UDP galactose 4 epimerase

Overview
NameUDP galactose 4 epimerase (AFJ24756.1)
Smed IDSMED30012329
Length (bp)1215
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of UDP galactose 4 epimerase (SMED30012329) t-SNE clustered cells

Violin plots show distribution of expression levels for UDP galactose 4 epimerase (SMED30012329) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of UDP galactose 4 epimerase (SMED30012329) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for UDP galactose 4 epimerase (SMED30012329) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012329

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30012329SMESG000062688.1 dd_Smed_v4_1201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of UDP galactose 4 epimerase vs. Ensembl Human
Match: GALE (UDP-galactose-4-epimerase [Source:HGNC Symbol;Acc:HGNC:4116])

HSP 1 Score: 437.958 bits (1125), Expect = 3.199e-153
Identity = 204/340 (60.00%), Postives = 252/340 (74.12%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGY 1108
            VLVTGG GYIGSHTV+EL  AGY  V+IDN  NA +      E L R++++T     F E+D+L++  L  LF KY F  VIHFA LKAVGESV  PL YY+ N+   + L+E+M  HGVK+LVFSSSATVYG P+ LP+ E    GGCTNPYGK+K+FIEEM+ D+C+ D TW+ V+LRYFNP G+H SG IGEDP G P NLMP+V+QVA+G+R  +NVFGNDY T DGTGVRDYIHVVDLA+GHI AL KL  +CG +IYNLGTG GYSVL+M+ A E+A G KIPY++  RR GD+   YA+  LA++EL W +  GL  MCEDLW WQ++NP G+
Sbjct:    5 VLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGF 344          
BLAST of UDP galactose 4 epimerase vs. Ensembl Human
Match: GALE (UDP-galactose-4-epimerase [Source:HGNC Symbol;Acc:HGNC:4116])

HSP 1 Score: 437.958 bits (1125), Expect = 3.199e-153
Identity = 204/340 (60.00%), Postives = 252/340 (74.12%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGY 1108
            VLVTGG GYIGSHTV+EL  AGY  V+IDN  NA +      E L R++++T     F E+D+L++  L  LF KY F  VIHFA LKAVGESV  PL YY+ N+   + L+E+M  HGVK+LVFSSSATVYG P+ LP+ E    GGCTNPYGK+K+FIEEM+ D+C+ D TW+ V+LRYFNP G+H SG IGEDP G P NLMP+V+QVA+G+R  +NVFGNDY T DGTGVRDYIHVVDLA+GHI AL KL  +CG +IYNLGTG GYSVL+M+ A E+A G KIPY++  RR GD+   YA+  LA++EL W +  GL  MCEDLW WQ++NP G+
Sbjct:    5 VLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGF 344          
BLAST of UDP galactose 4 epimerase vs. Ensembl Human
Match: GALE (UDP-galactose-4-epimerase [Source:HGNC Symbol;Acc:HGNC:4116])

HSP 1 Score: 316.235 bits (809), Expect = 4.705e-107
Identity = 146/227 (64.32%), Postives = 177/227 (77.97%), Query Frame = 2
Query:  269 VDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHK 949
            +D+L++  L  LF KY F  VIHFA LKAVGESV  PL YY+ N+   + L+E+M  HGVK+LVFSSSATVYG P+ LP+ E    GGCTNPYGK+K+FIEEM+ D+C+ D TW+ V+LRYFNP G+H SG IGEDP G P NLMP+V+QVA+G+R  +NVFGNDY T DGTGVRDYIHVVDLA+GHI AL KL  +CG +IYNLGTG GYSVL+M+ A E+A G K
Sbjct:    1 MDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKK 227          
BLAST of UDP galactose 4 epimerase vs. Ensembl Human
Match: GALE (UDP-galactose-4-epimerase [Source:HGNC Symbol;Acc:HGNC:4116])

HSP 1 Score: 303.138 bits (775), Expect = 8.338e-102
Identity = 145/265 (54.72%), Postives = 181/265 (68.30%), Query Frame = 2
Query:  269 VDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEM 1063
            +D+L++  L  LF KY F  VIHFA LKAVGESV  PL YY+ N+   + L+E+M  HGVK+LVFSSSATVYG P+ LP+ E    GGCTNPYGK+K+FIEEM+ D+C+ D TW+ V+LRYFNP G+H SG IGEDP G P NLMP+V+QVA+G+R  +NVFGNDY T DGTGVRDYIHVVDLA+GHI AL KL                          ++ CG +IPY++  RR GD+   YA+  LA++EL W +  GL  M
Sbjct:    1 MDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKL--------------------------KEQCGCRIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRM 239          
BLAST of UDP galactose 4 epimerase vs. Ensembl Human
Match: GALE (UDP-galactose-4-epimerase [Source:HGNC Symbol;Acc:HGNC:4116])

HSP 1 Score: 228.794 bits (582), Expect = 2.295e-73
Identity = 109/190 (57.37%), Postives = 136/190 (71.58%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKS 658
            VLVTGG GYIGSHTV+EL  AGY  V+IDN  NA +      E L R++++T     F E+D+L++  L  LF KY F  VIHFA LKAVGESV  PL YY+ N+   + L+E+M  HGVK+LVFSSSATVYG P+ LP+ E    GGCTNPYGK+K+FIEEM+ D+C+ D TW+ V+LRYFNP G+H S
Sbjct:    5 VLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHAS 194          
BLAST of UDP galactose 4 epimerase vs. Ensembl Celegans
Match: gale-1 (UDP-glucose 4-epimerase [Source:UniProtKB/Swiss-Prot;Acc:Q564Q1])

HSP 1 Score: 392.119 bits (1006), Expect = 1.344e-135
Identity = 187/344 (54.36%), Postives = 250/344 (72.67%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNA------NKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIG-GCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLN--GKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            +LVTG  G+IGSHTV+EL  +GY V+ IDN  NA      N   L R+ ++T     F  VD+ ++  L  +F++ KF  +IH AALKAVGESVA PL+YY NN++A+LNLI++   + VK+ VFSSSATVYG P +LPITE    G G TNPYG+TK+ +E++L D+ K +  W+VV+LRYFNPVG+HKSG+IGEDP G P NLMP+V+QVA+GK P + ++G+ + T DGTGVRDYIHVVDLA+GH+KA +++   G  G +IYNLGTG GYSV +M+ A ++  G  IP +I   RPGD+  VY D  LA+++L W++  GL+EMC DLWNWQ KNP+G+S
Sbjct:    3 ILVTGAAGFIGSHTVLELLNSGYTVLCIDNFANAISDEHGNAISLKRVAQLTGKDVPFQNVDVCDEAALEKVFSENKFDGIIHLAALKAVGESVAKPLQYYSNNLVASLNLIQMCLKYNVKNFVFSSSATVYGPPSELPITEKSQTGQGITNPYGQTKYMMEQILIDVGKANPEWNVVLLRYFNPVGAHKSGLIGEDPKGVPNNLMPYVSQVAIGKLPVLTIYGDQFDTVDGTGVRDYIHVVDLAKGHVKAFDRIKTVGNIGTEIYNLGTGVGYSVRQMVDALKKVSGRDIPVKIGVPRPGDVASVYCDPSLAQEKLGWRAETGLEEMCADLWNWQTKNPQGFS 346          
BLAST of UDP galactose 4 epimerase vs. Ensembl Celegans
Match: gale-1 (UDP-glucose 4-epimerase [Source:UniProtKB/Swiss-Prot;Acc:Q564Q1])

HSP 1 Score: 391.734 bits (1005), Expect = 2.680e-135
Identity = 187/346 (54.05%), Postives = 250/346 (72.25%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNA--------NKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIG-GCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLN--GKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            +LVTG  G+IGSHTV+EL  +GY V+ IDN  NA        N   L R+ ++T     F  VD+ ++  L  +F++ KF  +IH AALKAVGESVA PL+YY NN++A+LNLI++   + VK+ VFSSSATVYG P +LPITE    G G TNPYG+TK+ +E++L D+ K +  W+VV+LRYFNPVG+HKSG+IGEDP G P NLMP+V+QVA+GK P + ++G+ + T DGTGVRDYIHVVDLA+GH+KA +++   G  G +IYNLGTG GYSV +M+ A ++  G  IP +I   RPGD+  VY D  LA+++L W++  GL+EMC DLWNWQ KNP+G+S
Sbjct:    3 ILVTGAAGFIGSHTVLELLNSGYTVLCIDNFANAISVTDEHGNAISLKRVAQLTGKDVPFQNVDVCDEAALEKVFSENKFDGIIHLAALKAVGESVAKPLQYYSNNLVASLNLIQMCLKYNVKNFVFSSSATVYGPPSELPITEKSQTGQGITNPYGQTKYMMEQILIDVGKANPEWNVVLLRYFNPVGAHKSGLIGEDPKGVPNNLMPYVSQVAIGKLPVLTIYGDQFDTVDGTGVRDYIHVVDLAKGHVKAFDRIKTVGNIGTEIYNLGTGVGYSVRQMVDALKKVSGRDIPVKIGVPRPGDVASVYCDPSLAQEKLGWRAETGLEEMCADLWNWQTKNPQGFS 348          
BLAST of UDP galactose 4 epimerase vs. Ensembl Celegans
Match: F53B1.4 (pep chromosome:WBcel235:X:2111397:2113103:-1 gene:WBGene00018737.1 transcript:F53B1.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53B1.4)

HSP 1 Score: 66.2402 bits (160), Expect = 7.234e-12
Identity = 75/278 (26.98%), Postives = 120/278 (43.17%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVII--DNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADH---GVKSLVFSSSATVYGTP--KKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYP-TNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEM 916
            VL+TGG G+IGS+ +   F        I  D L           E     ++ F E  + ++  L     + +   VIHFAA+  V ES +  +   ++NII+   L+E + +    GVK LV  S+  VYG       P +E  S+   TNPY  +K   E +      + + W    L Y   V    + + G  P      L+P   ++A+  +P        YP   DG   R +++V D ++   +    L G  G +IYN+GT    + +E+
Sbjct:   11 VLITGGCGFIGSNYINFTFNKWKNTKFINYDKLAFGASPLHVEKEIRESPRYKFVEAALEDQPTLIKTLQENEVDMVIHFAAITHVDESYSDRIGTIQDNIISTTTLLESIVNSPYKGVKKLVHISTDEVYGDSFEDTTPKSESASLPNPTNPYAASKAACEMV------IRSYWHSYKLPY---VMVRMNNVYG--PRQIHTKLIPKFTKLALDGKP--------YPLMGDGLHTRSWMYVEDCSEAITRV--ALEGTLG-EIYNIGTDFEMTNIEL 266          
BLAST of UDP galactose 4 epimerase vs. Ensembl Celegans
Match: sqv-1 (SQuashed Vulva [Source:UniProtKB/TrEMBL;Acc:X5M5R6])

HSP 1 Score: 63.929 bits (154), Expect = 7.094e-11
Identity = 75/333 (22.52%), Postives = 144/333 (43.24%), Query Frame = 2
Query:   92 KSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKY--KFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITE-----LDSIG--GCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEV-YADTKLAEKELNWKSIYGLKE 1060
            ++++ +L+TGG G++GSH V +L   G+EV+ +DN     K       K  ++       +M++     D+ N Y  +   + H A+  +    +  P+K  K N +  +N++  +A     +++ +S++ VYG P+  P  E     +++IG   C   Y + K   E ++    K +    + I R FN  G       G         +  F+ Q A+  +P + ++GN      GT  R + +V DL  G IK    +N    L + N+G    +++ +  T             +      D P+    D + A ++++W     +K+
Sbjct:   79 ETRKRILITGGAGFVGSHLVDKLMLDGHEVIALDNYFTGRK-------KNVEHWIGHPNFEMVHH----DVVNPYFVEVDQIYHLASPASPPHYMYNPVKTIKTNTLGTINMLG-LAKRVKATVLLASTSEVYGDPEVHPQPETYWGHVNTIGPRAC---YDEGKRVAESLMVAYNKQENI-KIRIARIFNTFGPRMHMNDGR-------VVSNFIIQ-ALQDKP-ITIYGN------GTQTRSFQYVTDLVDGLIKL---MNSNYSLPV-NIGNPEEHTIGQFATIIRDLVPGSTSEIVNLESQQDDPQQRRPDIRRAAEQISWAPQVHMKD 376          
BLAST of UDP galactose 4 epimerase vs. Ensembl Celegans
Match: sqv-1 (SQuashed Vulva [Source:UniProtKB/TrEMBL;Acc:X5M5R6])

HSP 1 Score: 63.929 bits (154), Expect = 7.094e-11
Identity = 75/333 (22.52%), Postives = 144/333 (43.24%), Query Frame = 2
Query:   92 KSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKY--KFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITE-----LDSIG--GCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEV-YADTKLAEKELNWKSIYGLKE 1060
            ++++ +L+TGG G++GSH V +L   G+EV+ +DN     K       K  ++       +M++     D+ N Y  +   + H A+  +    +  P+K  K N +  +N++  +A     +++ +S++ VYG P+  P  E     +++IG   C   Y + K   E ++    K +    + I R FN  G       G         +  F+ Q A+  +P + ++GN      GT  R + +V DL  G IK    +N    L + N+G    +++ +  T             +      D P+    D + A ++++W     +K+
Sbjct:   79 ETRKRILITGGAGFVGSHLVDKLMLDGHEVIALDNYFTGRK-------KNVEHWIGHPNFEMVHH----DVVNPYFVEVDQIYHLASPASPPHYMYNPVKTIKTNTLGTINMLG-LAKRVKATVLLASTSEVYGDPEVHPQPETYWGHVNTIGPRAC---YDEGKRVAESLMVAYNKQENI-KIRIARIFNTFGPRMHMNDGR-------VVSNFIIQ-ALQDKP-ITIYGN------GTQTRSFQYVTDLVDGLIKL---MNSNYSLPV-NIGNPEEHTIGQFATIIRDLVPGSTSEIVNLESQQDDPQQRRPDIRRAAEQISWAPQVHMKD 376          
BLAST of UDP galactose 4 epimerase vs. Ensembl Fly
Match: Gale (gene:FBgn0035147 transcript:FBtr0072556)

HSP 1 Score: 417.157 bits (1071), Expect = 3.134e-145
Identity = 196/343 (57.14%), Postives = 253/343 (73.76%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLN--GKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            VLVTGG GYIGSHTV+E+  AGY V+ +DNLCNA        E L+R+++IT  K  F+ VD+ +++ +  +F ++K   V HFAALKAVGES  +PL+YY NN+     L+E MAD+ V   V+SSSATVYG PK LP+TE    G CT+PYGKTK+F EE+L D+CK D  W+VV LRYFNPVG+H SG IGEDP G P NLMP++AQVAVG+RP ++V+G+D+PT+DGTGVRDYIH+VDLA+GH+KAL+KL    + G   YNLGTG GYSVL+M+ AFE+A G K+ Y +  RR GD+   YAD  LA+K+L WK+  G+ +MCED W WQ +NP GY+
Sbjct:    6 VLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEITGKKVNFYRVDITDREQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTGTNVLLEAMADNNVFKFVYSSSATVYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEILKDLCKSDKRWAVVSLRYFNPVGAHISGRIGEDPNGEPNNLMPYIAQVAVGRRPSLSVYGSDFPTHDGTGVRDYIHIVDLAEGHVKALDKLRNIAETGFFAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVDRRSGDVATCYADATLADKKLGWKAERGIDKMCEDTWRWQSQNPNGYA 348          
BLAST of UDP galactose 4 epimerase vs. Ensembl Fly
Match: Gale (gene:FBgn0035147 transcript:FBtr0306917)

HSP 1 Score: 417.157 bits (1071), Expect = 3.134e-145
Identity = 196/343 (57.14%), Postives = 253/343 (73.76%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLN--GKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            VLVTGG GYIGSHTV+E+  AGY V+ +DNLCNA        E L+R+++IT  K  F+ VD+ +++ +  +F ++K   V HFAALKAVGES  +PL+YY NN+     L+E MAD+ V   V+SSSATVYG PK LP+TE    G CT+PYGKTK+F EE+L D+CK D  W+VV LRYFNPVG+H SG IGEDP G P NLMP++AQVAVG+RP ++V+G+D+PT+DGTGVRDYIH+VDLA+GH+KAL+KL    + G   YNLGTG GYSVL+M+ AFE+A G K+ Y +  RR GD+   YAD  LA+K+L WK+  G+ +MCED W WQ +NP GY+
Sbjct:    6 VLVTGGAGYIGSHTVLEMLNAGYNVICVDNLCNAYSSGAKLPEALSRVQEITGKKVNFYRVDITDREQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTGTNVLLEAMADNNVFKFVYSSSATVYGEPKFLPVTEEHPTGNCTSPYGKTKYFTEEILKDLCKSDKRWAVVSLRYFNPVGAHISGRIGEDPNGEPNNLMPYIAQVAVGRRPSLSVYGSDFPTHDGTGVRDYIHIVDLAEGHVKALDKLRNIAETGFFAYNLGTGVGYSVLDMVKAFEKASGKKVNYTLVDRRSGDVATCYADATLADKKLGWKAERGIDKMCEDTWRWQSQNPNGYA 348          
BLAST of UDP galactose 4 epimerase vs. Ensembl Fly
Match: Uxs (gene:FBgn0035848 transcript:FBtr0076690)

HSP 1 Score: 61.2326 bits (147), Expect = 5.990e-10
Identity = 59/253 (23.32%), Postives = 110/253 (43.48%), Query Frame = 2
Query:   92 KSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNP------YGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHI 832
            K+++ +L+TGG G++GSH V +L   G+EV+++DN     K  +       ++       ++++   ++ LF   +   + H A+  +    +  P+K  K N +  +N++  +A   +  ++ +S++ VYG P   P  E  +  G  NP      Y + K   E + +   K +    V + R FN  G       G         +  F+ Q    +   + V+GN      G   R + +V DL  G I
Sbjct:  113 KNRKRILITGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNV-------EHWLGHENFELIHHDIVNPLF--IEIDEIYHLASPASPPHYMYNPVKTIKTNTMGTINVLG-LAKRVMAKVLIASTSEVYGDPTVHPQPE--TYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKV-QVRVARIFNTYGPRMHMNDGRV-------VSNFILQAL--RNETITVYGN------GKQTRSFQYVSDLVDGMI 337          
BLAST of UDP galactose 4 epimerase vs. Ensembl Zebrafish
Match: gale (UDP-galactose-4-epimerase [Source:ZFIN;Acc:ZDB-GENE-060421-6479])

HSP 1 Score: 453.751 bits (1166), Expect = 1.511e-159
Identity = 210/343 (61.22%), Postives = 259/343 (75.51%), Query Frame = 2
Query:   98 KQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKE-----CLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            +Q +LVTGG GYIGSH V+EL  AG+  V+IDN  NA +E      L RIEK    +  FHE+D+L+K  L  +F  + F+ V+HFA LKAVGESV  PL+YY+ N+   +NL+EVM  HGV++LVFSSSATVYG P+KLPI E   +GGCTNPYGKTK+FIEEM+ D C  +  W+ V+LRYFNP+G+H SG IGEDP G P NL+P+VAQVA+G+R H+NVFGNDY T DGTGVRDYIHVVDLA+GHI A+ KL   CG K+YNLGTG GYSVL+M++A E+A G KI Y+IAPRR GD+   YAD  LAEKEL WK+ + L+ MCEDLW WQ +NP G+S
Sbjct:    2 RQKILVTGGGGYIGSHCVVELIEAGFHPVVIDNFSNAVREGDVPESLRRIEKFMDTQIEFHELDLLDKPGLEKIFKMHSFYAVMHFAGLKAVGESVEQPLRYYRVNLTGTINLLEVMQSHGVRNLVFSSSATVYGDPQKLPIDEQHPVGGCTNPYGKTKYFIEEMIRDQCTAEKDWNAVLLRYFNPIGAHISGQIGEDPQGIPNNLLPYVAQVAIGRRKHLNVFGNDYSTPDGTGVRDYIHVVDLAKGHIAAVRKLKDSCGCKVYNLGTGTGYSVLQMVSAMEKASGRKIAYQIAPRRSGDVASCYADASLAEKELGWKAEFDLERMCEDLWRWQSQNPTGFS 344          
BLAST of UDP galactose 4 epimerase vs. Ensembl Zebrafish
Match: gale (UDP-galactose-4-epimerase [Source:ZFIN;Acc:ZDB-GENE-060421-6479])

HSP 1 Score: 452.981 bits (1164), Expect = 2.559e-159
Identity = 210/344 (61.05%), Postives = 259/344 (75.29%), Query Frame = 2
Query:   98 KQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            +Q +LVTGG GYIGSH V+EL  AG+  V+IDN  NA +      E L RIEK    +  FHE+D+L+K  L  +F  + F+ V+HFA LKAVGESV  PL+YY+ N+   +NL+EVM  HGV++LVFSSSATVYG P+KLPI E   +GGCTNPYGKTK+FIEEM+ D C  +  W+ V+LRYFNP+G+H SG IGEDP G P NL+P+VAQVA+G+R H+NVFGNDY T DGTGVRDYIHVVDLA+GHI A+ KL   CG K+YNLGTG GYSVL+M++A E+A G KI Y+IAPRR GD+   YAD  LAEKEL WK+ + L+ MCEDLW WQ +NP G+S
Sbjct:    2 RQKILVTGGGGYIGSHCVVELIEAGFHPVVIDNFSNAVRGEGDVPESLRRIEKFMDTQIEFHELDLLDKPGLEKIFKMHSFYAVMHFAGLKAVGESVEQPLRYYRVNLTGTINLLEVMQSHGVRNLVFSSSATVYGDPQKLPIDEQHPVGGCTNPYGKTKYFIEEMIRDQCTAEKDWNAVLLRYFNPIGAHISGQIGEDPQGIPNNLLPYVAQVAIGRRKHLNVFGNDYSTPDGTGVRDYIHVVDLAKGHIAAVRKLKDSCGCKVYNLGTGTGYSVLQMVSAMEKASGRKIAYQIAPRRSGDVASCYADASLAEKELGWKAEFDLERMCEDLWRWQSQNPTGFS 345          
BLAST of UDP galactose 4 epimerase vs. Ensembl Zebrafish
Match: gale (UDP-galactose-4-epimerase [Source:ZFIN;Acc:ZDB-GENE-060421-6479])

HSP 1 Score: 452.981 bits (1164), Expect = 2.559e-159
Identity = 210/344 (61.05%), Postives = 259/344 (75.29%), Query Frame = 2
Query:   98 KQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            +Q +LVTGG GYIGSH V+EL  AG+  V+IDN  NA +      E L RIEK    +  FHE+D+L+K  L  +F  + F+ V+HFA LKAVGESV  PL+YY+ N+   +NL+EVM  HGV++LVFSSSATVYG P+KLPI E   +GGCTNPYGKTK+FIEEM+ D C  +  W+ V+LRYFNP+G+H SG IGEDP G P NL+P+VAQVA+G+R H+NVFGNDY T DGTGVRDYIHVVDLA+GHI A+ KL   CG K+YNLGTG GYSVL+M++A E+A G KI Y+IAPRR GD+   YAD  LAEKEL WK+ + L+ MCEDLW WQ +NP G+S
Sbjct:    2 RQKILVTGGGGYIGSHCVVELIEAGFHPVVIDNFSNAVRGEGDVPESLRRIEKFMDTQIEFHELDLLDKPGLEKIFKMHSFYAVMHFAGLKAVGESVEQPLRYYRVNLTGTINLLEVMQSHGVRNLVFSSSATVYGDPQKLPIDEQHPVGGCTNPYGKTKYFIEEMIRDQCTAEKDWNAVLLRYFNPIGAHISGQIGEDPQGIPNNLLPYVAQVAIGRRKHLNVFGNDYSTPDGTGVRDYIHVVDLAKGHIAAVRKLKDSCGCKVYNLGTGTGYSVLQMVSAMEKASGRKIAYQIAPRRSGDVASCYADASLAEKELGWKAEFDLERMCEDLWRWQSQNPTGFS 345          
BLAST of UDP galactose 4 epimerase vs. Ensembl Zebrafish
Match: gale (UDP-galactose-4-epimerase [Source:ZFIN;Acc:ZDB-GENE-060421-6479])

HSP 1 Score: 452.981 bits (1164), Expect = 2.559e-159
Identity = 210/344 (61.05%), Postives = 259/344 (75.29%), Query Frame = 2
Query:   98 KQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            +Q +LVTGG GYIGSH V+EL  AG+  V+IDN  NA +      E L RIEK    +  FHE+D+L+K  L  +F  + F+ V+HFA LKAVGESV  PL+YY+ N+   +NL+EVM  HGV++LVFSSSATVYG P+KLPI E   +GGCTNPYGKTK+FIEEM+ D C  +  W+ V+LRYFNP+G+H SG IGEDP G P NL+P+VAQVA+G+R H+NVFGNDY T DGTGVRDYIHVVDLA+GHI A+ KL   CG K+YNLGTG GYSVL+M++A E+A G KI Y+IAPRR GD+   YAD  LAEKEL WK+ + L+ MCEDLW WQ +NP G+S
Sbjct:    2 RQKILVTGGGGYIGSHCVVELIEAGFHPVVIDNFSNAVRGEGDVPESLRRIEKFMDTQIEFHELDLLDKPGLEKIFKMHSFYAVMHFAGLKAVGESVEQPLRYYRVNLTGTINLLEVMQSHGVRNLVFSSSATVYGDPQKLPIDEQHPVGGCTNPYGKTKYFIEEMIRDQCTAEKDWNAVLLRYFNPIGAHISGQIGEDPQGIPNNLLPYVAQVAIGRRKHLNVFGNDYSTPDGTGVRDYIHVVDLAKGHIAAVRKLKDSCGCKVYNLGTGTGYSVLQMVSAMEKASGRKIAYQIAPRRSGDVASCYADASLAEKELGWKAEFDLERMCEDLWRWQSQNPTGFS 345          
BLAST of UDP galactose 4 epimerase vs. Ensembl Zebrafish
Match: gale (UDP-galactose-4-epimerase [Source:ZFIN;Acc:ZDB-GENE-060421-6479])

HSP 1 Score: 199.134 bits (505), Expect = 1.037e-62
Identity = 91/136 (66.91%), Postives = 108/136 (79.41%), Query Frame = 2
Query:  656 SGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEM 1063
            SG IGEDP G P NL+P+VAQVA+G+R H+NVFGNDY T DGTGVRDYIHVVDLA+GHI A+ KL   CG K+YNLGTG GYSVL+M++A E+A G KI Y+IAPRR GD+   YAD  LAEKEL WK+ + L+ M
Sbjct:    2 SGQIGEDPQGIPNNLLPYVAQVAIGRRKHLNVFGNDYSTPDGTGVRDYIHVVDLAKGHIAAVRKLKDSCGCKVYNLGTGTGYSVLQMVSAMEKASGRKIAYQIAPRRSGDVASCYADASLAEKELGWKAEFDLERM 137          
BLAST of UDP galactose 4 epimerase vs. Ensembl Xenopus
Match: gale (UDP-galactose-4-epimerase [Source:NCBI gene;Acc:448443])

HSP 1 Score: 432.95 bits (1112), Expect = 3.431e-151
Identity = 210/341 (61.58%), Postives = 249/341 (73.02%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            VLVTGG GYIGSH V+EL  AGY  V+IDN  NA +      E L R++ I      F EVDML+   L  LF+K+KF  V+HFA LKAVGESV  PL YYK N+   + L+EVM  HGVK++VFSSSATVYG P  LPI E   +GGCTNPYGKTK+FIEEM+ D CK +  W  ++LRYFNP+G+H SG IGEDP G P NLMP+V+QVAVG+R  +NVFGNDY T DGTGVRDYIH+VDLA+GHI AL+KL    G K+YNLGTG GYSVLEM+ A E+A G +I Y+IAPRR GD+   YAD  LA+ EL WK+ YGL  MCEDLW WQ +NP G+S
Sbjct:    5 VLVTGGGGYIGSHCVLELLEAGYNPVVIDNFHNAIRGAHNMPESLQRVQDIVGKTIEFEEVDMLDHAALDKLFSKHKFSAVLHFAGLKAVGESVEKPLLYYKVNLTGTIQLLEVMNSHGVKNIVFSSSATVYGDPSYLPIDESHPVGGCTNPYGKTKYFIEEMIKDQCKSEKDWCAILLRYFNPIGAHVSGRIGEDPQGIPNNLMPYVSQVAVGRREFLNVFGNDYNTPDGTGVRDYIHIVDLAKGHIAALKKLEATSGCKVYNLGTGTGYSVLEMVKAMEKASGKEIQYKIAPRREGDIATCYADPALAKAELGWKAEYGLDRMCEDLWRWQSQNPTGFS 345          
BLAST of UDP galactose 4 epimerase vs. Ensembl Xenopus
Match: gale (UDP-galactose-4-epimerase [Source:NCBI gene;Acc:448443])

HSP 1 Score: 403.29 bits (1035), Expect = 1.692e-139
Identity = 202/340 (59.41%), Postives = 241/340 (70.88%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGY 1108
            VLVTGG GYIGSH V+EL  AGY  V+IDN  NA +      E L R++ I      F EVDML+   L  LF+K+KF  V+HFA LKAVGESV  PL YYK N+   + L+EVM  HGVK++VFSSSATVYG P  LPI E   +GGCTNPYGKTK+FIEEM+ D CK +  W  ++LRYFNP+G+H SG IGEDP G P NLMP+V+QVAVG+R  +NVFGNDY T DGTGVRDYIH+VDLA+GHI AL+KL    G K+YNLGTG GYSVLEM+ A E+A G +I Y+IAPRR GD+   YAD  LA+ EL WK+ YGL  M      +   NP G+
Sbjct:    5 VLVTGGGGYIGSHCVLELLEAGYNPVVIDNFHNAIRGAHNMPESLQRVQDIVGKTIEFEEVDMLDHAALDKLFSKHKFSAVLHFAGLKAVGESVEKPLLYYKVNLTGTIQLLEVMNSHGVKNIVFSSSATVYGDPSYLPIDESHPVGGCTNPYGKTKYFIEEMIKDQCKSEKDWCAILLRYFNPIGAHVSGRIGEDPQGIPNNLMPYVSQVAVGRREFLNVFGNDYNTPDGTGVRDYIHIVDLAKGHIAALKKLEATSGCKVYNLGTGTGYSVLEMVKAMEKASGKEIQYKIAPRREGDIATCYADPALAKAELGWKAEYGLDRM------YTLGNPSGH 338          
BLAST of UDP galactose 4 epimerase vs. Ensembl Xenopus
Match: gale (UDP-galactose-4-epimerase [Source:NCBI gene;Acc:448443])

HSP 1 Score: 395.201 bits (1014), Expect = 9.538e-137
Identity = 187/302 (61.92%), Postives = 223/302 (73.84%), Query Frame = 2
Query:  215 ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYSGVS 1120
            E L R++ I      F EVDML+   L  LF+K+KF  V+HFA LKAVGESV  PL YYK N+   + L+EVM  HGVK++VFSSSATVYG P  LPI E   +GGCTNPYGKTK+FIEEM+ D CK +  W  ++LRYFNP+G+H SG IGEDP G P NLMP+V+QVAVG+R  +NVFGNDY T DGTGVRDYIH+VDLA+GHI AL+KL    G K+YNLGTG GYSVLEM+ A E+A G +I Y+IAPRR GD+   YAD  LA+ EL WK+ YGL  MCEDLW WQ +NP G+S  S
Sbjct:   24 ESLQRVQDIVGKTIEFEEVDMLDHAALDKLFSKHKFSAVLHFAGLKAVGESVEKPLLYYKVNLTGTIQLLEVMNSHGVKNIVFSSSATVYGDPSYLPIDESHPVGGCTNPYGKTKYFIEEMIKDQCKSEKDWCAILLRYFNPIGAHVSGRIGEDPQGIPNNLMPYVSQVAVGRREFLNVFGNDYNTPDGTGVRDYIHIVDLAKGHIAALKKLEATSGCKVYNLGTGTGYSVLEMVKAMEKASGKEIQYKIAPRREGDIATCYADPALAKAELGWKAEYGLDRMCEDLWRWQSQNPTGFSTES 325          
BLAST of UDP galactose 4 epimerase vs. Ensembl Xenopus
Match: gale (UDP-galactose-4-epimerase [Source:NCBI gene;Acc:448443])

HSP 1 Score: 360.147 bits (923), Expect = 3.376e-123
Identity = 186/341 (54.55%), Postives = 220/341 (64.52%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            VLVTGG GYIGSH V+EL  AGY  V+IDN  NA +      E L R++ I      F EVDML+   L  LF+K+KF  V+HFA LKAVGESV  PL YYK N+   + L+EVM  HGVK++VFSSSATVYG P  LPI E   +GGCTNPYGKTK+FIEEM+ D CK +                                      +VAVG+R  +NVFGNDY T DGTGVRDYIH+VDLA+GHI AL+KL    G K+YNLGTG GYSVLEM+ A E+A G +I Y+IAPRR GD+   YAD  LA+ EL WK+ YGL  MCEDLW WQ +NP G+S
Sbjct:    5 VLVTGGGGYIGSHCVLELLEAGYNPVVIDNFHNAIRGAHNMPESLQRVQDIVGKTIEFEEVDMLDHAALDKLFSKHKFSAVLHFAGLKAVGESVEKPLLYYKVNLTGTIQLLEVMNSHGVKNIVFSSSATVYGDPSYLPIDESHPVGGCTNPYGKTKYFIEEMIKDQCKSE--------------------------------------KVAVGRREFLNVFGNDYNTPDGTGVRDYIHIVDLAKGHIAALKKLEATSGCKVYNLGTGTGYSVLEMVKAMEKASGKEIQYKIAPRREGDIATCYADPALAKAELGWKAEYGLDRMCEDLWRWQSQNPTGFS 307          
BLAST of UDP galactose 4 epimerase vs. Ensembl Xenopus
Match: gale (UDP-galactose-4-epimerase [Source:NCBI gene;Acc:448443])

HSP 1 Score: 358.992 bits (920), Expect = 2.086e-122
Identity = 177/288 (61.46%), Postives = 211/288 (73.26%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKI 952
            VLVTGG GYIGSH V+EL  AGY  V+IDN  NA +      E L R++ I      F EVDML+   L  LF+K+KF  V+HFA LKAVGESV  PL YYK N+   + L+EVM  HGVK++VFSSSATVYG P  LPI E   +GGCTNPYGKTK+FIEEM+ D CK +  W  ++LRYFNP+G+H SG IGEDP G P NLMP+V+QVAVG+R  +NVFGNDY T DGTGVRDYIH+VDLA+GHI AL+KL    G K+YNLGTG GYSVLEM+ A E+A G ++
Sbjct:    5 VLVTGGGGYIGSHCVLELLEAGYNPVVIDNFHNAIRGAHNMPESLQRVQDIVGKTIEFEEVDMLDHAALDKLFSKHKFSAVLHFAGLKAVGESVEKPLLYYKVNLTGTIQLLEVMNSHGVKNIVFSSSATVYGDPSYLPIDESHPVGGCTNPYGKTKYFIEEMIKDQCKSEKDWCAILLRYFNPIGAHVSGRIGEDPQGIPNNLMPYVSQVAVGRREFLNVFGNDYNTPDGTGVRDYIHIVDLAKGHIAALKKLEATSGCKVYNLGTGTGYSVLEMVKAMEKASGKEV 292          
BLAST of UDP galactose 4 epimerase vs. Ensembl Mouse
Match: Gale (galactose-4-epimerase, UDP [Source:MGI Symbol;Acc:MGI:1921496])

HSP 1 Score: 436.417 bits (1121), Expect = 9.368e-153
Identity = 201/340 (59.12%), Postives = 252/340 (74.12%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGY 1108
            VLVTGG GYIGSHTV+EL  AGY  V+IDN  NA +      E L R++++T     F E+D+L++  L  LF K+ F  VIHFA LKAVGESV  PL YY+ N+   + L+E+M  HGVK+LVFSSSATVYG P+ LP+ E    GGCTNPYGK+K+FIEEM+ D+C+ DT W+ V+LRYFNP+G+H SG IGEDP G P NLMP+V+QVA+G+R  +NVFG+DY T DGTGVRDYIHVVDLA+GHI AL+KL  +CG + YNLGTG GYSVL+M+ A E+A G KIPY++  RR GD+   YA+  LA +EL W +  GL  MCEDLW WQ++NP G+
Sbjct:    4 VLVTGGAGYIGSHTVLELLEAGYSPVVIDNFHNAIRGEDSMPESLRRVQELTGRSVEFEEMDILDQAALQHLFKKHSFKAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMRAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCRADTAWNAVLLRYFNPIGAHASGRIGEDPQGIPNNLMPYVSQVAIGRREALNVFGDDYATEDGTGVRDYIHVVDLAKGHIAALKKLKEQCGCRTYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAHEELGWTAALGLDRMCEDLWRWQKQNPSGF 343          
BLAST of UDP galactose 4 epimerase vs. Ensembl Mouse
Match: Gale (galactose-4-epimerase, UDP [Source:MGI Symbol;Acc:MGI:1921496])

HSP 1 Score: 436.417 bits (1121), Expect = 9.368e-153
Identity = 201/340 (59.12%), Postives = 252/340 (74.12%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGY 1108
            VLVTGG GYIGSHTV+EL  AGY  V+IDN  NA +      E L R++++T     F E+D+L++  L  LF K+ F  VIHFA LKAVGESV  PL YY+ N+   + L+E+M  HGVK+LVFSSSATVYG P+ LP+ E    GGCTNPYGK+K+FIEEM+ D+C+ DT W+ V+LRYFNP+G+H SG IGEDP G P NLMP+V+QVA+G+R  +NVFG+DY T DGTGVRDYIHVVDLA+GHI AL+KL  +CG + YNLGTG GYSVL+M+ A E+A G KIPY++  RR GD+   YA+  LA +EL W +  GL  MCEDLW WQ++NP G+
Sbjct:    4 VLVTGGAGYIGSHTVLELLEAGYSPVVIDNFHNAIRGEDSMPESLRRVQELTGRSVEFEEMDILDQAALQHLFKKHSFKAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMRAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCRADTAWNAVLLRYFNPIGAHASGRIGEDPQGIPNNLMPYVSQVAIGRREALNVFGDDYATEDGTGVRDYIHVVDLAKGHIAALKKLKEQCGCRTYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAHEELGWTAALGLDRMCEDLWRWQKQNPSGF 343          
BLAST of UDP galactose 4 epimerase vs. Ensembl Mouse
Match: Uxs1 (UDP-glucuronate decarboxylase 1 [Source:MGI Symbol;Acc:MGI:1915133])

HSP 1 Score: 73.559 bits (179), Expect = 7.808e-14
Identity = 79/332 (23.80%), Postives = 138/332 (41.57%), Query Frame = 2
Query:   83 LMSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNP------YGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKE 1060
            L  K ++ +L+TGG G++GSH   +L   G+EV ++DN     K  +       ++       +++N   +  L+   +   + H A+  +    +  P+K  K N I  LN++ +    G + L+ +S++ VYG P+  P +E     G  NP      Y + K   E M +   K +    V + R FN  G       G         +  F+ Q   G+   + V+G+      G+  R + +V DL  G + AL   N    +   NLG    +++LE     +   G     +       D  +   D K A+  L W+ +  L+E
Sbjct:   83 LSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNV-------EHWIGHENFELINHDVVEPLY--IEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGAR-LLLASTSEVYGDPEVHPQSE--DYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGV-EVRVARIFNTFGPRMHMNDGRV-------VSNFILQALQGE--PLTVYGS------GSQTRAFQYVSDLVNGLV-ALMNSNVSSPV---NLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEE 382          
BLAST of UDP galactose 4 epimerase vs. Ensembl Mouse
Match: Tgds (TDP-glucose 4,6-dehydratase [Source:MGI Symbol;Acc:MGI:1923605])

HSP 1 Score: 71.2478 bits (173), Expect = 3.726e-13
Identity = 74/281 (26.33%), Postives = 123/281 (43.77%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFT--AGYEVVIIDNL--CNANKECLNRIEKIT-KNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWS-----VVILRYFNPVGSHKSGMIGEDPLGPPANLMP-FVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEM 916
            VLVTGG G+I SH ++ L      Y +V +D L  C +    L  +E ++ K  + F + D+ +   +  LF   K   V+HFAA   V  S     ++   N+     L+    + GV+  ++ S+  VYG        E  S    TNPY  +K   E      C V + W      VVI R  N  G H+           P  ++P F++ +   ++  ++          G   R++++  D+ +  +  L K  G+ G +IYN+GT    SV+++
Sbjct:   20 VLVTGGAGFIASHVIVSLVEDYPDYMIVNLDKLDYCAS----LKNLEPVSNKQNYKFIQGDICDSHFVKLLFEVEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVNAAYEAGVEKFIYVSTDEVYGGSLDQEFDE-SSPKQPTNPYASSKAAAE------CFVQSYWERYKFPVVITRSSNVYGPHQY----------PEKVIPKFISLLQHNRKCCIH--------GSGLQRRNFLYAADVVEAFLTVLTK--GEPG-EIYNIGTNFEMSVVQL 268          
BLAST of UDP galactose 4 epimerase vs. Ensembl Mouse
Match: Tgds (TDP-glucose 4,6-dehydratase [Source:MGI Symbol;Acc:MGI:1923605])

HSP 1 Score: 70.4774 bits (171), Expect = 6.981e-13
Identity = 74/281 (26.33%), Postives = 123/281 (43.77%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFT--AGYEVVIIDNL--CNANKECLNRIEKIT-KNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWS-----VVILRYFNPVGSHKSGMIGEDPLGPPANLMP-FVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEM 916
            VLVTGG G+I SH ++ L      Y +V +D L  C +    L  +E ++ K  + F + D+ +   +  LF   K   V+HFAA   V  S     ++   N+     L+    + GV+  ++ S+  VYG        E  S    TNPY  +K   E      C V + W      VVI R  N  G H+           P  ++P F++ +   ++  ++          G   R++++  D+ +  +  L K  G+ G +IYN+GT    SV+++
Sbjct:   20 VLVTGGAGFIASHVIVSLVEDYPDYMIVNLDKLDYCAS----LKNLEPVSNKQNYKFIQGDICDSHFVKLLFEVEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVNAAYEAGVEKFIYVSTDEVYGGSLDQEFDE-SSPKQPTNPYASSKAAAE------CFVQSYWERYKFPVVITRSSNVYGPHQY----------PEKVIPKFISLLQHNRKCCIH--------GSGLQRRNFLYAADVVEAFLTVLTK--GEPG-EIYNIGTNFEMSVVQL 268          
BLAST of UDP galactose 4 epimerase vs. UniProt/SwissProt
Match: sp|Q14376|GALE_HUMAN (UDP-glucose 4-epimerase OS=Homo sapiens OX=9606 GN=GALE PE=1 SV=2)

HSP 1 Score: 437.958 bits (1125), Expect = 1.536e-152
Identity = 204/340 (60.00%), Postives = 252/340 (74.12%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGY 1108
            VLVTGG GYIGSHTV+EL  AGY  V+IDN  NA +      E L R++++T     F E+D+L++  L  LF KY F  VIHFA LKAVGESV  PL YY+ N+   + L+E+M  HGVK+LVFSSSATVYG P+ LP+ E    GGCTNPYGK+K+FIEEM+ D+C+ D TW+ V+LRYFNP G+H SG IGEDP G P NLMP+V+QVA+G+R  +NVFGNDY T DGTGVRDYIHVVDLA+GHI AL KL  +CG +IYNLGTG GYSVL+M+ A E+A G KIPY++  RR GD+   YA+  LA++EL W +  GL  MCEDLW WQ++NP G+
Sbjct:    5 VLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGF 344          
BLAST of UDP galactose 4 epimerase vs. UniProt/SwissProt
Match: sp|Q8R059|GALE_MOUSE (UDP-glucose 4-epimerase OS=Mus musculus OX=10090 GN=Gale PE=1 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 6.553e-152
Identity = 201/340 (59.12%), Postives = 252/340 (74.12%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGY 1108
            VLVTGG GYIGSHTV+EL  AGY  V+IDN  NA +      E L R++++T     F E+D+L++  L  LF K+ F  VIHFA LKAVGESV  PL YY+ N+   + L+E+M  HGVK+LVFSSSATVYG P+ LP+ E    GGCTNPYGK+K+FIEEM+ D+C+ DT W+ V+LRYFNP+G+H SG IGEDP G P NLMP+V+QVA+G+R  +NVFG+DY T DGTGVRDYIHVVDLA+GHI AL+KL  +CG + YNLGTG GYSVL+M+ A E+A G KIPY++  RR GD+   YA+  LA +EL W +  GL  MCEDLW WQ++NP G+
Sbjct:    4 VLVTGGAGYIGSHTVLELLEAGYSPVVIDNFHNAIRGEDSMPESLRRVQELTGRSVEFEEMDILDQAALQHLFKKHSFKAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMRAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCRADTAWNAVLLRYFNPIGAHASGRIGEDPQGIPNNLMPYVSQVAIGRREALNVFGDDYATEDGTGVRDYIHVVDLAKGHIAALKKLKEQCGCRTYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAHEELGWTAALGLDRMCEDLWRWQKQNPSGF 343          
BLAST of UDP galactose 4 epimerase vs. UniProt/SwissProt
Match: sp|Q5R8D0|GALE_PONAB (UDP-glucose 4-epimerase OS=Pongo abelii OX=9601 GN=GALE PE=2 SV=1)

HSP 1 Score: 434.876 bits (1117), Expect = 2.870e-151
Identity = 203/340 (59.71%), Postives = 251/340 (73.82%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGY 1108
            VLVTGG GYIGSHTV+EL  AGY  V+IDN  NA +      E L R++++T     F E+D+L++  L  LF K+ F  VIHFA LKAVGESV  PL YY+ N+   + L+E+M  HGVK+LVFSSSATVYG P+ LP+ E    GGCTNPYGK+K+FIEEM+ D+C+ D TW+ V+LRYFNP G+H SG IGEDP G P NLMP+V+QVA+G+R  +NVFGNDY T DGTGVRDYIHVVDLA+GHI AL KL  +CG +IYNLGTG GYSVL+M+ A E+A G KIPY++  RR GD+   YA+  LA +EL W +  GL  MCEDLW WQ++NP G+
Sbjct:    5 VLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKHSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAHEELGWTAALGLDRMCEDLWRWQKQNPSGF 344          
BLAST of UDP galactose 4 epimerase vs. UniProt/SwissProt
Match: sp|Q3T105|GALE_BOVIN (UDP-glucose 4-epimerase OS=Bos taurus OX=9913 GN=GALE PE=2 SV=2)

HSP 1 Score: 434.491 bits (1116), Expect = 4.346e-151
Identity = 202/340 (59.41%), Postives = 250/340 (73.53%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGY 1108
            VLVTGG GYIGSHTV+EL  AGY  ++IDN  NA +      E L R++ +T     F E+D+L++  L  LF K+ F  VIHFA LKAVGESV  PL YY+ N+   + L+E+M  HGVK+LVFSSSATVYG P+ LP+ E    GGCTNPYGK+K+FIEEM+ D+C+ D  W+ V+LRYFNP+G+H SG IGEDP G P NLMP+V+QVA+G+R  +NVFGNDY T DGTGVRDYIHVVDLA+GHI AL KL  +CG +IYNLGTG GYSVL+M+ A E+A G KIPY++  RR GD+   YA+  LA KEL W +  GL  MCEDLW WQ++NP G+
Sbjct:    5 VLVTGGAGYIGSHTVLELLEAGYSPMVIDNFHNAIRGGGSMPESLRRVQDLTGRSVEFEEMDILDQAALQRLFKKHSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMRAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKAWNAVLLRYFNPIGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREVLNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLALKELGWSAALGLDRMCEDLWRWQKQNPSGF 344          
BLAST of UDP galactose 4 epimerase vs. UniProt/SwissProt
Match: sp|Q9SN58|UGE5_ARATH (UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana OX=3702 GN=UGE5 PE=1 SV=3)

HSP 1 Score: 421.394 bits (1082), Expect = 5.606e-146
Identity = 205/343 (59.77%), Postives = 252/343 (73.47%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKN---KFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKL-NGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYSGVSK 1123
            VLV+GG GYIGSHTV++L   GY VV++DNL N++   L R++K+      + +FH+VD+ ++  L  +F++ KF  VIHFA LKAVGESV  PL YY NN++  + L+EVMA HG K+LVFSSSATVYG+PK++P TE   I    NPYG+TK FIEE+  D+   D  W +++LRYFNPVG+H SG IGEDP G P NLMPFV QVAVG+RPH+ VFGNDY T DGTGVRDYIHV+DLA GHI AL KL + K G ++YNLGTG G SVLEM+ AFE+A G KIP  IA RRPGD   VYA T+ AE ELNWK+ YG++EMC DLWNW   NP GY   S+
Sbjct:    6 VLVSGGAGYIGSHTVLQLLLGGYSVVVVDNLDNSSAVSLQRVKKLAAEHGERLSFHQVDLRDRSALEKIFSETKFDAVIHFAGLKAVGESVEKPLLYYNNNLVGTITLLEVMAQHGCKNLVFSSSATVYGSPKEVPCTEEFPISAL-NPYGRTKLFIEEICRDVYGSDPEWKIILLRYFNPVGAHPSGDIGEDPRGIPNNLMPFVQQVAVGRRPHLTVFGNDYNTKDGTGVRDYIHVIDLADGHIAALRKLEDCKIGCEVYNLGTGNGTSVLEMVDAFEKASGKKIPLVIAGRRPGDAEVVYASTERAESELNWKAKYGIEEMCRDLWNWASNNPYGYDSSSE 347          
BLAST of UDP galactose 4 epimerase vs. TrEMBL
Match: I1ZIA2 (UDP-glucose 4-epimerase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 346/346 (100.00%), Postives = 346/346 (100.00%), Query Frame = 2
Query:   86 MSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYSGVSK 1123
            MSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYSGVSK
Sbjct:    1 MSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYSGVSK 346          
BLAST of UDP galactose 4 epimerase vs. TrEMBL
Match: A0A5N5N419 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00012280 PE=4 SV=1)

HSP 1 Score: 457.988 bits (1177), Expect = 1.398e-157
Identity = 215/360 (59.72%), Postives = 266/360 (73.89%), Query Frame = 2
Query:   50 FYFLIF*LLNALMSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            F F  F    ++ +   Q VLVTGG GYIGSH V+EL  AGY+ V+IDN  NA +      E L RIEK    K  F E+D+L+K  L  LFN++ F+ V+HFA LKAVGESV  PL+YY+ N+   +NL+EVM  HGV ++VFSSSATVYG P+KLPI E    GGCTNPYGK+K+FIEEM+ D C  +  W+ V+LRYFNP+G+H SG IGEDP G P NL+P+VAQVA+G+R H+NVFGNDY T DGTGVRDYIHVVDLA+GHI AL+KL   CG K+YNLGTG GYSVL+M+ A E+A G +I YEIAPRR GD+   YAD +LAE+EL WK+ +GL+ MCEDLW WQ +NP G++
Sbjct:   10 FTFEKFFSFKSVAASMAQKVLVTGGAGYIGSHCVVELIEAGYQPVVIDNFSNAVRGEKNVPESLRRIEKFLNTKIEFQELDLLDKPGLEKLFNQHSFYAVMHFAGLKAVGESVEQPLRYYRVNLTGTINLLEVMQAHGVHNIVFSSSATVYGDPQKLPIDEQHPAGGCTNPYGKSKFFIEEMIQDQCNAEKDWNAVLLRYFNPIGAHISGQIGEDPQGIPNNLLPYVAQVAIGRRKHLNVFGNDYKTIDGTGVRDYIHVVDLAKGHIAALKKLKDNCGCKVYNLGTGTGYSVLQMVKAMEKASGREIAYEIAPRRSGDIASCYADPRLAEEELGWKADFGLERMCEDLWRWQSQNPTGFT 369          
BLAST of UDP galactose 4 epimerase vs. TrEMBL
Match: A7RFA6 (UDP-glucose 4-epimerase OS=Nematostella vectensis OX=45351 GN=v1g237812 PE=3 SV=1)

HSP 1 Score: 454.907 bits (1169), Expect = 1.005e-156
Identity = 217/342 (63.45%), Postives = 260/342 (76.02%), Query Frame = 2
Query:   83 LMSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGY 1108
            +MSK    VLVTGG GYIGSH V+E+  AGYEVVIIDNL N++ EC+ R+E+I+  K  F   D+LNK+ L D+F K+KF+ V+HFA LKAVGESV +PL+YY NN+   L+L+E M  HGV +LVFSSSATVYG P+ LPITE    GGCTNPYGKTK+FIEEML D+C  +  +++V LRYFNPVG+HKSG IGEDP   P NL+P++ QVAVGKRPH+NVFG DY T DGTGVRDYIHVVDLA GH+ AL+K+  KCG K+YNLGTGRGYSVLEM+ A E+A G +IPY+   RR GD+   YAD  LA KELNWK+     EMCED W WQ  NP GY
Sbjct:    2 VMSKK---VLVTGGAGYIGSHCVVEILNAGYEVVIIDNLSNSDAECVRRVEEISGKKVPFFIEDLLNKEALDDIFKKHKFNGVLHFAGLKAVGESVQIPLRYYHNNLTGTLHLLECMKKHGVHNLVFSSSATVYGDPQFLPITESHPAGGCTNPYGKTKYFIEEMLKDLCYAEKEFNIVSLRYFNPVGAHKSGKIGEDPKDIPNNLLPYITQVAVGKRPHLNVFGKDYDTPDGTGVRDYIHVVDLAMGHVAALKKVEEKCGWKVYNLGTGRGYSVLEMVKAVEKASGKEIPYKFTDRRAGDIASCYADPSLAAKELNWKATRAQNEMCEDSWRWQANNPNGY 340          
BLAST of UDP galactose 4 epimerase vs. TrEMBL
Match: A0A3B1IK01 (UDP-glucose 4-epimerase OS=Astyanax mexicanus OX=7994 PE=3 SV=1)

HSP 1 Score: 454.907 bits (1169), Expect = 1.368e-156
Identity = 216/343 (62.97%), Postives = 260/343 (75.80%), Query Frame = 2
Query:  101 QIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            Q VLVTGG GYIGSH V+EL  AGY+ V+IDN  NA +      E L RIEK    K  FHE+D+L+K  L  +F K+ F+ V+HFA LKAVGESV  PL+YY+ N+   +NL+EVM  HGV +LVFSSSATVYG P+KLPI E    GGCTNPYGKTK+FIEEM+ D C  +  W+ V+LRYFNP+G+H SG IGEDP G P NL+P+VAQVA+G+R H+NVFGNDY T DGTGVRDYIHVVDLA+GHI AL KLN  CG K+YNLGTG GYSVL+M+ A E+A G++I Y+IAPRR GD+   YAD  LAEKEL WK+ +GL+ MCEDLW WQ +NP G+S
Sbjct:    3 QKVLVTGGGGYIGSHCVVELIEAGYQPVVIDNFSNAVRGEGDVPESLKRIEKFLDTKIEFHELDLLDKPGLEKIFKKHSFYAVMHFAGLKAVGESVEQPLRYYRVNLTGTINLLEVMQAHGVHNLVFSSSATVYGDPQKLPIDEQHPAGGCTNPYGKTKFFIEEMIRDQCSAEKDWNAVLLRYFNPIGAHISGQIGEDPQGIPNNLLPYVAQVAIGRRKHLNVFGNDYNTVDGTGVRDYIHVVDLAKGHIAALRKLNDNCGCKVYNLGTGTGYSVLQMVKAMEKASGNEIAYKIAPRRNGDIASCYADPSLAEKELGWKADFGLERMCEDLWRWQSQNPTGFS 345          
BLAST of UDP galactose 4 epimerase vs. TrEMBL
Match: A0A210QTE1 (UDP-glucose 4-epimerase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09002 PE=3 SV=1)

HSP 1 Score: 454.521 bits (1168), Expect = 1.415e-156
Identity = 210/338 (62.13%), Postives = 262/338 (77.51%), Query Frame = 2
Query:   95 SKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGY 1108
            S   VLVTGG G++GSH+V+EL  AGY VV +DNL NA+ E + R+E IT  K    +VD+L+K  L DLF ++KF  VIHFA LKAVGES  LPL YYK N+   +NL+EVM ++ +K+L+FSSSATVYGTP+ LP+ E   IGGCT+PYGKTK+FIEE+L D+ K DT W++V+LRYFNPVG+HKSG IGEDP GPP NLMP++AQ AVGKR  ++++G+DY T DGTGVRDYIHVVDLA GH+ A +KL+ KCG K+YNLGTG+G SVL+M+ AFE+A G  +PY++ PRR GD+   YAD  LAEKEL WK+  GL EMCEDLW WQ +NP GY
Sbjct:    2 SAGCVLVTGGAGFVGSHSVVELVKAGYSVVALDNLVNASMESMKRVEMITGQKVPACKVDLLDKAALQDLFKQHKFTSVIHFAGLKAVGESCELPLLYYKTNVGGTMNLLEVMKENNLKNLIFSSSATVYGTPQYLPLDEQHPIGGCTSPYGKTKYFIEEILCDLAKSDTEWNIVLLRYFNPVGAHKSGTIGEDPQGPPNNLMPYIAQTAVGKRKELSIYGSDYDTPDGTGVRDYIHVVDLAVGHVAAQKKLDEKCGCKLYNLGTGKGLSVLDMLKAFEKASGKSVPYKLCPRREGDVASCYADAALAEKELGWKATRGLDEMCEDLWRWQSQNPNGY 339          
BLAST of UDP galactose 4 epimerase vs. Ensembl Cavefish
Match: gale (UDP-galactose-4-epimerase [Source:NCBI gene;Acc:103047842])

HSP 1 Score: 454.907 bits (1169), Expect = 5.182e-160
Identity = 216/343 (62.97%), Postives = 260/343 (75.80%), Query Frame = 2
Query:  101 QIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANK------ECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            Q VLVTGG GYIGSH V+EL  AGY+ V+IDN  NA +      E L RIEK    K  FHE+D+L+K  L  +F K+ F+ V+HFA LKAVGESV  PL+YY+ N+   +NL+EVM  HGV +LVFSSSATVYG P+KLPI E    GGCTNPYGKTK+FIEEM+ D C  +  W+ V+LRYFNP+G+H SG IGEDP G P NL+P+VAQVA+G+R H+NVFGNDY T DGTGVRDYIHVVDLA+GHI AL KLN  CG K+YNLGTG GYSVL+M+ A E+A G++I Y+IAPRR GD+   YAD  LAEKEL WK+ +GL+ MCEDLW WQ +NP G+S
Sbjct:    3 QKVLVTGGGGYIGSHCVVELIEAGYQPVVIDNFSNAVRGEGDVPESLKRIEKFLDTKIEFHELDLLDKPGLEKIFKKHSFYAVMHFAGLKAVGESVEQPLRYYRVNLTGTINLLEVMQAHGVHNLVFSSSATVYGDPQKLPIDEQHPAGGCTNPYGKTKFFIEEMIRDQCSAEKDWNAVLLRYFNPIGAHISGQIGEDPQGIPNNLLPYVAQVAIGRRKHLNVFGNDYNTVDGTGVRDYIHVVDLAKGHIAALRKLNDNCGCKVYNLGTGTGYSVLQMVKAMEKASGNEIAYKIAPRRNGDIASCYADPSLAEKELGWKADFGLERMCEDLWRWQSQNPTGFS 345          
BLAST of UDP galactose 4 epimerase vs. Ensembl Cavefish
Match: gale (UDP-galactose-4-epimerase [Source:NCBI gene;Acc:103047842])

HSP 1 Score: 454.521 bits (1168), Expect = 1.258e-159
Identity = 216/346 (62.43%), Postives = 262/346 (75.72%), Query Frame = 2
Query:   89 SKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKE-----CLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            ++  Q VLVTGG GYIGSH V+EL  AGY+ V+IDN  NA +E      L RIEK    K  FHE+D+L+K  L  +F K+ F+ V+HFA LKAVGESV  PL+YY+ N+   +NL+EVM  HGV +LVFSSSATVYG P+KLPI E    GGCTNPYGKTK+FIEEM+ D C  +  W+ V+LRYFNP+G+H SG IGEDP G P NL+P+VAQVA+G+R H+NVFGNDY T DGTGVRDYIHVVDLA+GHI AL KLN  CG K+YNLGTG GYSVL+M+ A E+A G++I Y+IAPRR GD+   YAD  LAEKEL WK+ +GL+ MCEDLW WQ +NP G+S
Sbjct:   23 ARMVQKVLVTGGGGYIGSHCVVELIEAGYQPVVIDNFSNAVREGDVPESLKRIEKFLDTKIEFHELDLLDKPGLEKIFKKHSFYAVMHFAGLKAVGESVEQPLRYYRVNLTGTINLLEVMQAHGVHNLVFSSSATVYGDPQKLPIDEQHPAGGCTNPYGKTKFFIEEMIRDQCSAEKDWNAVLLRYFNPIGAHISGQIGEDPQGIPNNLLPYVAQVAIGRRKHLNVFGNDYNTVDGTGVRDYIHVVDLAKGHIAALRKLNDNCGCKVYNLGTGTGYSVLQMVKAMEKASGNEIAYKIAPRRNGDIASCYADPSLAEKELGWKADFGLERMCEDLWRWQSQNPTGFS 368          
BLAST of UDP galactose 4 epimerase vs. Ensembl Cavefish
Match: gale (UDP-galactose-4-epimerase [Source:NCBI gene;Acc:103047842])

HSP 1 Score: 343.969 bits (881), Expect = 5.367e-116
Identity = 168/268 (62.69%), Postives = 200/268 (74.63%), Query Frame = 2
Query:  101 QIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKE-----CLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGT 889
            Q VLVTGG GYIGSH V+EL  AGY+ V+IDN  NA +E      L RIEK    K  FHE+D+L+K  L  +F K+ F+ V+HFA LKAVGESV  PL+YY+ N+   +NL+EVM  HGV +LVFSSSATVYG P+KLPI E    GGCTNPYGKTK+FIEEM+ D C  +  W+ V+LRYFNP+G+H SG IGEDP G P NL+P+VAQVA+G+R H+NVFGNDY T DGTGVRDYIHVVDLA+GHI AL KLN  CG K+  L T
Sbjct:    3 QKVLVTGGGGYIGSHCVVELIEAGYQPVVIDNFSNAVREGDVPESLKRIEKFLDTKIEFHELDLLDKPGLEKIFKKHSFYAVMHFAGLKAVGESVEQPLRYYRVNLTGTINLLEVMQAHGVHNLVFSSSATVYGDPQKLPIDEQHPAGGCTNPYGKTKFFIEEMIRDQCSAEKDWNAVLLRYFNPIGAHISGQIGEDPQGIPNNLLPYVAQVAIGRRKHLNVFGNDYNTVDGTGVRDYIHVVDLAKGHIAALRKLNDNCGCKVRFLFT 270          
BLAST of UDP galactose 4 epimerase vs. Ensembl Cavefish
Match: uxs1 (UDP-glucuronate decarboxylase 1 [Source:NCBI gene;Acc:103039696])

HSP 1 Score: 79.7221 bits (195), Expect = 6.271e-16
Identity = 78/332 (23.49%), Postives = 138/332 (41.57%), Query Frame = 2
Query:   83 LMSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNP------YGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKE 1060
            L  K ++ +L+TGG G++GSH   +L   G+EV ++DN     K  +       ++       +++N   +  L+   +   + H A+  +    +  P+K  K N I  LN++ +    G + L+ +S++ VYG P+  P  E     G  NP      Y + K   E M +   K +    V + R FN  GS      G         +  F+ Q   G+   + V+G+      G+  R + +V DL  G +     +N      + NLG    +++LE     +   G +   +  P    D      D + A+  L W+ +  L+E
Sbjct:   68 LSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNV-------EHWIGHENFELINHDVVEPLY--IEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGAR-LLLASTSEVYGDPEVHPQNE--DYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGV-EVRVARIFNTFGSRMHMNDGR-------VVSNFILQALQGE--PLTVYGS------GSQTRAFQYVSDLVNGLVSL---MNSNVSSPV-NLGNPEEHTILEFAQLIKSLVGSRSYIQFLPEAQDDPQRRRPDIRKAKMLLGWEPVVPLEE 367          
BLAST of UDP galactose 4 epimerase vs. Ensembl Cavefish
Match: uxs1 (UDP-glucuronate decarboxylase 1 [Source:NCBI gene;Acc:103039696])

HSP 1 Score: 76.2554 bits (186), Expect = 7.058e-15
Identity = 76/327 (23.24%), Postives = 135/327 (41.28%), Query Frame = 2
Query:   83 LMSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNP------YGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSI 1045
            L  K ++ +L+TGG G++GSH   +L   G+EV ++DN     K  +       ++       +++N   +  L+   +   + H A+  +    +  P+K  K N I  LN++ +    G + L+ +S++ VYG P+  P  E     G  NP      Y + K   E M +   K +    V + R FN  GS      G         +  F+ Q   G+   + V+G+      G+  R + +V DL  G +     +N      + NLG    +++LE     +   G +   +  P    D      D + A+  L W+ +
Sbjct:   81 LSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNV-------EHWIGHENFELINHDVVEPLY--IEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGAR-LLLASTSEVYGDPEVHPQNE--DYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGV-EVRVARIFNTFGSRMHMNDGR-------VVSNFILQALQGE--PLTVYGS------GSQTRAFQYVSDLVNGLVSL---MNSNVSSPV-NLGNPEEHTILEFAQLIKSLVGSRSYIQFLPEAQDDPQRRRPDIRKAKMLLGWEPV 375          
BLAST of UDP galactose 4 epimerase vs. Ensembl Yeast
Match: GAL10 (UDP-glucose-4-epimerase; catalyzes interconversion of UDP-galactose and UDP-D-glucose in galactose metabolism; also catalyzes conversion of alpha-D-glucose or alpha-D-galactose to their beta-anomers; human homolog GALE implicated in galactosemia, can complement yeast null mutant [Source:SGD;Acc:S000000223])

HSP 1 Score: 346.665 bits (888), Expect = 7.330e-114
Identity = 177/353 (50.14%), Postives = 242/353 (68.56%), Query Frame = 2
Query:   83 LMSKS-KQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGT----PKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVD-TTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKL---NGKCGL-KIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            L S+S  +IVLVTGG GYIGSHTV+EL   GY+ V+ DNL N+  + + R+E +TK+   F+EVD+ ++K L  +F +YK   VIHFA LKAVGES  +PL+YY NNI+  + L+E+M  + V   VFSSSATVYG     P  +PI E   + G TNPYG TK+ IE +L D+   D  +W   ILRYFNP+G+H SG+IGEDPLG P NL+P++AQVAVG+R  + +FG+DY + DGT +RDYIHVVDLA+GHI AL+ L   N   GL + +NLG+G+G +V E+  AF +A G  +PY++  RR GD+  + A    A++EL W++   +++ C+DLW W  +NP GY 
Sbjct:    5 LQSESTSKIVLVTGGAGYIGSHTVVELIENGYDCVVADNLSNSTYDSVARLEVLTKHHIPFYEVDLCDRKGLEKVFKEYKIDSVIHFAGLKAVGESTQIPLRYYHNNILGTVVLLELMQQYNVSKFVFSSSATVYGDATRFPNMIPIPEECPL-GPTNPYGHTKYAIENILNDLYNSDKKSWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLPYMAQVAVGRREKLYIFGDDYDSRDGTPIRDYIHVVDLAKGHIAALQYLEAYNENEGLCREWNLGSGKGSTVFEVYHAFCKASGIDLPYKVTGRRAGDVLNLTAKPDRAKRELKWQTELQVEDSCKDLWKWTTENPFGYQ 356          
BLAST of UDP galactose 4 epimerase vs. Ensembl Yeast
Match: ERG26 (C-3 sterol dehydrogenase; catalyzes the second of three steps required to remove two C-4 methyl groups from an intermediate in ergosterol biosynthesis; human homolog NSDHL implicated in CK syndrome, and can complement yeast null mutant; molecular target of natural product and antifungal compound FR171456 [Source:SGD;Acc:S000002969])

HSP 1 Score: 50.447 bits (119), Expect = 2.364e-7
Identity = 60/255 (23.53%), Postives = 107/255 (41.96%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSA-------TVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKL 850
            VL+ GG G++G H + + F    +  I         E L++      +   FH+ D+ +  D+ +  N+ K + V+H A+    G++   P  Y   N+    N+I++    GV  LV++SSA        V+   +  PI E+       + Y +TK   E+M+       + +  V LR   P G    G            L+P + QVA        +  + +   D   + D+ +  ++A  H+ A +KL
Sbjct:    7 VLIIGGSGFLGLHLIQQFFDINPKPDIHIFDVRDLPEKLSKQFTFNVDDIKFHKGDLTSPDDMENAINESKANVVVHCAS-PMHGQN---PDIYDIVNVKGTRNVIDMCKKCGVNILVYTSSAGVIFNGQDVHNADETWPIPEVP-----MDAYNETKAIAEDMVLKANDPSSDFYTVALR---PAGIFGPG---------DRQLVPGLRQVA-------KLGQSKFQIGDNNNLFDWTYAGNVADAHVLAAQKL 233          
BLAST of UDP galactose 4 epimerase vs. Ensembl Nematostella
Match: EDO49922 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFA6])

HSP 1 Score: 454.907 bits (1169), Expect = 1.390e-160
Identity = 217/342 (63.45%), Postives = 260/342 (76.02%), Query Frame = 2
Query:   83 LMSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGY 1108
            +MSK    VLVTGG GYIGSH V+E+  AGYEVVIIDNL N++ EC+ R+E+I+  K  F   D+LNK+ L D+F K+KF+ V+HFA LKAVGESV +PL+YY NN+   L+L+E M  HGV +LVFSSSATVYG P+ LPITE    GGCTNPYGKTK+FIEEML D+C  +  +++V LRYFNPVG+HKSG IGEDP   P NL+P++ QVAVGKRPH+NVFG DY T DGTGVRDYIHVVDLA GH+ AL+K+  KCG K+YNLGTGRGYSVLEM+ A E+A G +IPY+   RR GD+   YAD  LA KELNWK+     EMCED W WQ  NP GY
Sbjct:    2 VMSKK---VLVTGGAGYIGSHCVVEILNAGYEVVIIDNLSNSDAECVRRVEEISGKKVPFFIEDLLNKEALDDIFKKHKFNGVLHFAGLKAVGESVQIPLRYYHNNLTGTLHLLECMKKHGVHNLVFSSSATVYGDPQFLPITESHPAGGCTNPYGKTKYFIEEMLKDLCYAEKEFNIVSLRYFNPVGAHKSGKIGEDPKDIPNNLLPYITQVAVGKRPHLNVFGKDYDTPDGTGVRDYIHVVDLAMGHVAALKKVEEKCGWKVYNLGTGRGYSVLEMVKAVEKASGKEIPYKFTDRRAGDIASCYADPSLAAKELNWKATRAQNEMCEDSWRWQANNPNGY 340          
BLAST of UDP galactose 4 epimerase vs. Ensembl Nematostella
Match: EDO26146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCR8])

HSP 1 Score: 114.775 bits (286), Expect = 5.658e-29
Identity = 96/310 (30.97%), Postives = 150/310 (48.39%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLN--RIEK--ITKNKF-AFHEVDMLN-KKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFD---ICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGL-KIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYAD 1006
            +LVTG  G+IG H    L   G+ VV IDN+ +     L   R+++  I KN+   F++    N  + L  LF   KF  V + AA   V  S+  P  Y ++NI+  LN++E    H +K LV++SS++VYG  KK+P +E DS+    + Y  TK   E M      + K+ TT     LR+F   G          P G P ++ P +   A+     + VF      N G   RD+ ++ D+ +G  + +EK   +  L KIYN+G      +L+ I   E + G +   E+ P + GD+   +A+
Sbjct:    3 ILVTGAAGFIGFHLSERLLAEGHTVVGIDNINDYYDVNLKYARLKELGIDKNRAEVFYQESSSNIYEKLFQLFTSEKFDVVCNLAAQAGVRYSIENPDVYIQSNIVGFLNILECCRHHEIKHLVYASSSSVYGANKKVPFSEEDSVDNPVSLYAATKKSNELMAHTYSHLYKIPTTG----LRFFTVYG----------PWGRP-DMAPILFADAISNNLSIKVF------NKGDMERDFTYIDDIVEGVKRVIEKPVERRELYKIYNIGNNDSIKLLDFIREMETSIGKEAVKEMLPMQMGDVKRTWAN 291          
BLAST of UDP galactose 4 epimerase vs. Ensembl Nematostella
Match: EDO34511 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP46])

HSP 1 Score: 81.2629 bits (199), Expect = 3.069e-19
Identity = 38/71 (53.52%), Postives = 53/71 (74.65%), Query Frame = 2
Query:  218 CLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEV 430
            C+ R+E+I+  K  F   D+LNK+ L D+F K+KF+ V+HFA LKAVGESV +PL+YY NN+   L+L+EV
Sbjct:    2 CVRRVEEISGKKVPFFIEDLLNKEALDDIFKKHKFNGVLHFAGLKAVGESVQIPLRYYHNNLTGTLHLLEV 72          
BLAST of UDP galactose 4 epimerase vs. Ensembl Nematostella
Match: EDO36456 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII4])

HSP 1 Score: 73.1738 bits (178), Expect = 2.776e-14
Identity = 75/279 (26.88%), Postives = 127/279 (45.52%), Query Frame = 2
Query:   98 KQIVLVTGGVGYIGSHTVIELFTA--GYEVVIIDNL--CNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKL-PITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMP-FVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEM 916
            K+ +LVTGG G+IGSH VI L      Y V+ +D L  C A+ + L RI    +  + F E D+     L  +F   +   V+HFAA   V  S    L + K N+     LI V  +  +K  +  S+  VYG    L  +    S    +NPY  +K   E ++    +    + V+I R  N  G H+           P  ++P F+  +   ++  ++         DG+  R++++V D+A+  ++ L    G+ G + YN+G+     ++E+
Sbjct:   16 KKRILVTGGAGFIGSHVVILLVERYPEYYVINLDKLDYC-ASLKNLKRIS--GRPNYKFIEGDICEANHLKYIFQAEQIDTVLHFAAQSHVDNSFWSSLDFTKTNVYGTHVLINVAHEAKIKKFIHVSTDEVYGGNSSLGDMHSESSPLRPSNPYAASKAAAECIVMSYLE-SFKFPVIITRSNNVYGPHQY----------PEKVIPKFITLLNRNRKCFIH--------GDGSQERNFLYVTDVAEAFLRILHY--GQDG-ETYNIGSEFAIDIMEL 269          
BLAST of UDP galactose 4 epimerase vs. Ensembl Nematostella
Match: EDO39936 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8F5])

HSP 1 Score: 72.4034 bits (176), Expect = 6.704e-14
Identity = 79/330 (23.94%), Postives = 131/330 (39.70%), Query Frame = 2
Query:   83 LMSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNP------YGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGL 1054
            L  K ++ VL++GG G++GSH    L   G+EV ++DN     K  +       ++       +++N   +  L    +   + H A+  +    +  P+K  K N I  LN++  +A      L+ +S++ VYG  ++ P  E     G  NP      Y + K   E M +   K +    V + R FN  G       G         +  F+ Q   GK   + V+G+      G+  R + +V DL  G I  +     K      N+G    +S++E      +A G   P     +   D      D   A + LNWK +  L
Sbjct:   95 LAEKDRKRVLISGGAGFVGSHLADSLMMQGHEVTVVDNFFTGRKRNI-------EHWIGHENFELINHDVVEPLL--IEVDQIYHLASPASPPNYMYNPIKTIKTNTIGTLNMLG-LAKRVHARLLLASTSEVYGVQQEHPQGE--DYWGHVNPIGPRACYDEGKRVAETMCYAYAKQEQV-EVRVARIFNTFGPRMHMNDGRV-------VSNFILQALEGK--PLTVYGS------GSQTRSFQYVSDLVNGLILLMNSNYSKP----VNVGNPDEHSIMEFARIINKAVGGNNPIINVAQMEDDPKRRKPDITRARRLLNWKPLVPL 392          
BLAST of UDP galactose 4 epimerase vs. Ensembl Medaka
Match: gale (UDP-galactose-4-epimerase [Source:NCBI gene;Acc:101158066])

HSP 1 Score: 417.542 bits (1072), Expect = 1.813e-145
Identity = 203/341 (59.53%), Postives = 255/341 (74.78%), Query Frame = 2
Query:  107 VLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKE-----CLNRIEKITKNKFAFHEVDMLNKKDLSDLFNK-YKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            +LVTGG GYIGSH V+EL  AGY  V++DN  NA +E      + RIEK+      FH++D+L++  L  LF K + F  V+HFA LKAVGESV  PL+YYK N+ AA+NLIEVM  + V++LVFSSSATVYG PK LPI E    GGCTNPYGKTK+FIEE++ D CK +  W+ V+LRYFNP+G+H SG+IGEDP G P NL+P+VAQVAVG+R  ++VFGNDY T DGT VRDYIHVVDL++GHI AL+KL   CG K+YNLGTG+GYSVL+++   E+A G +IPY+IAPRR GD+   YAD KLAE+EL WK+ + ++ M  DLW WQ  NP G+S
Sbjct:    5 ILVTGGAGYIGSHCVLELIEAGYHPVVVDNFSNAVQEGTVAESIRRIEKLLNTTIEFHQLDLLDRPGLESLFKKQHTFAAVMHFAGLKAVGESVEQPLRYYKVNLTAAMNLIEVMQANNVRNLVFSSSATVYGDPKHLPIDEQHPAGGCTNPYGKTKFFIEEIIKDQCKAEKDWNAVLLRYFNPIGAHSSGLIGEDPQGIPNNLLPYVAQVAVGRRQCLSVFGNDYDTVDGT-VRDYIHVVDLSKGHIAALKKLKENCGCKVYNLGTGKGYSVLQVVKGMEKASGKEIPYKIAPRRGGDVASCYADPKLAEEELGWKAEFDMERMA-DLWRWQSMNPTGFS 343          
BLAST of UDP galactose 4 epimerase vs. Ensembl Medaka
Match: uxs1 (UDP-glucuronate decarboxylase 1 [Source:NCBI gene;Acc:101174710])

HSP 1 Score: 70.0922 bits (170), Expect = 8.624e-13
Identity = 75/332 (22.59%), Postives = 135/332 (40.66%), Query Frame = 2
Query:   83 LMSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNP------YGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKE 1060
            L  K ++ +L+TGG G++GSH   +L   G+EV ++DN     K  +       ++       +++N   +  L+   +   + H A+  +    +  P+K  K N I  LN++ +    G + L+ +S++ +YG P+  P +E     G  NP      Y + K   E M +   K +    V + R FN  GS      G         +  F+ Q   G+   + V+G       G+  R + +V DL  G +     +N      + NLG    +++LE     +         +       D      D + A+  L W+ +  L+E
Sbjct:   81 LSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNV-------EHWIGHENFELINHDVVEPLY--IEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGAR-LLLASTSEIYGDPEVHPQSE--DYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGV-EVRVARIFNTFGSRMHMNDGRV-------VSNFILQALQGE--PLTVYGT------GSQTRAFQYVSDLVNGLVLL---MNSNISSPV-NLGNPEEHTILEFARLIKSLVVSHSQIQFLAEAQDDPQRRRPDIRKAKMLLGWEPVVPLEE 380          
BLAST of UDP galactose 4 epimerase vs. Ensembl Medaka
Match: ENSORLT00000025340.2 (TDP-glucose 4,6-dehydratase [Source:NCBI gene;Acc:101172787])

HSP 1 Score: 62.7734 bits (151), Expect = 1.625e-10
Identity = 88/356 (24.72%), Postives = 139/356 (39.04%), Query Frame = 2
Query:   86 MSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNK--FAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEV--MADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTG--VRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIP-------YEIAPRRPG-DLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYS 1111
            M   ++ VLVTGG G+IGSH V  L     +  II NL   +  C  R  +  +++  + F + D+ +   L  LF+ ++   V H AA   V  S   P  + + N+     L+    MA H  +  ++ S+  VYG        E   +    NPY  +K   E +      V   W     RY  PV   +S  I   P      ++P    +         +  N+  T  GT    R ++ V D     +  LEK  G  G ++YN+G+     +L +     +     +P        E  P RP  +L    +  KL  + L W +     E       W Q NP+ ++
Sbjct:    1 MGAFERTVLVTGGSGFIGSHLVCSLVCEHPDWRII-NLDQLDSCCSPRSLRSVEDRRNYTFVQGDVCDPSLLDRLFSAHRIDVVFHLAARTHVEASFQNPASFQRVNVEGTRTLLRAAQMAQHRPQRFLYISTDEVYGAGADRAFDERSPLRP-ANPYAVSKAAAENL------VRFYWD----RYQLPVIITRSNNI-YGPRQHSEKVIPRFLSL---------LQQNNKCTIQGTAPKSRHFLFVSDAIAAFLLLLEK--GAVG-EVYNVGSSWEVPILGLAQQLVKTV-RNVPDSEVGEWLEFVPDRPQVELRYPISSEKL--RRLGWGAQVSWAEGIRRTVQWYQDNPDFWA 328          
BLAST of UDP galactose 4 epimerase vs. Ensembl Medaka
Match: ENSORLT00000036387.1 (TDP-glucose 4,6-dehydratase [Source:NCBI gene;Acc:101172787])

HSP 1 Score: 60.8474 bits (146), Expect = 7.076e-10
Identity = 47/169 (27.81%), Postives = 75/169 (44.38%), Query Frame = 2
Query:   86 MSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNK--FAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEV--MADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEML 580
            M   ++ VLVTGG G+IGSH V  L     +  II NL   +  C  R  +  +++  + F + D+ +   L  LF+ ++   V H AA   V  S   P  + + N+     L+    MA H  +  ++ S+  VYG        E   +    NPY  +K   E ++
Sbjct:    1 MGAFERTVLVTGGSGFIGSHLVCSLVCEHPDWRII-NLDQLDSCCSPRSLRSVEDRRNYTFVQGDVCDPSLLDRLFSAHRIDVVFHLAARTHVEASFQNPASFQRVNVEGTRTLLRAAQMAQHRPQRFLYISTDEVYGAGADRAFDERSPLRP-ANPYAVSKAAAENLV 167          
BLAST of UDP galactose 4 epimerase vs. Ensembl Medaka
Match: nsdhl (NAD(P) dependent steroid dehydrogenase-like [Source:NCBI gene;Acc:101171010])

HSP 1 Score: 50.8322 bits (120), Expect = 1.301e-6
Identity = 62/260 (23.85%), Postives = 104/260 (40.00%), Query Frame = 2
Query:   86 MSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVY--GTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIG-EDPLGPPANLMPFVAQVAVGKRPHVN-VFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLN 853
            +  S +   V GG G++G H V +L   GY V + D             +        FH+ D+ +K+ L           V H A+     +   L   + + N++    +I+   + GV+ LV +SSA+V   GT  K    +L       + Y +TK   E+++   C     +  V +R          G+ G  DP      L+P +   A  +R  +  + GN      G  + D+ +V ++  GHI A E L 
Sbjct:    5 LRPSSKRCAVIGGSGFLGRHLVEKLLERGYSVSVFDIR-----------QSYELPGVTFHQGDLCDKQALLSALQDVSL--VFHCASPAPGSDDRKL---FERVNVVGTQTVIQACIEAGVQKLVLTSSASVVYEGTDIKNGKEDLPYAKKPIDYYTQTKIEQEKLVLGACNKQKGFLTVAIR--------PHGIFGPRDP-----QLVPILVDTA--RRGKMKFIIGN------GANLVDFTYVENVVHGHILAAEHLR 227          
BLAST of UDP galactose 4 epimerase vs. Planmine SMEST
Match: SMESG000062688.1 (SMESG000062688.1)

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 345/346 (99.71%), Postives = 345/346 (99.71%), Query Frame = 2
Query:   86 MSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYSGVSK 1123
            MSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITE DSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYSGVSK
Sbjct:    1 MSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEKITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITESDSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYSGVSK 346          
BLAST of UDP galactose 4 epimerase vs. Planmine SMEST
Match: SMESG000064945.1 (SMESG000064945.1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.685e-16
Identity = 94/347 (27.09%), Postives = 151/347 (43.52%), Query Frame = 2
Query:   86 MSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEK-ITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITEL----DSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVG---SHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLE---MITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKS----IYGLKEMCEDLWN 1081
            +S +K+I L+TGG G+IGSH   EL   G +V++IDN     K   + IEK +    F F   D++N   L       +   + H A+  +    +  P+K  K N +  +N++  +A     +L+ +S++ +YG PK+ P  E      +I G  + Y + K   E + +   K D   S+ I R FN  G    H  G +  +          F+ Q    K   + V+GN + T      R + +V DL  G +K L   N    +   N G    +++L+   MI         +I +  +   P D      D   A K LNW+     IYGL++  E + N
Sbjct:   77 ISHTKRI-LITGGAGFIGSHLTDELILEGNDVIVIDNFATGKK---SNIEKWLGHPNFEFIHHDIINPIWL-------EVDQIYHLASPASPLIYMKNPIKTIKTNTMGTVNMLG-LAKRNKATLLLASTSEIYGDPKEHPQKETYFGNVNIFGPRSCYDEGKRLAESLCYAYYKQDNV-SIRIARIFNTFGPRMKHDDGRVVSN----------FIYQSLTNKS--LTVYGNGFQT------RSFQYVTDLIVG-LKLLMNSNVHSPV---NFGNPEEHTILQLSKMILKLVPKSNSQIVFNSS--LPDDPQRRLPDISKAIKSLNWRPKVSLIYGLRKTIEYMRN 386          
BLAST of UDP galactose 4 epimerase vs. Planmine SMEST
Match: SMESG000064945.1 (SMESG000064945.1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.820e-16
Identity = 94/347 (27.09%), Postives = 151/347 (43.52%), Query Frame = 2
Query:   86 MSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIEK-ITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLKYYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITEL----DSIGGCTNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVG---SHKSGMIGEDPLGPPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIKALEKLNGKCGLKIYNLGTGRGYSVLE---MITAFEQACGHKIPYEIAPRRPGDLPEVYADTKLAEKELNWKS----IYGLKEMCEDLWN 1081
            +S +K+I L+TGG G+IGSH   EL   G +V++IDN     K   + IEK +    F F   D++N   L       +   + H A+  +    +  P+K  K N +  +N++  +A     +L+ +S++ +YG PK+ P  E      +I G  + Y + K   E + +   K D   S+ I R FN  G    H  G +  +          F+ Q    K   + V+GN + T      R + +V DL  G +K L   N    +   N G    +++L+   MI         +I +  +   P D      D   A K LNW+     IYGL++  E + N
Sbjct:   79 ISHTKRI-LITGGAGFIGSHLTDELILEGNDVIVIDNFATGKK---SNIEKWLGHPNFEFIHHDIINPIWL-------EVDQIYHLASPASPLIYMKNPIKTIKTNTMGTVNMLG-LAKRNKATLLLASTSEIYGDPKEHPQKETYFGNVNIFGPRSCYDEGKRLAESLCYAYYKQDNV-SIRIARIFNTFGPRMKHDDGRVVSN----------FIYQSLTNKS--LTVYGNGFQT------RSFQYVTDLIVG-LKLLMNSNVHSPV---NFGNPEEHTILQLSKMILKLVPKSNSQIVFNSS--LPDDPQRRLPDISKAIKSLNWRPKVSLIYGLRKTIEYMRN 388          
The following BLAST results are available for this feature:
BLAST of UDP galactose 4 epimerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALE3.199e-15360.00UDP-galactose-4-epimerase [Source:HGNC Symbol;Acc:... [more]
GALE3.199e-15360.00UDP-galactose-4-epimerase [Source:HGNC Symbol;Acc:... [more]
GALE4.705e-10764.32UDP-galactose-4-epimerase [Source:HGNC Symbol;Acc:... [more]
GALE8.338e-10254.72UDP-galactose-4-epimerase [Source:HGNC Symbol;Acc:... [more]
GALE2.295e-7357.37UDP-galactose-4-epimerase [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of UDP galactose 4 epimerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gale-11.344e-13554.36UDP-glucose 4-epimerase [Source:UniProtKB/Swiss-P... [more]
gale-12.680e-13554.05UDP-glucose 4-epimerase [Source:UniProtKB/Swiss-P... [more]
F53B1.47.234e-1226.98pep chromosome:WBcel235:X:2111397:2113103:-1 gene:... [more]
sqv-17.094e-1122.52SQuashed Vulva [Source:UniProtKB/TrEMBL;Acc:X5M5R... [more]
sqv-17.094e-1122.52SQuashed Vulva [Source:UniProtKB/TrEMBL;Acc:X5M5R... [more]
back to top
BLAST of UDP galactose 4 epimerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Gale3.134e-14557.14gene:FBgn0035147 transcript:FBtr0072556[more]
Gale3.134e-14557.14gene:FBgn0035147 transcript:FBtr0306917[more]
Uxs5.990e-1023.32gene:FBgn0035848 transcript:FBtr0076690[more]
back to top
BLAST of UDP galactose 4 epimerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gale1.511e-15961.22UDP-galactose-4-epimerase [Source:ZFIN;Acc:ZDB-GEN... [more]
gale2.559e-15961.05UDP-galactose-4-epimerase [Source:ZFIN;Acc:ZDB-GEN... [more]
gale2.559e-15961.05UDP-galactose-4-epimerase [Source:ZFIN;Acc:ZDB-GEN... [more]
gale2.559e-15961.05UDP-galactose-4-epimerase [Source:ZFIN;Acc:ZDB-GEN... [more]
gale1.037e-6266.91UDP-galactose-4-epimerase [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of UDP galactose 4 epimerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gale3.431e-15161.58UDP-galactose-4-epimerase [Source:NCBI gene;Acc:44... [more]
gale1.692e-13959.41UDP-galactose-4-epimerase [Source:NCBI gene;Acc:44... [more]
gale9.538e-13761.92UDP-galactose-4-epimerase [Source:NCBI gene;Acc:44... [more]
gale3.376e-12354.55UDP-galactose-4-epimerase [Source:NCBI gene;Acc:44... [more]
gale2.086e-12261.46UDP-galactose-4-epimerase [Source:NCBI gene;Acc:44... [more]
back to top
BLAST of UDP galactose 4 epimerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gale9.368e-15359.12galactose-4-epimerase, UDP [Source:MGI Symbol;Acc:... [more]
Gale9.368e-15359.12galactose-4-epimerase, UDP [Source:MGI Symbol;Acc:... [more]
Uxs17.808e-1423.80UDP-glucuronate decarboxylase 1 [Source:MGI Symbol... [more]
Tgds3.726e-1326.33TDP-glucose 4,6-dehydratase [Source:MGI Symbol;Acc... [more]
Tgds6.981e-1326.33TDP-glucose 4,6-dehydratase [Source:MGI Symbol;Acc... [more]
back to top
BLAST of UDP galactose 4 epimerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14376|GALE_HUMAN1.536e-15260.00UDP-glucose 4-epimerase OS=Homo sapiens OX=9606 GN... [more]
sp|Q8R059|GALE_MOUSE6.553e-15259.12UDP-glucose 4-epimerase OS=Mus musculus OX=10090 G... [more]
sp|Q5R8D0|GALE_PONAB2.870e-15159.71UDP-glucose 4-epimerase OS=Pongo abelii OX=9601 GN... [more]
sp|Q3T105|GALE_BOVIN4.346e-15159.41UDP-glucose 4-epimerase OS=Bos taurus OX=9913 GN=G... [more]
sp|Q9SN58|UGE5_ARATH5.606e-14659.77UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana ... [more]
back to top
BLAST of UDP galactose 4 epimerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIA20.000e+0100.00UDP-glucose 4-epimerase OS=Schmidtea mediterranea ... [more]
A0A5N5N4191.398e-15759.72Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A7RFA61.005e-15663.45UDP-glucose 4-epimerase OS=Nematostella vectensis ... [more]
A0A3B1IK011.368e-15662.97UDP-glucose 4-epimerase OS=Astyanax mexicanus OX=7... [more]
A0A210QTE11.415e-15662.13UDP-glucose 4-epimerase OS=Mizuhopecten yessoensis... [more]
back to top
BLAST of UDP galactose 4 epimerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gale5.182e-16062.97UDP-galactose-4-epimerase [Source:NCBI gene;Acc:10... [more]
gale1.258e-15962.43UDP-galactose-4-epimerase [Source:NCBI gene;Acc:10... [more]
gale5.367e-11662.69UDP-galactose-4-epimerase [Source:NCBI gene;Acc:10... [more]
uxs16.271e-1623.49UDP-glucuronate decarboxylase 1 [Source:NCBI gene;... [more]
uxs17.058e-1523.24UDP-glucuronate decarboxylase 1 [Source:NCBI gene;... [more]
back to top
BLAST of UDP galactose 4 epimerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDP galactose 4 epimerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
GAL107.330e-11450.14UDP-glucose-4-epimerase; catalyzes interconversion... [more]
ERG262.364e-723.53C-3 sterol dehydrogenase; catalyzes the second of ... [more]
back to top
BLAST of UDP galactose 4 epimerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO499221.390e-16063.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261465.658e-2930.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345113.069e-1953.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364562.776e-1426.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399366.704e-1423.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UDP galactose 4 epimerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gale1.813e-14559.53UDP-galactose-4-epimerase [Source:NCBI gene;Acc:10... [more]
uxs18.624e-1322.59UDP-glucuronate decarboxylase 1 [Source:NCBI gene;... [more]
ENSORLT00000025340.21.625e-1024.72TDP-glucose 4,6-dehydratase [Source:NCBI gene;Acc:... [more]
ENSORLT00000036387.17.076e-1027.81TDP-glucose 4,6-dehydratase [Source:NCBI gene;Acc:... [more]
nsdhl1.301e-623.85NAD(P) dependent steroid dehydrogenase-like [Sourc... [more]
back to top
BLAST of UDP galactose 4 epimerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000062688.10.000e+099.71SMESG000062688.1[more]
SMESG000064945.11.685e-1627.09SMESG000064945.1[more]
SMESG000064945.11.820e-1627.09SMESG000064945.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012329
GenBankAFJ24756.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012329 ID=SMED30012329|Name=UDP galactose 4 epimerase|organism=Schmidtea mediterranea sexual|type=transcript|length=1215bp
TATCAAGTCATTACTTTATTTTCAAATATTATTCTTGACTTCATTAAAAT
TTTATTTTTTAATTTTTTGATTGTTAAACGCATTAATGAGCAAATCTAAA
CAGATAGTTTTAGTAACTGGCGGAGTAGGTTATATAGGAAGTCATACTGT
AATTGAATTATTTACCGCTGGTTATGAAGTTGTAATAATTGATAATCTTT
GCAACGCCAATAAAGAGTGTCTTAATCGTATCGAAAAAATAACTAAGAAC
AAGTTTGCTTTTCATGAAGTTGATATGCTTAACAAAAAAGACCTATCAGA
TTTGTTCAATAAATACAAATTCCATCACGTTATTCATTTTGCAGCTTTAA
AGGCTGTCGGAGAATCAGTGGCTTTGCCTTTGAAATATTATAAGAATAAC
ATAATTGCTGCATTAAATTTAATAGAGGTAATGGCAGACCATGGCGTTAA
GAGTCTTGTATTTTCGAGTTCTGCCACAGTTTACGGAACGCCCAAAAAAT
TACCGATAACCGAATTGGATTCGATTGGTGGCTGTACCAATCCATACGGG
AAAACGAAATGGTTTATAGAGGAAATGCTTTTTGACATATGTAAAGTTGA
CACGACTTGGTCGGTGGTTATTTTGCGATATTTCAATCCAGTGGGGTCTC
ATAAATCCGGCATGATTGGCGAGGATCCACTTGGACCTCCTGCTAATTTA
ATGCCGTTTGTCGCTCAAGTGGCTGTAGGAAAACGGCCACATGTAAATGT
TTTTGGAAATGACTACCCAACAAATGACGGAACAGGAGTCCGGGATTACA
TTCACGTTGTCGATCTAGCCCAGGGTCACATAAAGGCATTAGAGAAATTA
AATGGTAAATGCGGCCTTAAAATTTATAATCTCGGCACTGGCAGAGGATA
TTCGGTTTTAGAAATGATAACTGCGTTTGAGCAGGCATGTGGTCACAAAA
TCCCGTACGAAATTGCTCCTCGACGCCCAGGAGATTTACCGGAAGTATAT
GCTGATACAAAACTTGCGGAAAAGGAACTCAATTGGAAATCGATATATGG
ATTGAAAGAAATGTGTGAAGATTTATGGAATTGGCAGCAAAAAAATCCAG
AAGGATATTCGGGAGTTTCTAAATGAGAATTTTTTTTAATTTCAATGGAA
ATGGTTGTGAACGTTTTGTAGTTCTATTTTATTTGAAATAAAAACTTTTG
TTTTTTAAAAAAAAA
back to top

protein sequence of SMED30012329-orf-1

>SMED30012329-orf-1 ID=SMED30012329-orf-1|Name=SMED30012329-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=347bp
MSKSKQIVLVTGGVGYIGSHTVIELFTAGYEVVIIDNLCNANKECLNRIE
KITKNKFAFHEVDMLNKKDLSDLFNKYKFHHVIHFAALKAVGESVALPLK
YYKNNIIAALNLIEVMADHGVKSLVFSSSATVYGTPKKLPITELDSIGGC
TNPYGKTKWFIEEMLFDICKVDTTWSVVILRYFNPVGSHKSGMIGEDPLG
PPANLMPFVAQVAVGKRPHVNVFGNDYPTNDGTGVRDYIHVVDLAQGHIK
ALEKLNGKCGLKIYNLGTGRGYSVLEMITAFEQACGHKIPYEIAPRRPGD
LPEVYADTKLAEKELNWKSIYGLKEMCEDLWNWQQKNPEGYSGVSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005886UDP_G4E
IPR036291NAD(P)-bd_dom_sf
IPR008089Nuc_sugar_epim
IPR016040NAD(P)-bd_dom
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0006012galactose metabolic process
GO:0019388galactose catabolic process
Vocabulary: molecular function
TermDefinition
GO:0016857racemase and epimerase activity, acting on carbohydrates and derivatives
GO:0003974UDP-N-acetylglucosamine 4-epimerase activity
GO:0003978UDP-glucose 4-epimerase activity
GO:0016853isomerase activity
GO:0042802identical protein binding
GO:0042803protein homodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 35..55
NoneNo IPR availablePRINTSPR01713NUCEPIMERASEcoord: 261..276
score: 29.4
coord: 300..317
score: 29.01
coord: 236..251
score: 31.48
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 8..279
e-value: 8.5E-144
score: 480.6
NoneNo IPR availableGENE3DG3DSA:3.90.25.10coord: 199..334
e-value: 8.5E-144
score: 480.6
NoneNo IPR availablePANTHERPTHR43725:SF14UDP-GLUCOSE 4-EPIMERASEcoord: 5..342
NoneNo IPR availablePANTHERPTHR43725FAMILY NOT NAMEDcoord: 5..342
IPR005886UDP-glucose 4-epimeraseTIGRFAMTIGR01179TIGR01179coord: 8..340
e-value: 1.7E-133
score: 442.5
IPR005886UDP-glucose 4-epimeraseCDDcd05247UDP_G4E_1_SDR_ecoord: 8..335
e-value: 0.0
score: 545.208
IPR016040NAD(P)-binding domainPFAMPF16363GDP_Man_Dehydcoord: 9..329
e-value: 5.9E-57
score: 193.5
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 5..341