DUF4371 domain-containing protein

Overview
NameDUF4371 domain-containing protein
Smed IDSMED30012330
Length (bp)1730
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF4371 domain-containing protein (SMED30012330) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF4371 domain-containing protein (SMED30012330) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF4371 domain-containing protein (SMED30012330) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF4371 domain-containing protein (SMED30012330) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012330

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30012330 SmedASXL_004872SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012330 SmedASXL_066299SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30012330SMESG000075230.1 Contig27497newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012330SMESG000075230.1 Contig27497uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30012330 dd_Smed_v4_15054_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF4371 domain-containing protein vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 55.8398 bits (133), Expect = 1.938e-7
Identity = 32/101 (31.68%), Postives = 59/101 (58.42%), Query Frame = 1
Query:  727 TEASYEIG--LALPKKLFSDGEEIVKPCLQIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALDDAAKLN------IFIR 1005
            TEASY +   +AL  +  + GE ++KPC +     + ++ + KK+D + +S   V RRI++L+ D+ ++L   +  C  FSL LD++A ++      +F+R
Sbjct:  194 TEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVR 294          
BLAST of DUF4371 domain-containing protein vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 55.8398 bits (133), Expect = 1.938e-7
Identity = 32/101 (31.68%), Postives = 59/101 (58.42%), Query Frame = 1
Query:  727 TEASYEIG--LALPKKLFSDGEEIVKPCLQIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALDDAAKLN------IFIR 1005
            TEASY +   +AL  +  + GE ++KPC +     + ++ + KK+D + +S   V RRI++L+ D+ ++L   +  C  FSL LD++A ++      +F+R
Sbjct:  194 TEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVR 294          
BLAST of DUF4371 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000028445.1 (general transcription factor II-I repeat domain-containing protein 2-like [Source:NCBI gene;Acc:101734469])

HSP 1 Score: 59.3066 bits (142), Expect = 1.175e-8
Identity = 33/92 (35.87%), Postives = 47/92 (51.09%), Query Frame = 1
Query:  778 DGEEIVKPCLQIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALDDAAK------LNIFIRGFDANFNVFE 1035
            D  ++VK C     R  GN+    K D I++  Q V RR+  + Q + Q+L  ++ +C  FSLALD+         L IFIR  D  FN+ E
Sbjct:  117 DSVDVVKECAVKMARVFGNEEMAAKFDSISLQPQTVARRVSAMHQQITQKLHAILKNCCYFSLALDETTDSCGTDLLVIFIRAIDDGFNISE 208          
BLAST of DUF4371 domain-containing protein vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 53.5286 bits (127), Expect = 7.337e-7
Identity = 36/106 (33.96%), Postives = 54/106 (50.94%), Query Frame = 1
Query:  751 LALPKKLFSDGEEIVKPCLQIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALD------DAAKLNIFIRGFDANFNVFE*LVSL 1050
            +A  K  FS G  +VK C        GN+   K V+ I++S Q V R I  ++Q L  +L  ++ S   FS+ALD      D  +L IF+R  D  F++ E L+ +
Sbjct:  120 IAKRKYPFSSGT-LVKTCALKMAEAFGNETMAKTVESISLSHQTVARHICTINQHLTDKLQNILRSAPYFSIALDESTDITDTCQLVIFVRSVDQEFHISEELLEI 224          
BLAST of DUF4371 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 8.710e-7
Identity = 36/106 (33.96%), Postives = 54/106 (50.94%), Query Frame = 1
Query:  751 LALPKKLFSDGEEIVKPCLQIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALD------DAAKLNIFIRGFDANFNVFE*LVSL 1050
            +A  K  FS G  +VK C        GN+   K V+ I++S Q V R I  ++Q L  +L  ++ S   FS+ALD      D  +L IF+R  D  F++ E L+ +
Sbjct:  120 IAKRKYPFSSGT-LVKTCALKMAEAFGNETMAKTVESISLSHQTVARHICTINQHLTDKLQNILRSAPYFSIALDESTDITDTCQLVIFVRSVDQEFHISEELLEI 224          
BLAST of DUF4371 domain-containing protein vs. UniProt/SwissProt
Match: sp|A4Z944|ZBED5_CANLF (Zinc finger BED domain-containing protein 5 OS=Canis lupus familiaris OX=9615 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 9.233e-7
Identity = 32/101 (31.68%), Postives = 59/101 (58.42%), Query Frame = 1
Query:  727 TEASYEIG--LALPKKLFSDGEEIVKPCLQIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALDDAAKLN------IFIR 1005
            TEASY +   +AL  +  + GE ++KPC +     + ++ + KK+D + +S   V RRI++L+ D+ ++L   +  C  FSL LD++A ++      +F+R
Sbjct:  195 TEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVR 295          
BLAST of DUF4371 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q49AG3|ZBED5_HUMAN (Zinc finger BED domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBED5 PE=2 SV=2)

HSP 1 Score: 55.8398 bits (133), Expect = 9.307e-7
Identity = 32/101 (31.68%), Postives = 59/101 (58.42%), Query Frame = 1
Query:  727 TEASYEIG--LALPKKLFSDGEEIVKPCLQIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALDDAAKLN------IFIR 1005
            TEASY +   +AL  +  + GE ++KPC +     + ++ + KK+D + +S   V RRI++L+ D+ ++L   +  C  FSL LD++A ++      +F+R
Sbjct:  194 TEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVR 294          
BLAST of DUF4371 domain-containing protein vs. UniProt/SwissProt
Match: sp|A4Z943|ZBED5_BOVIN (Zinc finger BED domain-containing protein 5 OS=Bos taurus OX=9913 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 9.475e-7
Identity = 32/101 (31.68%), Postives = 59/101 (58.42%), Query Frame = 1
Query:  727 TEASYEIG--LALPKKLFSDGEEIVKPCLQIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALDDAAKLN------IFIR 1005
            TEASY +   +AL  +  + GE ++KPC +     + ++ + KK+D + +S   V RRI++L+ D+ ++L   +  C  FSL LD++A ++      +F+R
Sbjct:  195 TEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVR 295          
BLAST of DUF4371 domain-containing protein vs. TrEMBL
Match: A0A026WH11 (General transcription factor II-I repeat domain-containing protein OS=Ooceraea biroi OX=2015173 GN=X777_04805 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 3.483e-28
Identity = 48/79 (60.76%), Postives = 61/79 (77.22%), Query Frame = 1
Query: 1291 KVKILQDLFESRFHDFIKEEDCMLAFINSFSFSEQNVMQMPSIIQMEQINLKTNSFLEMKFDELLKDQNASDIINFWNS 1527
            K+++LQ+ FE RF DF KE DC++AFINSFS SEQ +++MP+I Q E I+LKTN  L MKF+EL    NASD+INFW S
Sbjct:   40 KIRLLQESFEIRFRDFSKE-DCIVAFINSFSLSEQKIIKMPNI-QTELIDLKTNLLLNMKFNELSSVPNASDVINFWRS 116          

HSP 2 Score: 49.2914 bits (116), Expect = 3.483e-28
Identity = 23/36 (63.89%), Postives = 28/36 (77.78%), Query Frame = 3
Query: 1515 FLEFRA*KVFKKYICRFGTTYRCEKVFSSMKLIKSK 1622
            F E R  K  ++YICRFGTTYRCE+ FS+MK+IKS 
Sbjct:  122 FPELR--KFSQRYICRFGTTYRCEQAFSAMKMIKSN 155          

HSP 3 Score: 35.8094 bits (81), Expect = 3.483e-28
Identity = 20/30 (66.67%), Postives = 22/30 (73.33%), Query Frame = 2
Query: 1196 MKLKLFISQLENKHLSQFPHLK*QI*FAVD 1285
            MKLKLF SQL++  LSQFPHLK Q   A D
Sbjct:    1 MKLKLFTSQLKSGDLSQFPHLKEQNECAED 30          
BLAST of DUF4371 domain-containing protein vs. TrEMBL
Match: A0A1S3DQG7 (general transcription factor II-I repeat domain-containing protein 2B-like OS=Diaphorina citri OX=121845 GN=LOC103522896 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.948e-16
Identity = 58/137 (42.34%), Postives = 83/137 (60.58%), Query Frame = 1
Query:  724 MTEASYEIGLALPKKL--FSDGEEIVKPCLQIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALDDA------AKLNIFIRGFDANFNVFE*LVSLTF*RTGS--E*IF*QLKNAV 1104
            M +ASYEI L L KK   FSDG+ IVK  L IF  H  ++  +K  + I++SR  VTRR+EE+S D+  Q+  +V  C  FSLALD+       ++L+IF+R  D +FN+F+ L+ +    T S  E IF ++K  V
Sbjct:    1 MVKASYEISLLLAKKKKPFSDGQ-IVKEALSIFAEHCNDQNVKKHAENISLSRPTVTRRMEEMSNDISSQIQDMVAKCKYFSLALDETCDLTSMSQLSIFVRCIDGDFNIFQDLLEICQLETTSKGEDIFLKIKECV 136          
BLAST of DUF4371 domain-containing protein vs. TrEMBL
Match: A0A3S2LP99 (DUF4371 domain-containing protein OS=Chilo suppressalis OX=168631 GN=evm_014568 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.261e-16
Identity = 50/117 (42.74%), Postives = 73/117 (62.39%), Query Frame = 1
Query:  724 MTEASYEIGLALPKK--LFSDGEEIVKPCLQIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALDDA------AKLNIFIRGFDANFNVFE*LVSL 1050
            M + SYEI L L KK   FSDGE IVK  L IF ++  +K  + K D I++SR  VTRR+E+++ D+ +Q+  +V  C  FSLALD+       ++L IF+R  D N+NV + L+ +
Sbjct:  124 MVKTSYEISLLLAKKKKSFSDGE-IVKEALTIFAKNCDDKHVKAKADSISLSRHTVTRRVEQMAVDIKEQIQEIVAKCKYFSLALDETCDLTSRSQLAIFVRCVDENWNVLQDLLEV 239          

HSP 2 Score: 28.4906 bits (62), Expect = 3.261e-16
Identity = 17/61 (27.87%), Postives = 36/61 (59.02%), Query Frame = 3
Query:  480 WGNELLFITSLSSKPFCVVCKSTF-T**KHDLKR**TTHHQTIMEENMKFILGSELQKEYV 659
            W N+  FI S + KP C++C +T  T  K++L+R    +H    ++   + +GS ++++++
Sbjct:   43 WENKYCFIESKARKPTCLLCFTTVATAKKYNLERHYKQNHNNFEKD---YPVGSAIREDFL 100          
BLAST of DUF4371 domain-containing protein vs. TrEMBL
Match: A0A2T7PA76 (Lactamase_B domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_09589 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.316e-9
Identity = 57/150 (38.00%), Postives = 81/150 (54.00%), Query Frame = 1
Query:  727 TEASY--EIGLALPKKLFSDGEEIVKPCLQIFTRHLGNKFF---EKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLAL------DDAAKLNIFIRGFDANFNVFE*LVSLTF*R--TGSE*IF*QLKNAVFNFL*QENQLP 1137
            T AS+     +A   K FSDGE + K     F  H+ ++      KK +E+++SR+   RRIE + +DL  QL   VPS  +FSLAL      DDAA+L IF+RG   NF + E L+S+   +  T  E IF  ++NA++       QLP
Sbjct:   49 THASFVGAYNIAKHSKSFSDGEFVNK-----FMLHVADQVCPQQRKKFEEVSLSRRTGVRRIEAIGEDLTSQLKRRVPSFQLFSLALDESTNIDDAAQLLIFVRGISENFEITEELLSMESMKDTTPGEDIFECVENAMYTM-----QLP 188          
BLAST of DUF4371 domain-containing protein vs. TrEMBL
Match: A0A5J5CCG0 (Dimer_Tnp_hAT domain-containing protein (Fragment) OS=Etheostoma spectabile OX=54343 GN=FQN60_004506 PE=4 SV=1)

HSP 1 Score: 48.1358 bits (113), Expect = 5.973e-9
Identity = 21/40 (52.50%), Postives = 32/40 (80.00%), Query Frame = 3
Query: 1536 KVFKKYICRFGTTYRCEKVFSSMKLIKSKTRSQITDLNLK 1655
            ++FK+ +C FG+TY CEK+FS+M   KSK RS++TD +L+
Sbjct:  163 RMFKRTMCLFGSTYLCEKLFSTMNFNKSKYRSRLTDGHLQ 202          

HSP 2 Score: 43.1282 bits (100), Expect = 5.973e-9
Identity = 24/60 (40.00%), Postives = 36/60 (60.00%), Query Frame = 1
Query: 1303 LQDLFESRFHDFIKEEDCMLAFINSFSFSEQNVMQMPSIIQMEQINLKTNSFLEMKFDEL 1482
            LQ+ F+ RF DF        +F + FSF  Q+    P ++QME I+L+ NS L++KF E+
Sbjct:   84 LQEEFDRRFADFKTHRATFQSFADPFSFDVQDA---PPVLQMELIDLQCNSELKVKFREV 140          
BLAST of DUF4371 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048309.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000491.1:94927:99076:1 gene:ENSAMXG00000033081.1 transcript:ENSAMXT00000048309.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 7.982e-9
Identity = 39/114 (34.21%), Postives = 61/114 (53.51%), Query Frame = 1
Query:  733 ASYEIGLALP--KKLFSDGEEIVKPCLQIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALD------DAAKLNIFIRGFDANFNVFE*LVSL 1050
            ASY++ L L   KK  SDGE +VK C     +  G+    K  + +++SR+ VTRRI ++   +  ++  ++  C  FSLALD      D ++L +F R  D  F+V   L+ L
Sbjct:  129 ASYDVALELARAKKPLSDGE-VVKRCAVKMAKAFGDNNIAKNFETVSLSRRTVTRRIFDIHGHVHVKMKQVMQDCQYFSLALDESTDVTDVSQLLVFARTIDNAFDVHRELLKL 241          
BLAST of DUF4371 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000030525.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:12992682:12994541:1 gene:ENSAMXG00000035573.1 transcript:ENSAMXT00000030525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 9.159e-8
Identity = 46/137 (33.58%), Postives = 74/137 (54.01%), Query Frame = 1
Query:  730 EASYEIGLALPK--KLFSDGEEIVKPCLQIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALD------DAAKLNIFIRGFDANFNVFE*LVSL--TF*RTGSE*IF*QLKNAVFN 1110
            EASY +   + K  K F++GE + K  LQ  +     K  + +   I++S   V  RI +LS D++ QL       +++S+ALD      D A+L I++RG D NF V E L+++     +T ++ IF QL +A+ N
Sbjct:  155 EASYVVSEMIAKAGKPFTEGEFVKKCILQAASIVCPEK--KGQFSNISLSANTVAERISDLSSDIYDQLCEKAKRFSVYSVALDESTDITDTAQLAIYVRGVDDNFEVTEELLTVIPMHGQTTAQEIFHQLCDAIEN 289          
BLAST of DUF4371 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000052542.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000549.1:35642:40620:1 gene:ENSAMXG00000033785.1 transcript:ENSAMXT00000052542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 2.051e-6
Identity = 49/143 (34.27%), Postives = 67/143 (46.85%), Query Frame = 1
Query:  727 TEASYEIG--LALPKKLFSDGEEIVKPCL----QIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALD------DAAKLNIFIRGFDANFNVFE*LVSLT--F*RTGSE*IF*QLKNAVFNF 1113
            T ASY I   +A   + F DGE  VK C+     +      + F       I++SR  + RRI +LS + + QL   +   T FS ALD      D A+L+IFIRG      V++ L +L   + RT    IF   K AV N 
Sbjct:   99 TIASYRIANLVAKSARPFIDGE-FVKDCMLEACDVICPEAKDAF-----KNISLSRTTIQRRIVDLSSNSYCQLQSRINDVTYFSAALDESTDNTDTAQLSIFIRGVTGTCQVYQELAALVPLYGRTTGFEIFNAFKTAVENL 235          
BLAST of DUF4371 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027093.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111947639])

HSP 1 Score: 50.0618 bits (118), Expect = 5.938e-6
Identity = 40/106 (37.74%), Postives = 57/106 (53.77%), Query Frame = 1
Query:  751 LALPKKLFSDGEEIVKPCLQIFTRHLGNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALD------DAAKLNIFIRGFDANFNVFE*LVSL 1050
            +A   K FSDGE  VK CL + +  L     +   + I++SR+ V RRIE+++ +L  QL         FSLALD      D A+L IF+RG  A F + E L ++
Sbjct:   94 IARNSKPFSDGE-FVKECL-LDSVALICPETKSAFENISLSRRTVARRIEDIAGNLELQLKSRAADFDCFSLALDESCDIRDTAQLLIFLRGITAEFQITEELAAM 197          
BLAST of DUF4371 domain-containing protein vs. Planmine SMEST
Match: SMESG000045419.1 (SMESG000045419.1)

HSP 1 Score: 56.225 bits (134), Expect = 4.836e-8
Identity = 42/104 (40.38%), Postives = 56/104 (53.85%), Query Frame = 1
Query:  763 KKLFSDGEEIVKPCLQIFTRHLGNKFFEKKV--DEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALD------DAAKLNIFIRGFDANFNVFE*LVSL 1050
            K+ F+D  E VK CL      L     E K    +I++S +   RR+EE+  +LF+QL     S   +SLA+D      D A+L IFIRG D +FNV E L SL
Sbjct:   89 KRPFTD-LEFVKRCLVAVAEKLCP---ETKTLFQDISLSARTCARRVEEIGTNLFEQLKCKAKSFDCYSLAMDESIDITDTAQLIIFIRGIDGDFNVHEELTSL 188          
BLAST of DUF4371 domain-containing protein vs. Planmine SMEST
Match: SMESG000053419.1 (SMESG000053419.1)

HSP 1 Score: 40.4318 bits (93), Expect = 2.356e-7
Identity = 17/27 (62.96%), Postives = 22/27 (81.48%), Query Frame = 3
Query: 1572 TYRCEKVFSSMKLIKSKTRSQITDLNL 1652
            TYRCE+ FS+MKLIK+K R ++ D NL
Sbjct:   58 TYRCEQSFSAMKLIKNKNRDRLNDSNL 84          

HSP 2 Score: 34.2686 bits (77), Expect = 2.356e-7
Identity = 16/34 (47.06%), Postives = 24/34 (70.59%), Query Frame = 1
Query: 1420 IQMEQINLKTNSFLEMKFDELLKDQNASDIINFW 1521
            +Q+E  +LK NS L+ +F ELL    A+D+I+FW
Sbjct:    6 LQLEINDLKCNSILKARFVELLGAPTANDMISFW 39          
BLAST of DUF4371 domain-containing protein vs. Planmine SMEST
Match: SMESG000037770.1 (SMESG000037770.1)

HSP 1 Score: 53.1434 bits (126), Expect = 5.495e-7
Identity = 47/118 (39.83%), Postives = 65/118 (55.08%), Query Frame = 1
Query:  727 TEASYEIGLALPK--KLFSDGEEIVKPCLQIFTRHLG--NKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALD------DAAKLNIFIRGFDANFNVFE*LVSL 1050
            T+AS  I   + K  K FS+GE  VK C+      +   NK   KK + I++SR+ V RRIE +++DL  QL   + +   FS+ALD      D A+L IFIRG D  F   E L+S+
Sbjct:  619 TKASLVIAHKIVKHNKPFSEGE-FVKDCVLEIADIICPENK---KKFENISLSRRTVVRRIESIAEDLSDQLLNKIKTFQWFSIALDESTDIQDTAQLLIFIRGIDDKFIATEELLSM 732          
BLAST of DUF4371 domain-containing protein vs. Planmine SMEST
Match: SMESG000068362.1 (SMESG000068362.1)

HSP 1 Score: 47.7506 bits (112), Expect = 6.186e-6
Identity = 28/82 (34.15%), Postives = 49/82 (59.76%), Query Frame = 1
Query:  829 GNKFFEKKVDEIAISRQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALD------DAAKLNIFIRGFDANFNVFE*LVSLTF 1056
            G++ F +K+  I++SR  VTRRI++++  +   L     +C  +S+ LD      D A+L IF+RG D++F++ E L+ L  
Sbjct:    8 GHRKF-RKIVIISLSRMTVTRRIDDMADSIEAVLKEKAENCDAYSICLDESTDMADTAQLAIFVRGVDSDFSIKEELLKLAI 88          
The following BLAST results are available for this feature:
BLAST of DUF4371 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ZBED51.938e-731.68zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
ZBED51.938e-731.68zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000028445.11.175e-835.87general transcription factor II-I repeat domain-co... [more]
spag17.337e-733.96sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000016563.18.710e-733.96pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4371 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|A4Z944|ZBED5_CANLF9.233e-731.68Zinc finger BED domain-containing protein 5 OS=Can... [more]
sp|Q49AG3|ZBED5_HUMAN9.307e-731.68Zinc finger BED domain-containing protein 5 OS=Hom... [more]
sp|A4Z943|ZBED5_BOVIN9.475e-731.68Zinc finger BED domain-containing protein 5 OS=Bos... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A026WH113.483e-2860.76General transcription factor II-I repeat domain-co... [more]
A0A1S3DQG72.948e-1642.34general transcription factor II-I repeat domain-co... [more]
A0A3S2LP993.261e-1642.74DUF4371 domain-containing protein OS=Chilo suppres... [more]
A0A2T7PA763.316e-938.00Lactamase_B domain-containing protein OS=Pomacea c... [more]
A0A5J5CCG05.973e-952.50Dimer_Tnp_hAT domain-containing protein (Fragment)... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000048309.17.982e-934.21pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030525.19.159e-833.58pep primary_assembly:Astyanax_mexicanus-2.0:1:1299... [more]
ENSAMXT00000052542.12.051e-634.27pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000027093.15.938e-637.74general transcription factor II-I repeat domain-co... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000045419.14.836e-840.38SMESG000045419.1[more]
SMESG000053419.12.356e-762.96SMESG000053419.1[more]
SMESG000037770.15.495e-739.83SMESG000037770.1[more]
SMESG000068362.16.186e-634.15SMESG000068362.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012330 ID=SMED30012330|Name=DUF4371 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1730bp
TACAACTTTTTTGTGTCGAAAGTTAAATTAATTGTTCGTAAATGTTACTT
TAGGTAAGTTTACAAAATACAAATTTTTTTTATCGGTGTTACCATTCGCA
TTCTTATTTAAATTATTGTAAACCTTGCGCACTAACAACATAGCATATGT
TTGAAGTCATGTTCGAATGAGCGGTGAGTGTTTTATGTTGCTAGCAGTTC
TGCATGAGTCATCGTGGCTTGGAGTTTGAAGGAATGTTTTATTGAGTATA
CTAACGTAGTTTTTGTATTGAGAGTGAATCAAAGACAATATATAATTTAA
ATTCAAAAATAATTTATATTTTCTGTAATAAGACGTGCGTACTTTTATTT
TTTTATTCTTTTAAATTTTTTTTAGTTAAAAACTGTTATATACTTAAATT
CCTGTTGTTCATTACCATCCAAAGGAAAGTAAACCAAAGAAGCCAAGAAA
GTGACAGTAGGTGATAATTCGATAAATGATGGGGAAATGAGTTGCTGTTT
ATAACAAGTTTATCTAGCAAACCATTTTGTGTTGTTTGTAAAAGTACTTT
CACATAATAAAAACATGATCTTAAGAGATAGTAAACGACACATCATCAGA
CTATTATGGAAGAAAACATGAAGTTTATTCTTGGATCCGAATTACAAAAA
GAATATGTAACCAAGAAAAATGAAGAATAAGAAAAAGACAAAGTGGATTT
GTTAAAGTATTAAAGACTTGGAAATGACAGAAGCGTCATATGAAATTGGT
TTAGCATTACCAAAAAAACTTTTTTCTGATGGAGAAGAAATTGTTAAACC
TTGTCTCCAAATATTTACACGCCATCTCGGTAATAAATTTTTCGAAAAAA
AAGTAGACGAAATTGCTATTTCAAGGCAGAAAGTTACAAGACGTATCGAG
GAACTCTCTCAGGATTTATTTCAGCAACTGGACTACCTTGTTCCTTCTTG
TACCATATTTTCTCTAGCTTTGGATGATGCTGCAAAGTTAAATATTTTTA
TAAGAGGATTTGATGCCAATTTTAATGTCTTTGAATAACTTGTCAGTCTG
ACTTTCTAGAGGACAGGTTCTGAATAGATTTTTTGACAATTAAAAAATGC
CGTTTTTAATTTTTTATAACAGGAAAACCAACTACCTGATGAAAGAACTC
TATACAAATAAAAAATAAATTATAAATAACGTCAGTTCATTTAAAATGAA
ATTAAAACTATTCATTTCCCAGTTAGAAAACAAGCATTTAAGTCAATTTC
CACATTTGAAATAACAGATTTAATTTGCTGTGGATAAATAAAGGTAAAGA
TATTGCAAGATTTATTTGAAAGCCGTTTTCATGATTTTATCAAAGAAGAA
GACTGCATGCTCGCATTTATAAACTCATTTTCCTTTAGTGAGCAAAACGT
AATGCAGATGCCTAGTATCATACAAATGGAACAGATTAATTTAAAAACAA
ATTCATTTTTGGAAATGAAATTCGATGAGCTTTTAAAAGATCAAAATGCG
TCTGATATAATTAATTTCTGGAATTCAGGGCTTAAAAAGTATTCAAAAAA
TACATATGCCGATTTGGAACGACATACAGATGTGAAAAAGTATTTTCGTC
TATGAAATTGATTAAAAGCAAAACAAGATCGCAAATAACTGATCTAAATT
TGAAAAACTCTGCTACTTTCGGTGACAAATATAACACCAAACATAAAAAA
ATTAGCTAAATCCAAGCCAAACAGATCGGA
back to top

protein sequence of SMED30012330-orf-1

>SMED30012330-orf-1 ID=SMED30012330-orf-1|Name=SMED30012330-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
MTEASYEIGLALPKKLFSDGEEIVKPCLQIFTRHLGNKFFEKKVDEIAIS
RQKVTRRIEELSQDLFQQLDYLVPSCTIFSLALDDAAKLNIFIRGFDANF
NVFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005654nucleoplasm
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
Vocabulary: molecular function
TermDefinition
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter