACCATGAAACCGGTTTTTGAATGAGACGCCACGCATTGT
CAGAGTCATTGGTCCGTGACGGTTATTTATTGGTTATAAAACTACCATAA
TTACACTTTTGGTGGTTGTATTTTCACAAAATGATTTTAGACGAGACTGC
TAATGATGATCCAACTGACTATGTTCATAATTCTAGTCATAACTCATCGT
TTGAGGTTCATTCGAAACAATTTGAAAATCTTTTAAGCATTCCAGCATAC
AATGATCACTGTGGATTCATTCAAAACATGGAATTTAATGGTGGAGGTTA
TCAGTATTCCAGCAATAATGGTAATTACAGTCTCCTTCAACAACTGAATT
CAGACCATTCAAATGATTTGCTTCAAATGTTACAAAATGACCCATTCATT
TCTACTGATTGCCGATTCATTACCGATTCGCAGTCGCAATATTTTCATCC
CTACCAGCAATACATGTGTCGGATTGCCAACAATAATTTCCATAACGTAA
ATAATTACGCCATCTATGACAATTCAAAATTGAAGCCCATTCCTCTTGAC
AGTTCTCAAATTTCCAATCAAACAAACATAAAACTTGAACCATTACACGA
TCCGATCAGTAGAATTTCGAGAGAGGAAAAATCAAAATCTGGCAAATCCA
ATCAACTGCCACCCGACAAATCTTTTACCTGTTCGAATTGTCCGAGTCGA
TTTACAAGAAAAGACGAATTGAGACGACACGAAAAAATTCATACCGGTAT
TAAAACTCTCTGTTGCCCATATTGTGATAAAACTTTCATCCGGTCGGATC
ATCGGCGAACTCATATTCGAACACATACCGGCGAGAAGCCTTATTCCTGT
GAGATTTGTTGCAAATGTTTCGCTCGGTCTGATGAGCGGACACGGCACAC
AAGAATTCACAGTAAAGATCCAGTCAGAAAACGAAAGAAACCAAATGCAA
ATAATAATACTAGCAATAATGATTATACCAAAAGTGCAATTATTGATTTG
GATTCTTTGAAGTCCAATCTTCCTTTAGTGCAAAACAAAGAGCCTTTTGT
TGAGTCCTACTATCAAATTCATCCCGAAATCTTTATACGTGAATCTCTCA
AGGACCCCAGCAGATACAATCCGGCCTTCGATAATAACTCATTAATCCGG
AATAAAGACGCTACCACCAAATCAAAGGCCTTCATAAAAATCGAGCCACA
TATTAATGATGCAATTTCAGACATGACTGCAAATATTGCCAAATATTACC
ATTTCAGTGATAAAAGTAGCTCCCCATCAACGGAAATATCAATTGATTAA
TGTTATTTTTAATAAATAATTTTTTATTAATATAATATTTAATTTGATTA
TATTTTTTGGTTCTATTAGTGACAATGAAATATAAACACCGGCTGCCAGT
AATAGTTTCTCTACTATTTTTAATGTTAAATCCGCGTGTGAAAATATTAT
TTTTGGAAGC
back to top

protein sequence of SMED30012332-orf-1

>SMED30012332-orf-1 ID=SMED30012332-orf-1|Name=SMED30012332-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=390bp
MILDETANDDPTDYVHNSSHNSSFEVHSKQFENLLSIPAYNDHCGFIQNM
EFNGGGYQYSSNNGNYSLLQQLNSDHSNDLLQMLQNDPFISTDCRFITDS
QSQYFHPYQQYMCRIANNNFHNVNNYAIYDNSKLKPIPLDSSQISNQTNI
KLEPLHDPISRISREEKSKSGKSNQLPPDKSFTCSNCPSRFTRKDELRRH
EKIHTGIKTLCCPYCDKTFIRSDHRRTHIRTHTGEKPYSCEICCKCFARS
DERTRHTRIHSKDPVRKRKKPNANNNTSNNDYTKSAIIDLDSLKSNLPLV
QNKEPFVESYYQIHPEIFIRESLKDPSRYNPAFDNNSLIRNKDATTKSKA
FIKIEPHINDAISDMTANIAKYYHFSDKSSSPSTEISID*
back to top
Aliases
The feature 'EGR-1' has the following synonyms
Synonym
EGR-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000028Category 2 cell
PLANA:0000035Category 3 cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 210..232
e-value: 0.074
score: 22.2
coord: 182..204
e-value: 0.0021
score: 27.3
coord: 238..260
e-value: 0.67
score: 19.0
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 182..204
e-value: 0.0012
score: 19.2
coord: 212..232
e-value: 5.5E-4
score: 20.2
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 211..232
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 240..260
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 184..204
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 238..265
score: 11.115
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 182..209
score: 13.568
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 210..237
score: 14.108
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 210..237
e-value: 2.8E-11
score: 45.1
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 238..263
e-value: 9.8E-10
score: 40.3
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 162..206
e-value: 4.6E-8
score: 34.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 255..281
NoneNo IPR availablePANTHERPTHR24384:SF205ZINC FINGER PROTEIN 977coord: 179..263
NoneNo IPR availablePANTHERPTHR24384FAMILY NOT NAMEDcoord: 178..262
NoneNo IPR availablePANTHERPTHR24384FAMILY NOT NAMEDcoord: 179..263
NoneNo IPR availablePANTHERPTHR24384:SF205ZINC FINGER PROTEIN 977coord: 178..262
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 208..260
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 179..219