Palmitoyl-protein thioesterase 1

Overview
NamePalmitoyl-protein thioesterase 1
Smed IDSMED30012316
Length (bp)1322
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Palmitoyl-protein thioesterase 1 (SMED30012316) t-SNE clustered cells

Violin plots show distribution of expression levels for Palmitoyl-protein thioesterase 1 (SMED30012316) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Palmitoyl-protein thioesterase 1 (SMED30012316) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Palmitoyl-protein thioesterase 1 (SMED30012316) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012316

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012316SMESG000036367.1 Contig2665GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30012316SMESG000036367.1 dd_Smed_v4_2388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012316SMESG000036367.1 dd_Smed_v4_2388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30012316SMESG000036367.1 dd_Smed_v4_2388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012316SMESG000036367.1 dd_Smed_v6_2388_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012316SMESG000036367.1 dd_Smed_v4_2388_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Human
Match: PPT1 (palmitoyl-protein thioesterase 1 [Source:HGNC Symbol;Acc:HGNC:9325])

HSP 1 Score: 346.665 bits (888), Expect = 2.256e-117
Identity = 162/280 (57.86%), Postives = 198/280 (70.71%), Query Frame = 3
Query:  132 LSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            L    P P+V+WHGMGD+CCNPLS+G I+  +EK IPG+YVLSL IG    ED  N FF+NVN+Q+   C  +A D  LQ G+NA+GFSQGGQFLRAV QRCP   + NLIS+GGQHQGVFG P CP     IC+ IRK L+ GAY   VQ   VQAEYWHDP+KED+Y+  SIFLA+IN  +  N +YK  L  L  FVMVKFLND++V P DSEWF FY  GQ ++  PL  +++YTQD LGLK++ +  +L FL+  G HLQ SEEWF  +II PFL
Sbjct:   27 LDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHII-PFL 305          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Human
Match: PPT1 (palmitoyl-protein thioesterase 1 [Source:HGNC Symbol;Acc:HGNC:9325])

HSP 1 Score: 346.665 bits (888), Expect = 2.256e-117
Identity = 162/280 (57.86%), Postives = 198/280 (70.71%), Query Frame = 3
Query:  132 LSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            L    P P+V+WHGMGD+CCNPLS+G I+  +EK IPG+YVLSL IG    ED  N FF+NVN+Q+   C  +A D  LQ G+NA+GFSQGGQFLRAV QRCP   + NLIS+GGQHQGVFG P CP     IC+ IRK L+ GAY   VQ   VQAEYWHDP+KED+Y+  SIFLA+IN  +  N +YK  L  L  FVMVKFLND++V P DSEWF FY  GQ ++  PL  +++YTQD LGLK++ +  +L FL+  G HLQ SEEWF  +II PFL
Sbjct:   27 LDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHII-PFL 305          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Human
Match: PPT1 (palmitoyl-protein thioesterase 1 [Source:HGNC Symbol;Acc:HGNC:9325])

HSP 1 Score: 339.732 bits (870), Expect = 1.123e-114
Identity = 161/280 (57.50%), Postives = 197/280 (70.36%), Query Frame = 3
Query:  132 LSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            L    P P+V+WHGM D+CCNPLS+G I+  +EK IPG+YVLSL IG    ED  N FF+NVN+Q+   C  +A D  LQ G+NA+GFSQGGQFLRAV QRCP   + NLIS+GGQHQGVFG P CP     IC+ IRK L+ GAY   VQ   VQAEYWHDP+KED+Y+  SIFLA+IN  +  N +YK  L  L  FVMVKFLND++V P DSEWF FY  GQ ++  PL  +++YTQD LGLK++ +  +L FL+  G HLQ SEEWF  +II PFL
Sbjct:   27 LDPPAPLPLVIWHGM-DSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHII-PFL 304          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Human
Match: PPT1 (palmitoyl-protein thioesterase 1 [Source:HGNC Symbol;Acc:HGNC:9325])

HSP 1 Score: 332.798 bits (852), Expect = 1.859e-111
Identity = 162/309 (52.43%), Postives = 198/309 (64.08%), Query Frame = 3
Query:  132 LSNANPTPIVMWHGMG-----------------------------DTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            L    P P+V+WHGMG                             D+CCNPLS+G I+  +EK IPG+YVLSL IG    ED  N FF+NVN+Q+   C  +A D  LQ G+NA+GFSQGGQFLRAV QRCP   + NLIS+GGQHQGVFG P CP     IC+ IRK L+ GAY   VQ   VQAEYWHDP+KED+Y+  SIFLA+IN  +  N +YK  L  L  FVMVKFLND++V P DSEWF FY  GQ ++  PL  +++YTQD LGLK++ +  +L FL+  G HLQ SEEWF  +II PFL
Sbjct:   27 LDPPAPLPLVIWHGMGSRYVAQTGLELLASSNPPASSYQSAGMIGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHII-PFL 334          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Human
Match: PPT1 (palmitoyl-protein thioesterase 1 [Source:HGNC Symbol;Acc:HGNC:9325])

HSP 1 Score: 308.531 bits (789), Expect = 4.248e-102
Identity = 146/262 (55.73%), Postives = 178/262 (67.94%), Query Frame = 3
Query:  132 LSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQ-----DLLGLKQLFDTNRLKFL 899
            L    P P+V+WHGMGD+CCNPLS+G I+  +EK IPG+YVLSL IG    ED  N FF+NVN+Q+   C  +A D  LQ G+NA+GFSQGGQFLRAV QRCP   + NLIS+GGQHQGVFG P CP     IC+ IRK L+ GAY   VQ   VQAEYWHDP+KED+Y+  SIFLA+IN  +  N +YK  L  L  FVMVKFLND++V P DSEWF FY  GQ ++  PL  +++YTQ      +LG    F +  LK L
Sbjct:   20 LDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQVTGRESILGGWCFFSSQFLKLL 281          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Celegans
Match: ppt-1 (Palmitoyl-protein thioesterase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20390])

HSP 1 Score: 295.049 bits (754), Expect = 1.030e-97
Identity = 143/273 (52.38%), Postives = 188/273 (68.86%), Query Frame = 3
Query:  150 TPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPF 965
             P+VMWHGMGD CCNPLS+G ++   E+ IPGVYV SL++G +  +D  +GF+ N N  + MAC  I ND  L+NG+NAIGFSQG QFLRAV QRCP   + NL+S+GGQHQGVFG P C   D  +CN +R+L+  GAY  FVQ+  VQA+YWHDP + + YK++SIFLA+INN    N TYK  L +L N V+VKF  D MV+PKDS WF FY+ G  + I P+  + +Y +D +GLK+L ++ R+ F+ V G HLQ      V +IIK +
Sbjct:   25 VPVVMWHGMGDCCCNPLSMGSVKKLFEEQIPGVYVHSLQLGSSITKDIEHGFYANTNELVYMACIKIKNDPELKNGYNAIGFSQGAQFLRAVAQRCPNPPMKNLVSVGGQHQGVFGAPYC-IGDNIMCNGVRRLIDLGAYLPFVQKRVVQAQYWHDPNQVEEYKKRSIFLADINNENNNNPTYKRNLLSLKNLVLVKFNQDHMVVPKDSSWFGFYKDGDIDTILPMNETDLYKEDRIGLKKLHESGRIHFMDVDGDHLQIPRSVLVNDIIKKY 296          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Fly
Match: Ppt1 (gene:FBgn0030057 transcript:FBtr0345985)

HSP 1 Score: 275.018 bits (702), Expect = 1.514e-89
Identity = 140/281 (49.82%), Postives = 181/281 (64.41%), Query Frame = 3
Query:  135 SNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFLSK 974
            +N    P+V+WHGMGDTCC P SLG I + I +   G YV SL+IGGN   D  +GFF++ N Q+   C  +  D +L  G++AIGFSQGGQFLRAV +RCP   + NLI++GGQHQG+FG P CP+  E  C+ I +LL   AY   VQ+  VQA YWHDP+ E+ Y+  S FLA+INN    N  Y   L  L  FVMV+FLNDT+V PK+S+WF++Y  GQ + I P T S +Y QD LGL ++    +L FL V G HL  S+ WF+ NI+   L K
Sbjct:   36 TNPEVLPVVLWHGMGDTCCVPFSLGAIMNLIVEQTKGGYVRSLQIGGNVLIDWQSGFFIHPNEQVDYVCKQLLQDEHLAKGYHAIGFSQGGQFLRAVAERCPNPPMRNLITLGGQHQGIFGLPMCPTLTEKPCDYITRLLDNAAYAPEVQKALVQATYWHDPIMENKYRLGSTFLADINNELFINKFYIENLQKLKKFVMVQFLNDTIVQPKESQWFQYYTTGQNKVIQPFTESKVY-QD-LGLDKMHRQGQLVFLGVEGDHLAISKAWFIQNIVPLLLEK 314          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Fly
Match: Ppt1 (gene:FBgn0030057 transcript:FBtr0071225)

HSP 1 Score: 275.018 bits (702), Expect = 1.514e-89
Identity = 140/281 (49.82%), Postives = 181/281 (64.41%), Query Frame = 3
Query:  135 SNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFLSK 974
            +N    P+V+WHGMGDTCC P SLG I + I +   G YV SL+IGGN   D  +GFF++ N Q+   C  +  D +L  G++AIGFSQGGQFLRAV +RCP   + NLI++GGQHQG+FG P CP+  E  C+ I +LL   AY   VQ+  VQA YWHDP+ E+ Y+  S FLA+INN    N  Y   L  L  FVMV+FLNDT+V PK+S+WF++Y  GQ + I P T S +Y QD LGL ++    +L FL V G HL  S+ WF+ NI+   L K
Sbjct:   36 TNPEVLPVVLWHGMGDTCCVPFSLGAIMNLIVEQTKGGYVRSLQIGGNVLIDWQSGFFIHPNEQVDYVCKQLLQDEHLAKGYHAIGFSQGGQFLRAVAERCPNPPMRNLITLGGQHQGIFGLPMCPTLTEKPCDYITRLLDNAAYAPEVQKALVQATYWHDPIMENKYRLGSTFLADINNELFINKFYIENLQKLKKFVMVQFLNDTIVQPKESQWFQYYTTGQNKVIQPFTESKVY-QD-LGLDKMHRQGQLVFLGVEGDHLAISKAWFIQNIVPLLLEK 314          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Fly
Match: Ppt2 (gene:FBgn0032358 transcript:FBtr0080212)

HSP 1 Score: 81.2629 bits (199), Expect = 6.245e-17
Identity = 74/267 (27.72%), Postives = 121/267 (45.32%), Query Frame = 3
Query:  153 PIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFM--NVNNQIKMACDIIANDSNLQ-NGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNCPSSDETICNLI-RKLLSFGAYENFVQR---HSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKF--NMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQ 923
            P+V+ HG+     +  SL R    IE+  PG  V        +  D  NG++   N   Q+    D +     L   G   +G+SQGG   RA +Q  P   V   IS+     G +G         +  +LI   L +  A+E F  R   H+    YW+DP ++D+Y + S FL  INN +K   + ++K+ +  L   VM+   ND ++ P  S  F +++   +  + P     I+T D +G++ L +  +L  + VV  H+ 
Sbjct:   25 PVVILHGILSGAESMASLVR---EIEEFHPGTIV--------YNCDKFNGWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLPEHNVKTFISLSSPQAGQYG--------TSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPQRQDLYLKYSEFLPLINNEKKTSNSTSFKMGMVRLNKLVMIGGPNDDVITPWQSSHFGYFDENMD--VIPFIRRPIFTSDSIGIRTLQEAGKL--IIVVKPHVH 268          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Zebrafish
Match: ppt1 (palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile) [Source:ZFIN;Acc:ZDB-GENE-040426-2653])

HSP 1 Score: 323.168 bits (827), Expect = 2.161e-108
Identity = 149/274 (54.38%), Postives = 193/274 (70.44%), Query Frame = 3
Query:  150 TPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
             P+V+WHGMGD+CCNPLS+G I+  +E+ + G+YVLSL IG +  ED+ NGF M+VN Q+   CD +A D  L+ G+NA+GFSQG QFLRAV QRCP   + NLIS+GGQHQGV+G P CP     IC+ IRK L+ GAY + VQ+H VQA+YWHDPL +D+YK+ S+FLA+IN  +  N TYK  L +L  FVMVKFL D++V P DSEWF FY+ GQ E++  L  S IY +D LGL  +    +L FL+  G HLQF+ EWF  N++   L
Sbjct:   30 VPLVIWHGMGDSCCNPLSMGAIKKMVEQEVSGIYVLSLMIGKSVFEDTENGFLMDVNKQVSFVCDQLAKDPKLKEGYNAMGFSQGAQFLRAVAQRCPDPPMRNLISVGGQHQGVYGLPRCPGESSHICDWIRKQLNSGAYTDAVQKHLVQAQYWHDPLNDDLYKKYSLFLADINQERVVNETYKKNLMSLNKFVMVKFLQDSIVDPVDSEWFGFYKAGQAEELETLQESPIYKEDRLGLAAMDSAGKLVFLASEGDHLQFTREWFNENLLSYLL 303          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Zebrafish
Match: ppt1 (palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile) [Source:ZFIN;Acc:ZDB-GENE-040426-2653])

HSP 1 Score: 323.168 bits (827), Expect = 2.161e-108
Identity = 149/274 (54.38%), Postives = 193/274 (70.44%), Query Frame = 3
Query:  150 TPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
             P+V+WHGMGD+CCNPLS+G I+  +E+ + G+YVLSL IG +  ED+ NGF M+VN Q+   CD +A D  L+ G+NA+GFSQG QFLRAV QRCP   + NLIS+GGQHQGV+G P CP     IC+ IRK L+ GAY + VQ+H VQA+YWHDPL +D+YK+ S+FLA+IN  +  N TYK  L +L  FVMVKFL D++V P DSEWF FY+ GQ E++  L  S IY +D LGL  +    +L FL+  G HLQF+ EWF  N++   L
Sbjct:   30 VPLVIWHGMGDSCCNPLSMGAIKKMVEQEVSGIYVLSLMIGKSVFEDTENGFLMDVNKQVSFVCDQLAKDPKLKEGYNAMGFSQGAQFLRAVAQRCPDPPMRNLISVGGQHQGVYGLPRCPGESSHICDWIRKQLNSGAYTDAVQKHLVQAQYWHDPLNDDLYKKYSLFLADINQERVVNETYKKNLMSLNKFVMVKFLQDSIVDPVDSEWFGFYKAGQAEELETLQESPIYKEDRLGLAAMDSAGKLVFLASEGDHLQFTREWFNENLLSYLL 303          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Zebrafish
Match: ppt1 (palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile) [Source:ZFIN;Acc:ZDB-GENE-040426-2653])

HSP 1 Score: 232.261 bits (591), Expect = 3.565e-74
Identity = 102/175 (58.29%), Postives = 132/175 (75.43%), Query Frame = 3
Query:  150 TPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPF-RVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINN 671
             P+V+WHGMGD+CCNPLS+G I+  +E+ + G+YVLSL IG +  ED+ NGF M+VN Q+   CD +A D  L+ G+NA+GFSQG QFLRAV QRCP   + NLIS+GGQHQGV+G P CP     IC+ IRK L+ GAY + VQ+H VQA+YWHDPL +D+YK+ S+FLA+IN 
Sbjct:   30 VPLVIWHGMGDSCCNPLSMGAIKKMVEQEVSGIYVLSLMIGKSVFEDTENGFLMDVNKQVSFVCDQLAKDPKLKEGYNAMGFSQGAQFLRAVAQRCPDPPMRNLISVGGQHQGVYGLPRCPGESSHICDWIRKQLNSGAYTDAVQKHLVQAQYWHDPLNDDLYKKYSLFLADINQ 204          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Zebrafish
Match: ppt1 (palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile) [Source:ZFIN;Acc:ZDB-GENE-040426-2653])

HSP 1 Score: 220.32 bits (560), Expect = 8.437e-70
Identity = 96/165 (58.18%), Postives = 124/165 (75.15%), Query Frame = 3
Query:  150 TPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKE 641
             P+V+WHGMGD+CCNPLS+G I+  +E+ + G+YVLSL IG +  ED+ NGF M+VN Q+   CD +A D  L+ G+NA+GFSQG QFLRAV QRCP   + NLIS+GGQHQGV+G P CP     IC+ IRK L+ GAY + VQ+H VQA+YWHDPL +D+YK+
Sbjct:   30 VPLVIWHGMGDSCCNPLSMGAIKKMVEQEVSGIYVLSLMIGKSVFEDTENGFLMDVNKQVSFVCDQLAKDPKLKEGYNAMGFSQGAQFLRAVAQRCPDPPMRNLISVGGQHQGVYGLPRCPGESSHICDWIRKQLNSGAYTDAVQKHLVQAQYWHDPLNDDLYKK 194          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Zebrafish
Match: ppt2 (palmitoyl-protein thioesterase 2 [Source:ZFIN;Acc:ZDB-GENE-010430-4])

HSP 1 Score: 68.9366 bits (167), Expect = 1.537e-12
Identity = 65/256 (25.39%), Postives = 110/256 (42.97%), Query Frame = 3
Query:  153 PIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQ--KFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVG 911
            P+++ HG+ D+  + + L R   +I  + PG  V  L +    A  SL   +  V    +    I+ N ++   G + I +SQGG   R ++   P   V + IS+     G +G  +           ++  L    Y    Q+ S+   YW+DP   D+Y   S +LA +NN +    +  +K     +   V++   +D ++ P  S  F FY+    E +  + N  ++  DL GLK L     L   SV G
Sbjct:   23 PVIVVHGLFDSSADFVHLHR---FINLSHPGTNVTVLDLFDRSA--SLQPLWKQVEGFTEAIYPIMQNAAD---GVHLICYSQGGLVCRGILSTLPDHNVHSFISLSAPQAGQYG--DTDYLKYLFPQFVKSNLFHVCYTAVGQKISI-CNYWNDPHHRDMYINSSDYLALLNNERPNPNSTAWKQNFLRIKKLVLIGGPDDGVITPWQSSQFGFYD--DNETVVEMKNQKVFLMDLFGLKTLSARGDLALCSVEG 265          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Xenopus
Match: ppt1 (palmitoyl-protein thioesterase 1 [Source:NCBI gene;Acc:448650])

HSP 1 Score: 342.813 bits (878), Expect = 7.163e-116
Identity = 162/280 (57.86%), Postives = 203/280 (72.50%), Query Frame = 3
Query:  135 SNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFRVF-NLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFLS 971
            + A+P P+V+WHGMGD+CCNP S+G ++  +E+ IPG+YVLSL IG +  ED  N FF+NVN Q+   C  +A + NL+NG+N++GFSQGGQFLRAV QRCP     NLISIGGQHQGV+GFP CP     +C+LIRKLL++GAY   VQ + VQAEYWHDP+ E+ Y+  SIFLA+IN  +  N++YK  L  L  FVMVKFLNDTMV P D+EWF FY PGQ ++   L  S +Y +D LGLK++    RL FL V G HLQFS+EWF  NII PFLS
Sbjct:   21 TEADPVPLVIWHGMGDSCCNPFSMGAVKKMVEEQIPGIYVLSLEIGNSIPEDMKNSFFLNVNEQVDGVCKELAQNPNLKNGYNSMGFSQGGQFLRAVAQRCPSPPMKNLISIGGQHQGVYGFPRCPGEISHMCDLIRKLLNYGAYTREVQDYLVQAEYWHDPINEEQYRNGSIFLADINQERHVNVSYKQNLQLLEKFVMVKFLNDTMVDPPDTEWFGFYRPGQSKETITLQESNLYMEDRLGLKEMEKAGRLVFLGVEGNHLQFSKEWFNKNII-PFLS 299          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Xenopus
Match: ppt1 (palmitoyl-protein thioesterase 1 [Source:NCBI gene;Acc:448650])

HSP 1 Score: 340.887 bits (873), Expect = 3.995e-115
Identity = 161/279 (57.71%), Postives = 202/279 (72.40%), Query Frame = 3
Query:  135 SNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFRVF-NLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            + A+P P+V+WHGMGD+CCNP S+G ++  +E+ IPG+YVLSL IG +  ED  N FF+NVN Q+   C  +A + NL+NG+N++GFSQGGQFLRAV QRCP     NLISIGGQHQGV+GFP CP     +C+LIRKLL++GAY   VQ + VQAEYWHDP+ E+ Y+  SIFLA+IN  +  N++YK  L  L  FVMVKFLNDTMV P D+EWF FY PGQ ++   L  S +Y +D LGLK++    RL FL V G HLQFS+EWF  NII PFL
Sbjct:   27 TEADPVPLVIWHGMGDSCCNPFSMGAVKKMVEEQIPGIYVLSLEIGNSIPEDMKNSFFLNVNEQVDGVCKELAQNPNLKNGYNSMGFSQGGQFLRAVAQRCPSPPMKNLISIGGQHQGVYGFPRCPGEISHMCDLIRKLLNYGAYTREVQDYLVQAEYWHDPINEEQYRNGSIFLADINQERHVNVSYKQNLQLLEKFVMVKFLNDTMVDPPDTEWFGFYRPGQSKETITLQESNLYMEDRLGLKEMEKAGRLVFLGVEGNHLQFSKEWFNKNII-PFL 304          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Xenopus
Match: ppt1 (palmitoyl-protein thioesterase 1 [Source:NCBI gene;Acc:448650])

HSP 1 Score: 297.745 bits (761), Expect = 1.346e-98
Identity = 136/239 (56.90%), Postives = 174/239 (72.80%), Query Frame = 3
Query:  135 SNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFRVF-NLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQ 848
            + A+P P+V+WHGMGD+CCNP S+G ++  +E+ IPG+YVLSL IG +  ED  N FF+NVN Q+   C  +A + NL+NG+N++GFSQGGQFLRAV QRCP     NLISIGGQHQGV+GFP CP     +C+LIRKLL++GAY   VQ + VQAEYWHDP+ E+ Y+  SIFLA+IN  +  N++YK  L  L  FVMVKFLNDTMV P D+EWF FY PGQ ++   L  S +Y +
Sbjct:   23 TEADPVPLVIWHGMGDSCCNPFSMGAVKKMVEEQIPGIYVLSLEIGNSIPEDMKNSFFLNVNEQVDGVCKELAQNPNLKNGYNSMGFSQGGQFLRAVAQRCPSPPMKNLISIGGQHQGVYGFPRCPGEISHMCDLIRKLLNYGAYTREVQDYLVQAEYWHDPINEEQYRNGSIFLADINQERHVNVSYKQNLQLLEKFVMVKFLNDTMVDPPDTEWFGFYRPGQSKETITLQESNLYME 261          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Xenopus
Match: ppt1 (palmitoyl-protein thioesterase 1 [Source:NCBI gene;Acc:448650])

HSP 1 Score: 297.745 bits (761), Expect = 2.013e-98
Identity = 136/239 (56.90%), Postives = 174/239 (72.80%), Query Frame = 3
Query:  135 SNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFRVF-NLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQ 848
            + A+P P+V+WHGMGD+CCNP S+G ++  +E+ IPG+YVLSL IG +  ED  N FF+NVN Q+   C  +A + NL+NG+N++GFSQGGQFLRAV QRCP     NLISIGGQHQGV+GFP CP     +C+LIRKLL++GAY   VQ + VQAEYWHDP+ E+ Y+  SIFLA+IN  +  N++YK  L  L  FVMVKFLNDTMV P D+EWF FY PGQ ++   L  S +Y +
Sbjct:   21 TEADPVPLVIWHGMGDSCCNPFSMGAVKKMVEEQIPGIYVLSLEIGNSIPEDMKNSFFLNVNEQVDGVCKELAQNPNLKNGYNSMGFSQGGQFLRAVAQRCPSPPMKNLISIGGQHQGVYGFPRCPGEISHMCDLIRKLLNYGAYTREVQDYLVQAEYWHDPINEEQYRNGSIFLADINQERHVNVSYKQNLQLLEKFVMVKFLNDTMVDPPDTEWFGFYRPGQSKETITLQESNLYME 259          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Xenopus
Match: mxi1 (MAX interactor 1, dimerization protein [Source:Xenbase;Acc:XB-GENE-493086])

HSP 1 Score: 63.5438 bits (153), Expect = 1.388e-10
Identity = 68/264 (25.76%), Postives = 113/264 (42.80%), Query Frame = 3
Query:  153 PIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFG--------FPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQ-KFNMT-YKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVG 911
            P+++ HG+ D+  N      +  YI ++ PG  V  L +  N  ++SL   +  V    +    I+ N    ++G + + +SQGG   R ++Q  P   V   IS+     G +G        FP    S     NL R       Y    Q  S+   +W+DP    IY   S FLA +N+ + + N T +K     L   V++   +D ++ P +S  F FY+  + E +  +    +Y  D  GL+ +     +   SV G
Sbjct:   32 PVIVIHGLFDSSAN---FKNLLQYINESHPGTNVTVLDLFDN--KESLQPLWKQVQGFKEAIYPIMQNAG--RDGVHLLCYSQGGLICRGLLQTMPDHNVDTFISLSSPQMGQYGDTDYLRYLFPKYVKS-----NLYRL-----CYTQLGQTFSI-CNFWNDPHHHGIYVNVSDFLAPLNSERPEPNATDWKKNFLRLRKMVLIGGPDDGVITPWESSHFGFYD--ENETVLEMKYQMVYQDDTFGLRSMDYRGAVSVYSVPG 275          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Mouse
Match: Ppt1 (palmitoyl-protein thioesterase 1 [Source:MGI Symbol;Acc:MGI:1298204])

HSP 1 Score: 340.502 bits (872), Expect = 5.162e-115
Identity = 160/280 (57.14%), Postives = 196/280 (70.00%), Query Frame = 3
Query:  132 LSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            L   +P P+V+WHGMGD+CCNP+S+G I+  +EK IPG+YVLSL IG N  ED  N FF+NVN Q+ M C I+  D  LQ G+NAIGFSQGGQFLRAV QRCP   +  LIS+GGQHQGVFG P CP     IC+ IRK L+ GAY   VQ   VQA+YWHDP+KE +Y+  SIFLA+IN  +  N +YK  L  L  FVMVKF ND++V P DSEWF FY  GQ ++  PL  ST+YT+D LGLK++    +L FL+  G HLQ S+EWF  +II PFL
Sbjct:   27 LDPPSPPPLVIWHGMGDSCCNPMSMGVIKKMVEKEIPGIYVLSLEIGKNMMEDVENSFFLNVNVQVNMVCQILEKDPKLQQGYNAIGFSQGGQFLRAVAQRCPTPPMMTLISVGGQHQGVFGLPRCPGESSHICDFIRKSLNAGAYSKLVQERLVQAQYWHDPIKESVYRNYSIFLADINQERCVNESYKKNLMALKKFVMVKFFNDSIVDPVDSEWFGFYRSGQAKETIPLQESTLYTEDRLGLKKMDKAGKLVFLAKEGDHLQISKEWFTAHII-PFL 305          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Mouse
Match: Ppt1 (palmitoyl-protein thioesterase 1 [Source:MGI Symbol;Acc:MGI:1298204])

HSP 1 Score: 206.838 bits (525), Expect = 2.050e-64
Identity = 93/158 (58.86%), Postives = 113/158 (71.52%), Query Frame = 3
Query:  132 LSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPF-RVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAE 602
            L   +P P+V+WHGMGD+CCNP+S+G I+  +EK IPG+YVLSL IG N  ED  N FF+NVN Q+ M C I+  D  LQ G+NAIGFSQGGQFLRAV QRCP   +  LIS+GGQHQGVFG P CP     IC+ IRK L+ GAY   VQ  +++AE
Sbjct:   27 LDPPSPPPLVIWHGMGDSCCNPMSMGVIKKMVEKEIPGIYVLSLEIGKNMMEDVENSFFLNVNVQVNMVCQILEKDPKLQQGYNAIGFSQGGQFLRAVAQRCPTPPMMTLISVGGQHQGVFGLPRCPGESSHICDFIRKSLNAGAYSKLVQERTLEAE 184          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Mouse
Match: Ppt1 (palmitoyl-protein thioesterase 1 [Source:MGI Symbol;Acc:MGI:1298204])

HSP 1 Score: 200.29 bits (508), Expect = 3.175e-62
Identity = 91/153 (59.48%), Postives = 108/153 (70.59%), Query Frame = 3
Query:  132 LSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPF-RVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRH 587
            L   +P P+V+WHGMGD+CCNP+S+G I+  +EK IPG+YVLSL IG N  ED  N FF+NVN Q+ M C I+  D  LQ G+NAIGFSQGGQFLRAV QRCP   +  LIS+GGQHQGVFG P CP     IC+ IRK L+ GAY   VQ  
Sbjct:   27 LDPPSPPPLVIWHGMGDSCCNPMSMGVIKKMVEKEIPGIYVLSLEIGKNMMEDVENSFFLNVNVQVNMVCQILEKDPKLQQGYNAIGFSQGGQFLRAVAQRCPTPPMMTLISVGGQHQGVFGLPRCPGESSHICDFIRKSLNAGAYSKLVQER 179          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Mouse
Match: Ppt2 (palmitoyl-protein thioesterase 2 [Source:MGI Symbol;Acc:MGI:1860075])

HSP 1 Score: 61.2326 bits (147), Expect = 6.929e-10
Identity = 71/286 (24.83%), Postives = 114/286 (39.86%), Query Frame = 3
Query:  153 PIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFG--------FPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKF--NMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVG-GHLQF-SEEWFVTNIIKPFLS 971
            P+++ HG+ D+     S   +  YI +T  G  V  L +      +SL   +  V    +    I+        G + I +SQGG   RA++       V + IS+     G +G        FP    S     NL R       Y  + Q  S+   YWHDP  +D+Y   S FLA IN  +       ++     +   V++   +D ++ P  S +F FY+    E +  +    +Y +D  GLK L     +    + G  H  + S        I+P+LS
Sbjct:   38 PVIVVHGLFDSS---YSFRHLLDYINETHTGTVVTVLDLFD--GRESLRPLWEQVQGFREAVVPIM---EKAPEGVHLICYSQGGLVCRALLSVMDNHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRS-----NLYRV-----CYSPWGQEFSI-CNYWHDPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRVGRLVLIGGPDDGVITPWQSSFFGFYD--ANETVLEMEEQPVYLRDSFGLKTLLARGAIVRCPMAGISHTTWHSNRTLYDTCIEPWLS 302          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Mouse
Match: Ppt2 (palmitoyl-protein thioesterase 2 [Source:MGI Symbol;Acc:MGI:1860075])

HSP 1 Score: 61.2326 bits (147), Expect = 6.929e-10
Identity = 71/286 (24.83%), Postives = 114/286 (39.86%), Query Frame = 3
Query:  153 PIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFG--------FPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKF--NMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVG-GHLQF-SEEWFVTNIIKPFLS 971
            P+++ HG+ D+     S   +  YI +T  G  V  L +      +SL   +  V    +    I+        G + I +SQGG   RA++       V + IS+     G +G        FP    S     NL R       Y  + Q  S+   YWHDP  +D+Y   S FLA IN  +       ++     +   V++   +D ++ P  S +F FY+    E +  +    +Y +D  GLK L     +    + G  H  + S        I+P+LS
Sbjct:   38 PVIVVHGLFDSS---YSFRHLLDYINETHTGTVVTVLDLFD--GRESLRPLWEQVQGFREAVVPIM---EKAPEGVHLICYSQGGLVCRALLSVMDNHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRS-----NLYRV-----CYSPWGQEFSI-CNYWHDPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRVGRLVLIGGPDDGVITPWQSSFFGFYD--ANETVLEMEEQPVYLRDSFGLKTLLARGAIVRCPMAGISHTTWHSNRTLYDTCIEPWLS 302          
BLAST of Palmitoyl-protein thioesterase 1 vs. UniProt/SwissProt
Match: sp|P45478|PPT1_BOVIN (Palmitoyl-protein thioesterase 1 OS=Bos taurus OX=9913 GN=PPT1 PE=1 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 3.066e-117
Identity = 164/280 (58.57%), Postives = 198/280 (70.71%), Query Frame = 3
Query:  132 LSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            L    P P+V+WHGMGD+CCNPLS+G I+  +EK IPG++VLSL IG    ED  N FF+NVN+Q+   C I+A D  LQ G+NA+GFSQGGQFLRAV QRCP   + NLIS+GGQHQGVFG P CP     IC+ IRK L+ GAY   +Q   VQAEYWHDP++EDIY+  SIFLA+IN  +  N +YK  L  L  FVMVKFLNDT+V P DSEWF FY  GQ ++  PL  ST+YTQD LGLK +    +L FL++ G HLQ SEEWF  +II PFL
Sbjct:   27 LDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIHVLSLEIGKTLREDVENSFFLNVNSQVTTVCQILAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMVNLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYNKAIQERLVQAEYWHDPIREDIYRNHSIFLADINQERGVNESYKKNLMALKKFVMVKFLNDTIVDPVDSEWFGFYRSGQAKETIPLQESTLYTQDRLGLKAMDKAGQLVFLALEGDHLQLSEEWFYAHII-PFL 305          
BLAST of Palmitoyl-protein thioesterase 1 vs. UniProt/SwissProt
Match: sp|Q8HXW6|PPT1_MACFA (Palmitoyl-protein thioesterase 1 OS=Macaca fascicularis OX=9541 GN=PPT1 PE=2 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 7.989e-117
Identity = 162/280 (57.86%), Postives = 198/280 (70.71%), Query Frame = 3
Query:  132 LSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            L    P P+V+WHGMGD+CCNPLS+G I+  +EK IPG+YVLSL IG    ED  N FF+NVN+Q+   C  +A D  LQ G+NA+GFSQGGQFLRAV QRCP   + NLIS+GGQHQGVFG P CP     IC+ IRK L+ GAY   VQ   VQAEYWHDP+KED+Y+  SIFLA+IN  +  N +YK  L  L  FVMVKFLND++V P DSEWF FY  GQ ++  PL  +++YTQD LGLK++ +  +L FL+  G HLQ SEEWF  +II PFL
Sbjct:   27 LDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQTLAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHII-PFL 305          
BLAST of Palmitoyl-protein thioesterase 1 vs. UniProt/SwissProt
Match: sp|P50897|PPT1_HUMAN (Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1 PE=1 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.083e-116
Identity = 162/280 (57.86%), Postives = 198/280 (70.71%), Query Frame = 3
Query:  132 LSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            L    P P+V+WHGMGD+CCNPLS+G I+  +EK IPG+YVLSL IG    ED  N FF+NVN+Q+   C  +A D  LQ G+NA+GFSQGGQFLRAV QRCP   + NLIS+GGQHQGVFG P CP     IC+ IRK L+ GAY   VQ   VQAEYWHDP+KED+Y+  SIFLA+IN  +  N +YK  L  L  FVMVKFLND++V P DSEWF FY  GQ ++  PL  +++YTQD LGLK++ +  +L FL+  G HLQ SEEWF  +II PFL
Sbjct:   27 LDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHII-PFL 305          
BLAST of Palmitoyl-protein thioesterase 1 vs. UniProt/SwissProt
Match: sp|P45479|PPT1_RAT (Palmitoyl-protein thioesterase 1 OS=Rattus norvegicus OX=10116 GN=Ppt1 PE=1 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 4.572e-115
Identity = 160/280 (57.14%), Postives = 199/280 (71.07%), Query Frame = 3
Query:  132 LSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            L   +P P+V+WHGMGD+CCNP+S+G I+  +EK IPG+YVLSL IG N  ED  N FF+NVN Q+ MAC I+  D  LQ+G+NAIGFSQGGQFLRAV QRCP   +  LIS+GGQHQGVFG P CP     IC+ IRK L+ GAY   VQ   VQA+YWHDP+KE++Y+  SIFLA+IN  +  N +YK  L  L  FVMVKF ND++V P DSEWF FY  GQ ++  PL  +T+YT+D LGLK++    +L FL+  G HLQ S+EWF  +II PFL
Sbjct:   27 LDPPSPPPLVIWHGMGDSCCNPMSMGSIKKMVEKEIPGIYVLSLEIGKNMVEDVENSFFLNVNLQVGMACQILEKDPKLQHGYNAIGFSQGGQFLRAVAQRCPTPPMMTLISVGGQHQGVFGLPRCPGESSHICDFIRKSLNAGAYSKVVQERLVQAQYWHDPIKEEVYRNCSIFLADINQERHINESYKENLMALKKFVMVKFFNDSIVDPVDSEWFGFYRSGQAKETIPLQETTLYTEDRLGLKKMDKAGKLVFLAKEGDHLQISKEWFTAHII-PFL 305          
BLAST of Palmitoyl-protein thioesterase 1 vs. UniProt/SwissProt
Match: sp|O88531|PPT1_MOUSE (Palmitoyl-protein thioesterase 1 OS=Mus musculus OX=10090 GN=Ppt1 PE=1 SV=2)

HSP 1 Score: 340.502 bits (872), Expect = 3.611e-114
Identity = 160/280 (57.14%), Postives = 196/280 (70.00%), Query Frame = 3
Query:  132 LSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            L   +P P+V+WHGMGD+CCNP+S+G I+  +EK IPG+YVLSL IG N  ED  N FF+NVN Q+ M C I+  D  LQ G+NAIGFSQGGQFLRAV QRCP   +  LIS+GGQHQGVFG P CP     IC+ IRK L+ GAY   VQ   VQA+YWHDP+KE +Y+  SIFLA+IN  +  N +YK  L  L  FVMVKF ND++V P DSEWF FY  GQ ++  PL  ST+YT+D LGLK++    +L FL+  G HLQ S+EWF  +II PFL
Sbjct:   27 LDPPSPPPLVIWHGMGDSCCNPMSMGVIKKMVEKEIPGIYVLSLEIGKNMMEDVENSFFLNVNVQVNMVCQILEKDPKLQQGYNAIGFSQGGQFLRAVAQRCPTPPMMTLISVGGQHQGVFGLPRCPGESSHICDFIRKSLNAGAYSKLVQERLVQAQYWHDPIKESVYRNYSIFLADINQERCVNESYKKNLMALKKFVMVKFFNDSIVDPVDSEWFGFYRSGQAKETIPLQESTLYTEDRLGLKKMDKAGKLVFLAKEGDHLQISKEWFTAHII-PFL 305          
BLAST of Palmitoyl-protein thioesterase 1 vs. TrEMBL
Match: A0A210PJJ1 (Palmitoyl-protein thioesterase 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT03032 PE=4 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 4.567e-121
Identity = 168/276 (60.87%), Postives = 209/276 (75.72%), Query Frame = 3
Query:  150 TPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFLSK 974
            TP+V+WHGMGD+CCNP S+G I+  IEK + GVYV SL IG N A D+ NGFFMN N+QI +AC +IA DS LQNG+++IGFSQGGQFLRAV QRCP   + NL+S+GGQHQGVFGFP CP ++  +C+ +RKLL+ GAY + VQ     AEYW DP  ED YK+ S+FLA+IN  +  N TYK  L  L NFVM+KF  DTMV PK+SEWF FY+PGQ++++  L NS +YT+D LGLK +  TNRL FLS  G HLQF+EEWF+ NI+KPFLS+
Sbjct:   23 TPVVIWHGMGDSCCNPESMGSIKKIIEKEVKGVYVNSLMIGSNIAADTTNGFFMNANDQITLACSLIAKDSKLQNGYHSIGFSQGGQFLRAVAQRCPNPPMLNLVSVGGQHQGVFGFPKCPGNNSVVCDEVRKLLNLGAYVSLVQ-----AEYWQDPFNEDEYKQYSVFLADINQERTKNATYKANLQKLKNFVMLKFTEDTMVQPKESEWFGFYKPGQDKEVVSLNNSQLYTEDWLGLKAMAATNRLHFLSYPGDHLQFTEEWFIANIVKPFLSQ 293          
BLAST of Palmitoyl-protein thioesterase 1 vs. TrEMBL
Match: H3B5N4 (Palmitoyl-protein thioesterase 1 OS=Latimeria chalumnae OX=7897 GN=PPT1 PE=4 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.918e-120
Identity = 167/281 (59.43%), Postives = 207/281 (73.67%), Query Frame = 3
Query:  129 ALSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPF-RVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            A  N   TP+V+WHGMGD+CCNPLS+G I+  +E+ IPG+YVLSL IG +  ED  N FFMNVN+Q+K+ CD +A D  LQNG+N++GFSQGGQFLRAV +RCP  R+ NLISIGGQHQGV+G P+CP     ICN IRK+L+ GAY   +Q H VQAEYWHDPL E++Y+  SIFLA+IN  +  N +YK    NLT FVMVKFL D+MV P DSEWF FY+PGQ +    L  S +YT+D LGLK++    +L FLSV G HLQF+EEWF  NI+ P+L
Sbjct:   23 AAINGTITPLVIWHGMGDSCCNPLSMGAIKKMVEQKIPGIYVLSLEIGNSITEDMENSFFMNVNDQVKLVCDQLAKDPKLQNGYNSMGFSQGGQFLRAVAERCPSPRMLNLISIGGQHQGVYGLPHCPGESSHICNWIRKMLNLGAYTEAIQEHLVQAEYWHDPLNEELYRNNSIFLADINQEKTINASYKKNFMNLTKFVMVKFLKDSMVCPMDSEWFGFYKPGQAKDTYTLQESPLYTEDRLGLKEMEKAGKLVFLSVDGDHLQFTEEWFYANIL-PYL 302          
BLAST of Palmitoyl-protein thioesterase 1 vs. TrEMBL
Match: A0A401SBH8 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0006175 PE=4 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 4.771e-120
Identity = 168/281 (59.79%), Postives = 210/281 (74.73%), Query Frame = 3
Query:  129 ALSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPF-RVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            A ++  P P+V+WHGMGD+CCNPLS+G I+  +E+ I G+YVLSL IG + AED  N FFMNVN+Q+++ C+I++ D NLQNG+NA+GFSQGGQFLRAV QRCP   +  LI+ GGQHQGV+G P CP     ICNLIRK+L+ GAY + +Q H VQAEYWHDPL ED+Y+EKSIFLA+IN  +  N +YK+ L  L   VMVKFLNDTMV P DSEWF FY+ GQ +    L  S +Y +D LGLK +    +L+FL+V G HLQFSEEWFVTNII P+L
Sbjct:   27 ASNDTGPVPVVIWHGMGDSCCNPLSMGFIKKLVEQEITGIYVLSLEIGNSIAEDMENSFFMNVNDQVELVCNILSKDKNLQNGYNAMGFSQGGQFLRAVAQRCPSPAMLKLITFGGQHQGVYGLPRCPGETSQICNLIRKMLNVGAYSSPIQDHLVQAEYWHDPLNEDLYREKSIFLADINQERGINESYKVNLMKLKKLVMVKFLNDTMVDPVDSEWFGFYKVGQAKDTYSLQESALYQEDRLGLKTMDKAGKLQFLTVNGDHLQFSEEWFVTNII-PYL 306          
BLAST of Palmitoyl-protein thioesterase 1 vs. TrEMBL
Match: A0A1I8HWS3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029227g3 PE=4 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 6.158e-118
Identity = 160/275 (58.18%), Postives = 208/275 (75.64%), Query Frame = 3
Query:  150 TPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFLS 971
            TPIV+WHGMGD+CCNPLSLG IQ  +EK +PGVYV S++IG N  ED  NGF  N N Q++  C  I  +  L+ G+N+IGFSQG QFLRA+VQRCP   + NL+SIGGQHQGV+GFP CP ++ T+CN +R+LL+ GAY +FVQ + +QA+YWHDPL E+ YK+KSIF+A+INN    N TY   L  L N V+VKFL+D+MV P++SEWF FY+PGQ++ + PL N+T+YTQD LGLK +    +LKFL+  G HLQF++ WF  NI+KP+LS
Sbjct:   22 TPIVLWHGMGDSCCNPLSLGAIQRMLEKQLPGVYVYSVQIGNNMVEDIENGFLSNANKQVEQVCQTIRANPKLKGGYNSIGFSQGAQFLRALVQRCPNPPMRNLVSIGGQHQGVYGFPRCPGTNVTLCNYVRELLNLGAYVSFVQNNLIQAQYWHDPLNEEEYKQKSIFIADINNELTVNRTYAANLQTLKNLVLVKFLSDSMVQPRESEWFGFYQPGQDKMVLPLRNTTLYTQDRLGLKAMDAAGKLKFLACEGDHLQFTDTWFTQNIVKPYLS 296          
BLAST of Palmitoyl-protein thioesterase 1 vs. TrEMBL
Match: A0A267DQY9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029227g4 PE=4 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 8.445e-118
Identity = 159/275 (57.82%), Postives = 208/275 (75.64%), Query Frame = 3
Query:  150 TPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFLS 971
            TPIV+WHGMGD+CCNPLSLG I+  +EK +PGVYV S++IG N  ED  NGF  N N Q++  C  I  D  L+ G+N+IGFSQG QFLRA+VQRCP   + NL+SIGGQHQGV+GFP CP ++ T+CN +R+LL+ GAY +FVQ + +QA+YWHDPL E+ YK+KSIF+A+INN    N +Y   L  L N V+VKFL+D+MV P++SEWF FY+PGQ++ + PL N+T+YTQD LGLK +    +LKFL+  G HLQF++ WF  NI+KP+LS
Sbjct:   22 TPIVLWHGMGDSCCNPLSLGAIKRMLEKQLPGVYVYSVQIGNNMVEDIENGFLSNANKQVEQVCQTIRADPKLKGGYNSIGFSQGAQFLRALVQRCPNPPMRNLVSIGGQHQGVYGFPRCPGTNVTLCNYVRELLNLGAYVSFVQNNLIQAQYWHDPLNEEEYKQKSIFIADINNELTVNRSYAANLQTLKNLVLVKFLSDSMVQPRESEWFGFYQPGQDKTVLPLRNTTLYTQDRLGLKAMDAAGKLKFLACEGDHLQFTDTWFTQNIVKPYLS 296          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Cavefish
Match: ppt1 (palmitoyl-protein thioesterase 1 [Source:NCBI gene;Acc:103041647])

HSP 1 Score: 317.39 bits (812), Expect = 2.911e-106
Identity = 146/281 (51.96%), Postives = 194/281 (69.04%), Query Frame = 3
Query:  129 ALSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            A  + + TP+V+WHGMGD CCNPLS+G I+  +E+ +PG+YVLSL IG    +D+ +GFF +VN Q+   C+ +A D  L+ G+NA+GFSQG QFLRAV QRCP   +  LIS+GGQHQGV+G P CP     IC+ IRK L+ GAY + +Q+H VQA+YWHDPL +D+YK+ S+FLA+IN  +  N TYK  L  L  FVMVKFL D++V P DSEWF F+  GQ EK   L  S +Y +D LGL ++    +L FL+  G HLQFS EWF   ++ P++
Sbjct:   19 ARGSNDTTPLVIWHGMGDNCCNPLSMGAIKKMVEEEVPGIYVLSLMIGKTVVQDTESGFFKDVNEQVSFVCEKLAQDPKLKAGYNAMGFSQGAQFLRAVAQRCPNPPMKTLISVGGQHQGVYGLPRCPGESSHICDWIRKKLNSGAYTDAIQKHLVQAQYWHDPLNDDLYKQHSLFLADINQERVVNQTYKKNLMLLEKFVMVKFLQDSVVDPVDSEWFGFFVTGQAEKTETLQESALYKEDRLGLAEMDKAGKLVFLATDGDHLQFSREWFNAKLL-PYI 298          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Cavefish
Match: zgc:66024 (lysosomal thioesterase PPT2-like [Source:NCBI gene;Acc:103039155])

HSP 1 Score: 61.6178 bits (148), Expect = 3.203e-10
Identity = 61/243 (25.10%), Postives = 109/243 (44.86%), Query Frame = 3
Query:  153 PIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKF-NMT-YKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQL 872
            P+V+ HG+ D    P    ++ ++I +T PG  V ++ +  N A  SL   +  V    K    I+ + ++   G + I FSQGG   R ++   P   V +LI +     G +G        +     I+  +    Y  + Q+ S+   +W+DP +   Y + + +LA +N   K  N+T ++ R   +   V++   +D ++ P  S  F FY+    E +  +     Y  D+ GLK L
Sbjct:   23 PVVIVHGLFD---GPKQFVKLGTFISETHPGTNVTTVDLYDNMA--SLKPLWQQVEGFRKAVLPIMESATD---GIHFICFSQGGLVCRGLLATLPKHNVHSLIFLSSPLAGQYG--ETSYLKKVFPKDIKSGVYRLCYNCWGQKISI-CNFWNDPHQRVKYLKSNTYLALLNGESKTPNITEWRERFLGIKKLVLIGGPDDGVITPWQSSLFGFYD--SNETVVEMRKQRWYQMDVFGLKTL 252          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Cavefish
Match: ENSAMXT00000047534.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:988879:1005621:-1 gene:ENSAMXG00000033770.1 transcript:ENSAMXT00000047534.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 3.027e-6
Identity = 47/182 (25.82%), Postives = 79/182 (43.41%), Query Frame = 3
Query:  153 PIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFG--------FPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINN 671
            P+++ HG+ D+  + ++L R   +I ++ PG  V  + +    A  SL   +  V    +    I+ N ++   G + I +SQGG   R ++   P   V + IS+     G +G        FP            ++  L    Y    QR S+   YW+DP   D+Y   S +LA +NN
Sbjct:   25 PVIIVHGLFDSSSDFITLSR---FINQSHPGTNVTVIDLFDRSA--SLQPLWKQVEGFKEAIYPIMQNAAD---GVHLICYSQGGLVCRGILSTLPDHNVHSFISLSSPQAGQYGDTDYLKYLFPT----------FLKSNLYLICYTAVGQRVSI-CNYWNDPHHRDLYLNSSDYLALLNN 187          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Sea Lamprey
Match: ppt1 (palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile) [Source:ZFIN;Acc:ZDB-GENE-040426-2653])

HSP 1 Score: 326.25 bits (835), Expect = 3.187e-110
Identity = 151/270 (55.93%), Postives = 197/270 (72.96%), Query Frame = 3
Query:  150 TPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNII 956
             P+VMWHGMGD+CCNPLSLG ++  IE+ IP +YVLSL+IG +  +D  NGFFMNVN+Q+ + C ++  D NLQNG+NA+GFSQGGQFLRAV QRCP   + NLIS+GGQHQGV+GFP CP ++  +C+ IRKLL+  AY+  +Q+  VQAEYWHD L E++Y   S+FLA+IN  +  N +Y+  L  L  FVMV F  D MV PK+SEWF FY+PGQ  +I  L +S +YT+D LGLK++    +L FLS    HLQF++EWF  NI+
Sbjct:   40 VPLVMWHGMGDSCCNPLSLGSVKKMIERKIPNIYVLSLKIGDSVLQDVTNGFFMNVNDQVDLVCQMLRKDPNLQNGYNAMGFSQGGQFLRAVAQRCPDPPMRNLISVGGQHQGVYGFPKCPGAEYHLCDYIRKLLNKEAYQPQIQKMIVQAEYWHDSLNEELYINNSVFLADINQERVVNPSYRENLKKLNKFVMVMFNQDQMVEPKESEWFGFYKPGQAVEIYKLQDSALYTEDRLGLKEMDQAGKLVFLSSDTDHLQFTDEWFDENIL 309          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Sea Lamprey
Match: zgc:66024 (zgc:66024 [Source:ZFIN;Acc:ZDB-GENE-040426-1511])

HSP 1 Score: 73.559 bits (179), Expect = 7.073e-15
Identity = 75/276 (27.17%), Postives = 120/276 (43.48%), Query Frame = 3
Query:  129 ALSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINN--LQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVG-GHLQFSEEWFV 944
            A+S A   PIV  HG+     +   L R    I +  P   V+S+ I   F   SL   +  V+   +    I+       NG + I +S+GG   RA +   P   V   IS+     G +G P   S    I  L R  +    Y  F Q+ S+   YW+DP+    YK+ + FL  +N+    ++   +K     + N V++    D ++ P  S  FE Y+  ++  I  + N  +YT+D  GL  L +T ++    V G  H  F + ++V
Sbjct:   19 AISTAAYKPIVNVHGLLGKSSDFRVLKR---NIVRAHPNTKVISINIYNGF--KSLQPMWKQVHGLARKLRPIM---KRFPNGIHLICYSEGGLLCRAALYLSPHHNVDAFISLASPQMGEYGVP---SVVRKILPLRRSKVYKFCYNRFGQKLSL-CNYWNDPIHHVQYKKYNKFLPLLNSQIYNQYANVWKRNFLRINNLVLIGSPADGVLKPWQSSLFETYD--KKMNILHMRNQEVYTKDTFGLCSLSETGKITKCVVPGITHSNFLKSYYV 280          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Sea Lamprey
Match: PPT2-EGFL8 (PPT2-EGFL8 readthrough (NMD candidate) [Source:HGNC Symbol;Acc:HGNC:48343])

HSP 1 Score: 49.6766 bits (117), Expect = 4.851e-7
Identity = 46/183 (25.14%), Postives = 75/183 (40.98%), Query Frame = 3
Query:  372 NGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMT--YKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVG 911
            +G + I +SQGG   R V+   P   V   IS+     G +G  N           ++  L    Y    Q  S+   YW DP     Y   S FL+ +NN ++      +K     +   V++   +D ++ P  S  F FY+    E +  + +  +Y +D+ GL+ L +   L    V G
Sbjct:   54 DGVHIICYSQGGLVCRGVLSIMPNHNVDTFISLSSPQAGQYGDTNYLW--WLFPKYVKSTLFHFCYTELGQDVSI-CNYWKDPHHLGEYLNNSQFLSFLNNEREHASAAEWKKNFLRINRLVLIGGPDDGVITPWQSSHFGFYD--GNETVQEMKDQEVYQRDMFGLRTLDERGGLTVYEVPG 231          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Nematostella
Match: EDO39662 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9F2])

HSP 1 Score: 327.405 bits (838), Expect = 3.834e-111
Identity = 156/267 (58.43%), Postives = 197/267 (73.78%), Query Frame = 3
Query:  174 MGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFR-VFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFLS 971
            MGD+CCNPLS+G I+S +EK IPGVYV SL IG N  ED+ NGF MNVN+Q++  C  +A D  LQNG+NA+GFSQGGQFLRAV QRCP   + NLIS GGQHQGV+GFP+CP  + T+CN +R+LL+ GAY +++Q H VQAEYWHDP+ E  Y++KSIFLA+IN  +  N TYK  L  L NFVMV F  DTMV PK+SEWF FY+PGQ +++  L  S +Y +D LGL+ +    +L FLS  G HL+F+ E+F+ NII PFL 
Sbjct:    1 MGDSCCNPLSMGSIKSLVEKNIPGVYVRSLMIGNNVIEDTENGFLMNVNDQVEQVCAKLAKDPKLQNGYNAMGFSQGGQFLRAVAQRCPTPPMLNLISFGGQHQGVYGFPHCPGDNSTLCNYVRELLNIGAYVSWIQDHLVQAEYWHDPMNEKEYRDKSIFLADINQEKTKNPTYKENLMKLKNFVMVMFAKDTMVDPKESEWFGFYKPGQGKELMTLQESLLYKEDWLGLQVMDKAGKLHFLSADGDHLRFTNEFFIKNII-PFLK 266          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Nematostella
Match: EDO31718 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX63])

HSP 1 Score: 69.707 bits (169), Expect = 2.290e-13
Identity = 78/290 (26.90%), Postives = 127/290 (43.79%), Query Frame = 3
Query:  153 PIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAE-DSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNCPSSDETICN-LIRKLLSFGAYENFVQRHSVQ----AEYWHDPLKEDIYKEKSIFLAEINNLQKF----NMTYKIRLSN---LTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVG-GHLQF--SEEWFVTNIIKPFLS 971
            P+++ HG+ D   +   +  +  +I    PG    ++ I   F+E  S    +  V         I+      ++G + IGFSQGG  LR +++  P   V   I++     G +G       D +  N  I   L   AYE F  R +      A YW+DP  + +  E +IFL  INN Q         YK + +N   L N V++   +D ++ P  S  F FY+  Q+  +  +T   +Y  D  GL+ L     +   +  G  H+++  SE+ F    IKP+L+
Sbjct:    3 PVIVLHGILDKASD---MKDLAGFIRSAHPGT---NITIVDMFSELKSFEPLWRQVRGISPKLRPIM---EQAKDGVHMIGFSQGGITLRGIIETMPDHNVDTFIALSSPLMGQYG-------DTSYLNPFIPYKLRKDAYEFFYSRIAQDTLAIANYWNDPYHQKLNMEYNIFLPFINNNQSSAWINETAYKQQKANFLKLKNLVLIGGPDDGVITPWQSSHFGFYD--QDLNVLDMTQQMVYLDDTFGLQTLDKRKAVHMYTFPGIEHVKWHGSEQVF-DKAIKPWLT 273          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Medaka
Match: ppt1 (palmitoyl-protein thioesterase 1 [Source:NCBI gene;Acc:101166727])

HSP 1 Score: 328.561 bits (841), Expect = 1.545e-110
Identity = 150/279 (53.76%), Postives = 195/279 (69.89%), Query Frame = 3
Query:  135 SNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFRVFN-LISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFL 968
            S     P+++WHGMGD+CCNPLS+G I+  IE+ I G+YVLSL IG N  ED+ NGFF++VN+Q+ M C  +A D NLQ G+NA+GFSQG QFLRAV QRCP      LIS+GGQHQGV+G P CP     +C++IR+ L+ GAY + VQ+H VQA+YWHDPL +D+YK+ S+FLA+IN  +  N TYK  L  L  FVMVKFL D++V P D+EWF F + GQ +    L  S +Y QD LGL  +    +L FL+  G HLQFS+EWF  N++ P+L
Sbjct:   26 STNKTVPLILWHGMGDSCCNPLSMGAIKKMIEQEIAGIYVLSLMIGKNVVEDTENGFFLDVNHQVSMVCSQLAQDPNLQGGYNAMGFSQGAQFLRAVAQRCPSPPMKKLISVGGQHQGVYGLPRCPGESSHLCDMIREALNRGAYSDLVQKHLVQAQYWHDPLNDDLYKKHSLFLADINQERSVNETYKKNLQQLEKFVMVKFLQDSVVDPVDTEWFGFLKTGQAKVTETLQESDLYKQDRLGLAAMDKAGKLVFLATEGDHLQFSKEWFDANLL-PYL 303          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Medaka
Match: ppt2 (palmitoyl-protein thioesterase 2 [Source:NCBI gene;Acc:101159364])

HSP 1 Score: 66.2402 bits (160), Expect = 1.016e-11
Identity = 62/251 (24.70%), Postives = 107/251 (42.63%), Query Frame = 3
Query:  153 PIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFG--------FPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKF-NMT-YKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQL 872
            P+++ HG+ D+   P +L  +Q +I ++ PG  V  + +   +  +SL   +  V     +   I+ N ++   G + I +SQGG   R ++   P   V   IS+     G +G        FP C          ++  +    Y    QR S+   YW DP  +D+Y   S +LA +N  +   N T ++     +   V++   +D ++ P  S  F FY+    E +  +     Y  D  GLK L
Sbjct:   41 PVIIVHGLFDS---PKNLLNLQRFISESHPGTNVTIIDLFDGY--ESLKPLWTQVEGFKAVIYPIMQNAAD---GVHFICYSQGGLVCRGILSTLPEHNVHTFISLSSPQAGQYGDTDYFKDVFPEC----------VKSEIYHFCYLGIGQRFSI-CNYWKDPHHKDLYVNVSSYLALLNTEKPHPNATEWRKNFLKIQKLVLIGGPDDGVITPWQSSQFGFYD--DNETVVEMQKQDFYLSDAFGLKTL 270          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Medaka
Match: ENSORLT00000038902.1 (lysosomal thioesterase PPT2-like [Source:NCBI gene;Acc:101157806])

HSP 1 Score: 60.077 bits (144), Expect = 9.855e-10
Identity = 60/250 (24.00%), Postives = 102/250 (40.80%), Query Frame = 3
Query:  153 PIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRI--GGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNC-----PSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFN--MTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQL 872
            P+++ HG+      P S   +  +I+K  PG  V ++ +   GN  E   N     V    K+   I+        G + + FSQGG   R ++   P   V + I++     G FG P+      P S        R+L+    Y   +Q       YW+DP +   Y + S FL  +N  +  +    ++     +   V++   +D ++ P  S +F FY     E +  +   T Y ++  GLK L
Sbjct:   27 PVILVHGI---LSGPRSFKMLTGFIKKAHPGTEVTAIDLFNYGNSTEPMWN----QVEGFGKVIQKIMEKSPE---GVHLLCFSQGGLICRGLLSTLPNHNVHSFIALSSPLAGQFGVPDVLLRYFPLS-------ARELVYLLCYTKDLQESISMCNYWNDPHRRRRYLKYSNFLPLLNGEKPHSKMAAWRKNFLRIKKLVLIGGPDDNVITPWQSSFFGFYN--HNEVVVEMKEQTFYKKNTFGLKTL 257          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Medaka
Match: ENSORLT00000046043.1 (lysosomal thioesterase PPT2-like [Source:NCBI gene;Acc:101157806])

HSP 1 Score: 59.3066 bits (142), Expect = 2.009e-9
Identity = 58/248 (23.39%), Postives = 103/248 (41.53%), Query Frame = 3
Query:  153 PIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNC-----PSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFN--MTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQL 872
            P+++ HG+      P S   +  +I+K  PG  V ++ +  N+  +S    +  V    K+   I+        G + + FSQGG   R ++   P   V + I++     G FG P+      P S        R+L+    Y   +Q       YW+DP +   Y + S FL  +N  +  +    ++     +   V++   +D ++ P  S +F FY     E +  +   T Y ++  GLK L
Sbjct:   27 PVILVHGI---LSGPRSFKMLTGFIKKAHPGTEVTAVDLF-NYG-NSTKPMWKQVEGFGKVIQKIMEKSPE---GVHLLCFSQGGLICRGLLSTLPNHNVHSFIALSSPLAGQFGVPDVLLRYFPLS-------ARELVYLLCYTKDLQESISMCNYWNDPHRRRRYLKYSNFLPLLNGEKPHSKMAAWRKNFLRIKKLVLIGGPDDNVITPWQSSFFGFYN--HNEVVVEMKEQTFYKKNTFGLKTL 257          
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Medaka
Match: ENSORLT00000044300.1 (lysosomal thioesterase PPT2-like [Source:NCBI gene;Acc:101157806])

HSP 1 Score: 59.3066 bits (142), Expect = 2.058e-9
Identity = 58/248 (23.39%), Postives = 103/248 (41.53%), Query Frame = 3
Query:  153 PIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCP-FRVFNLISIGGQHQGVFGFPNC-----PSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFN--MTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQL 872
            P+++ HG+      P S   +  +I+K  PG  V ++ +  N+  +S    +  V    K+   I+        G + + FSQGG   R ++   P   V + I++     G FG P+      P S        R+L+    Y   +Q       YW+DP +   Y + S FL  +N  +  +    ++     +   V++   +D ++ P  S +F FY     E +  +   T Y ++  GLK L
Sbjct:   29 PVILVHGV---LSGPRSFKMLTGFIKKAHPGTEVTAVDLF-NYG-NSTKPMWKQVEGFGKVIQKIMEKSPE---GVHLLCFSQGGLICRGLLSTLPNHNVHSFIALSSPLAGQFGVPDVLLRYFPLS-------ARELVYLLCYTKDLQESISMCNYWNDPHRRRRYLKYSNFLPLLNGEKPHSKMAAWRKNFLRIKKLVLIGGPDDNVITPWQSSFFGFYN--HNEVVVEMKEQTFYKKNTFGLKTL 259          
BLAST of Palmitoyl-protein thioesterase 1 vs. Planmine SMEST
Match: SMESG000036367.1 (SMESG000036367.1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 281/282 (99.65%), Postives = 281/282 (99.65%), Query Frame = 3
Query:  129 ALSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFLSK 974
            ALSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVG HLQFSEEWFVTNIIKPFLSK
Sbjct:   14 ALSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGEHLQFSEEWFVTNIIKPFLSK 295          
BLAST of Palmitoyl-protein thioesterase 1 vs. Planmine SMEST
Match: SMESG000036367.1 (SMESG000036367.1)

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 270/271 (99.63%), Postives = 270/271 (99.63%), Query Frame = 3
Query:  162 MWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFLSK 974
            MWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVG HLQFSEEWFVTNIIKPFLSK
Sbjct:    1 MWHGMGDTCCNPLSLGRIQSYIEKTIPGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAIGFSQGGQFLRAVVQRCPFRVFNLISIGGQHQGVFGFPNCPSSDETICNLIRKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNMTYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTIYTQDLLGLKQLFDTNRLKFLSVVGEHLQFSEEWFVTNIIKPFLSK 271          
The following BLAST results are available for this feature:
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPT12.256e-11757.86palmitoyl-protein thioesterase 1 [Source:HGNC Symb... [more]
PPT12.256e-11757.86palmitoyl-protein thioesterase 1 [Source:HGNC Symb... [more]
PPT11.123e-11457.50palmitoyl-protein thioesterase 1 [Source:HGNC Symb... [more]
PPT11.859e-11152.43palmitoyl-protein thioesterase 1 [Source:HGNC Symb... [more]
PPT14.248e-10255.73palmitoyl-protein thioesterase 1 [Source:HGNC Symb... [more]
back to top
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ppt-11.030e-9752.38Palmitoyl-protein thioesterase 1 [Source:UniProtK... [more]
back to top
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ppt11.514e-8949.82gene:FBgn0030057 transcript:FBtr0345985[more]
Ppt11.514e-8949.82gene:FBgn0030057 transcript:FBtr0071225[more]
Ppt26.245e-1727.72gene:FBgn0032358 transcript:FBtr0080212[more]
back to top
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppt12.161e-10854.38palmitoyl-protein thioesterase 1 (ceroid-lipofusci... [more]
ppt12.161e-10854.38palmitoyl-protein thioesterase 1 (ceroid-lipofusci... [more]
ppt13.565e-7458.29palmitoyl-protein thioesterase 1 (ceroid-lipofusci... [more]
ppt18.437e-7058.18palmitoyl-protein thioesterase 1 (ceroid-lipofusci... [more]
ppt21.537e-1225.39palmitoyl-protein thioesterase 2 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppt17.163e-11657.86palmitoyl-protein thioesterase 1 [Source:NCBI gene... [more]
ppt13.995e-11557.71palmitoyl-protein thioesterase 1 [Source:NCBI gene... [more]
ppt11.346e-9856.90palmitoyl-protein thioesterase 1 [Source:NCBI gene... [more]
ppt12.013e-9856.90palmitoyl-protein thioesterase 1 [Source:NCBI gene... [more]
mxi11.388e-1025.76MAX interactor 1, dimerization protein [Source:Xen... [more]
back to top
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppt15.162e-11557.14palmitoyl-protein thioesterase 1 [Source:MGI Symbo... [more]
Ppt12.050e-6458.86palmitoyl-protein thioesterase 1 [Source:MGI Symbo... [more]
Ppt13.175e-6259.48palmitoyl-protein thioesterase 1 [Source:MGI Symbo... [more]
Ppt26.929e-1024.83palmitoyl-protein thioesterase 2 [Source:MGI Symbo... [more]
Ppt26.929e-1024.83palmitoyl-protein thioesterase 2 [Source:MGI Symbo... [more]
back to top
BLAST of Palmitoyl-protein thioesterase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P45478|PPT1_BOVIN3.066e-11758.57Palmitoyl-protein thioesterase 1 OS=Bos taurus OX=... [more]
sp|Q8HXW6|PPT1_MACFA7.989e-11757.86Palmitoyl-protein thioesterase 1 OS=Macaca fascicu... [more]
sp|P50897|PPT1_HUMAN1.083e-11657.86Palmitoyl-protein thioesterase 1 OS=Homo sapiens O... [more]
sp|P45479|PPT1_RAT4.572e-11557.14Palmitoyl-protein thioesterase 1 OS=Rattus norvegi... [more]
sp|O88531|PPT1_MOUSE3.611e-11457.14Palmitoyl-protein thioesterase 1 OS=Mus musculus O... [more]
back to top
BLAST of Palmitoyl-protein thioesterase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PJJ14.567e-12160.87Palmitoyl-protein thioesterase 1 OS=Mizuhopecten y... [more]
H3B5N41.918e-12059.43Palmitoyl-protein thioesterase 1 OS=Latimeria chal... [more]
A0A401SBH84.771e-12059.79Uncharacterized protein OS=Chiloscyllium punctatum... [more]
A0A1I8HWS36.158e-11858.18Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DQY98.445e-11857.82Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ppt12.911e-10651.96palmitoyl-protein thioesterase 1 [Source:NCBI gene... [more]
zgc:660243.203e-1025.10lysosomal thioesterase PPT2-like [Source:NCBI gene... [more]
ENSAMXT00000047534.13.027e-625.82pep primary_assembly:Astyanax_mexicanus-2.0:8:9888... [more]
back to top
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ppt13.187e-11055.93palmitoyl-protein thioesterase 1 (ceroid-lipofusci... [more]
zgc:660247.073e-1527.17zgc:66024 [Source:ZFIN;Acc:ZDB-GENE-040426-1511][more]
PPT2-EGFL84.851e-725.14PPT2-EGFL8 readthrough (NMD candidate) [Source:HGN... [more]
back to top
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO396623.834e-11158.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317182.290e-1326.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Palmitoyl-protein thioesterase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppt11.545e-11053.76palmitoyl-protein thioesterase 1 [Source:NCBI gene... [more]
ppt21.016e-1124.70palmitoyl-protein thioesterase 2 [Source:NCBI gene... [more]
ENSORLT00000038902.19.855e-1024.00lysosomal thioesterase PPT2-like [Source:NCBI gene... [more]
ENSORLT00000046043.12.009e-923.39lysosomal thioesterase PPT2-like [Source:NCBI gene... [more]
ENSORLT00000044300.12.058e-923.39lysosomal thioesterase PPT2-like [Source:NCBI gene... [more]
back to top
BLAST of Palmitoyl-protein thioesterase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000036367.10.000e+099.65SMESG000036367.1[more]
SMESG000036367.10.000e+099.63SMESG000036367.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012316 ID=SMED30012316|Name=Palmitoyl-protein thioesterase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1322bp
TCAATAACCTTCGTGTTTTAATTAATCGGTTTGTCAGAATATTTTTAAAG
TTACATTAAATATTATTTTTCCGAATTATTTTATTAATAATGATTATTAT
TGTCAAAGTAATTATTTTATTTTTAATTGCTTTGAGTAATGCAAATCCAA
CTCCTATTGTTATGTGGCACGGAATGGGAGATACTTGTTGCAATCCGTTA
AGTTTGGGTAGAATACAATCTTATATCGAAAAAACTATTCCTGGAGTTTA
TGTTTTATCATTACGAATTGGAGGAAACTTTGCTGAAGATTCTCTCAACG
GTTTCTTTATGAATGTAAATAATCAAATTAAAATGGCTTGCGATATTATT
GCAAATGATAGTAATCTACAAAATGGATTTAATGCTATAGGATTTTCACA
AGGTGGTCAGTTTTTGCGAGCTGTGGTTCAAAGATGTCCTTTTCGTGTAT
TCAATTTAATTAGCATAGGAGGCCAGCATCAAGGAGTGTTTGGTTTTCCG
AACTGTCCGTCATCAGATGAAACAATTTGTAATTTAATTAGAAAATTGCT
GAGTTTTGGGGCCTATGAAAACTTTGTTCAACGACATTCGGTTCAAGCAG
AATATTGGCATGATCCTTTAAAAGAAGATATTTACAAAGAAAAGAGTATT
TTTCTTGCTGAAATCAATAATTTACAAAAATTTAATATGACATACAAAAT
AAGATTGTCAAATCTAACCAACTTTGTCATGGTCAAGTTCCTCAATGACA
CAATGGTCATTCCCAAGGATTCCGAGTGGTTTGAATTCTACGAGCCAGGC
CAAGAAGAAAAAATAACACCTTTGACAAATAGCACCATATATACGCAGGA
TTTGTTGGGATTAAAACAATTGTTCGATACAAATCGATTGAAATTTCTAT
CTGTTGTGGGGGGACATTTGCAGTTTTCAGAAGAATGGTTCGTGACAAAT
ATAATAAAGCCATTTTTGTCCAAATAATTAAAGGAAAATTTCGATTTCCA
GTTGATGATTGTCATTTATATTTTCAGATTTTTTATGAATTTTTATGTGA
TTTAGTTCTTATCGATACATTTGATACACTTTTTTGTTTTAATCAGTTAA
CGAATCCCTAACATTTAAACATTTAATTTGTTCTAAATTTGATTAAAGTA
AATTTAAACAGCTTCATAGTCAAATATTGGACTTCAGAAGATCAGTTTAT
AAATTTAAAGTTATTAGGGCAGAGCCTGCGATACTGGTAAGTATAATAAC
TAATTATTTATATTATTAAAAGAACTTTTTTTGGTTTTCACCTCTGATTT
CTTTTTTTATTTATAAATGACA
back to top

protein sequence of SMED30012316-orf-1

>SMED30012316-orf-1 ID=SMED30012316-orf-1|Name=SMED30012316-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=296bp
MIIIVKVIILFLIALSNANPTPIVMWHGMGDTCCNPLSLGRIQSYIEKTI
PGVYVLSLRIGGNFAEDSLNGFFMNVNNQIKMACDIIANDSNLQNGFNAI
GFSQGGQFLRAVVQRCPFRVFNLISIGGQHQGVFGFPNCPSSDETICNLI
RKLLSFGAYENFVQRHSVQAEYWHDPLKEDIYKEKSIFLAEINNLQKFNM
TYKIRLSNLTNFVMVKFLNDTMVIPKDSEWFEFYEPGQEEKITPLTNSTI
YTQDLLGLKQLFDTNRLKFLSVVGGHLQFSEEWFVTNIIKPFLSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR030294PPT1
IPR002472Palm_thioest
IPR029058AB_hydrolase
Vocabulary: molecular function
TermDefinition
GO:0098599palmitoyl hydrolase activity
GO:0008474palmitoyl-(protein) hydrolase activity
GO:0016290palmitoyl-CoA hydrolase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0002084protein depalmitoylation
GO:0006898receptor-mediated endocytosis
GO:0006907pinocytosis
GO:0007042lysosomal lumen acidification
GO:0007399nervous system development
GO:0007420brain development
GO:0015031protein transport
GO:0016042lipid catabolic process
GO:0030308negative regulation of cell growth
GO:0031579membrane raft organization
GO:0043066negative regulation of apoptotic process
GO:0043524negative regulation of neuron apoptotic process
GO:0048260positive regulation of receptor-mediated endocytosis
GO:0048549positive regulation of pinocytosis
GO:0051181cofactor transport
GO:0051186cofactor metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005634nucleus
GO:0005764lysosome
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0008021synaptic vesicle
GO:0030424axon
GO:0045121membrane raft
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002472Palmitoyl protein thioesterasePRINTSPR00414PPTHIESTRASEcoord: 94..110
score: 85.29
coord: 224..242
score: 52.63
coord: 14..36
score: 60.87
coord: 172..191
score: 67.5
coord: 138..157
score: 45.0
coord: 54..73
score: 61.25
coord: 269..287
score: 55.26
IPR002472Palmitoyl protein thioesterasePFAMPF02089Palm_thioestcoord: 22..276
e-value: 3.8E-78
score: 262.7
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 11..295
e-value: 2.2E-110
score: 370.5
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 18..290
NoneNo IPR availablePANTHERPTHR11247PALMITOYL-PROTEIN THIOESTERASE/DOLICHYLDIPHOSPHATASE 1coord: 15..293
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.915
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR030294Palmitoyl-protein thioesterase 1PANTHERPTHR11247:SF8PALMITOYL-PROTEIN THIOESTERASE 1coord: 15..293