DNA-(apurinic or apyrimidinic site) lyase

Overview
NameDNA-(apurinic or apyrimidinic site) lyase
Smed IDSMED30012311
Length (bp)1033
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA-(apurinic or apyrimidinic site) lyase (SMED30012311) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA-(apurinic or apyrimidinic site) lyase (SMED30012311) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA-(apurinic or apyrimidinic site) lyase (SMED30012311) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA-(apurinic or apyrimidinic site) lyase (SMED30012311) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012311

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012311SMESG000036124.1 SmedASXL_011915SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30012311SMESG000036124.1 dd_Smed_v4_11417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30012311SMESG000036124.1 dd_Smed_v6_11417_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30012311SMESG000036124.1 dd_Smed_v4_11417_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012311SMESG000036124.1 SMED_11159_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30012311SMESG000036124.1 SMED_11159_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Human
Match: APEX1 (apurinic/apyrimidinic endodeoxyribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:587])

HSP 1 Score: 312.768 bits (800), Expect = 2.495e-105
Identity = 143/259 (55.21%), Postives = 189/259 (72.97%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L      YWS    K GY+G GL ++  P+ + YGIGD+EHD+EGR I AE+++F  +TAYVPN+GRGLVRL YR+  WD +F  +LK L   KP+++CGDLNV+H+EIDL NPK N K AGFT  ER GF  LL++V L D+FRH+YP+   AYTFW+ M N+RS+N+GWRLDYFL+S  LLP LC+ ++R+  +GSDHCPI LY+  
Sbjct:   61 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQR-WDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL 318          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Human
Match: APEX1 (apurinic/apyrimidinic endodeoxyribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:587])

HSP 1 Score: 312.768 bits (800), Expect = 2.495e-105
Identity = 143/259 (55.21%), Postives = 189/259 (72.97%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L      YWS    K GY+G GL ++  P+ + YGIGD+EHD+EGR I AE+++F  +TAYVPN+GRGLVRL YR+  WD +F  +LK L   KP+++CGDLNV+H+EIDL NPK N K AGFT  ER GF  LL++V L D+FRH+YP+   AYTFW+ M N+RS+N+GWRLDYFL+S  LLP LC+ ++R+  +GSDHCPI LY+  
Sbjct:   61 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQR-WDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL 318          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Human
Match: APEX1 (apurinic/apyrimidinic endodeoxyribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:587])

HSP 1 Score: 312.768 bits (800), Expect = 2.495e-105
Identity = 143/259 (55.21%), Postives = 189/259 (72.97%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L      YWS    K GY+G GL ++  P+ + YGIGD+EHD+EGR I AE+++F  +TAYVPN+GRGLVRL YR+  WD +F  +LK L   KP+++CGDLNV+H+EIDL NPK N K AGFT  ER GF  LL++V L D+FRH+YP+   AYTFW+ M N+RS+N+GWRLDYFL+S  LLP LC+ ++R+  +GSDHCPI LY+  
Sbjct:   61 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQR-WDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL 318          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Human
Match: APEX1 (apurinic/apyrimidinic endodeoxyribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:587])

HSP 1 Score: 232.646 bits (592), Expect = 1.193e-74
Identity = 109/199 (54.77%), Postives = 143/199 (71.86%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYP 802
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L      YWS    K GY+G GL ++  P+ + YGIGD+EHD+EGR I AE+++F  +TAYVPN+GRGLVRL YR+  WD +F  +LK L   KP+++CGDLNV+H+EIDL NPK N K AGFT  ER GF  LL++V L D+FRH+YP
Sbjct:   61 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQR-WDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYP 258          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Human
Match: APEX1 (apurinic/apyrimidinic endodeoxyribonuclease 1 [Source:HGNC Symbol;Acc:HGNC:587])

HSP 1 Score: 185.267 bits (469), Expect = 1.663e-56
Identity = 97/211 (45.97%), Postives = 126/211 (59.72%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNM 838
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L      YWS    K GY+G GL ++  P+ + YGIG                             RGLVRL YR+  WD +F  +LK L   KP+++CGDLNV+H+EIDL NPK N K AGFT  ER GF  LL++V L D+FRH+YP+   AYTFW+ M
Sbjct:   61 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIG-----------------------------RGLVRLEYRQR-WDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYM 241          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Celegans
Match: exo-3 (DNA-(apurinic or apyrimidinic site) lyase [Source:UniProtKB/TrEMBL;Acc:Q564V5])

HSP 1 Score: 231.106 bits (588), Expect = 3.462e-74
Identity = 121/257 (47.08%), Postives = 163/257 (63.42%), Query Frame = 2
Query:  218 KFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVK-SGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSN-SKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
            KFV WNV GLR+C+K    K +  E+ D+V L ETKC E     E  F N  K+   +  K  GYAG GL +K  P+ +  GIGD E D  GR I AE+  FYFI AYVPNSG  LV L  R   W+      +K +D+ KPVI  GDLNV+H EIDL+NP+SN +KTAGFT  ER  F+ +LE +   DTFR ++P     Y+FWS + NSR +++GWRLDY+++S R++  +   ++ +S+MGSDH P+V+ + F
Sbjct:   35 KFVCWNVAGLRACVKKSDFKEVLAEEPDLVFLGETKCKEWPPEMEETFKNYTKTLVVSTEKNGGYAGVGLLSKCAPMKVHKGIGDPEFDTAGRLIIAEFSKFYFIGAYVPNSGAKLVNLEKR-GRWEKLLTEKMKEMDEKKPVIYGGDLNVAHNEIDLKNPESNRNKTAGFTDQERGWFSEMLE-LGFTDTFRAMHPDEK-KYSFWSYLANSRQKDVGWRLDYYVVSNRIMNKVKRSDIMSSVMGSDHAPVVMQIDF 288          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Celegans
Match: exo-3 (DNA-(apurinic or apyrimidinic site) lyase [Source:UniProtKB/TrEMBL;Acc:Q564V5])

HSP 1 Score: 231.106 bits (588), Expect = 3.462e-74
Identity = 121/257 (47.08%), Postives = 163/257 (63.42%), Query Frame = 2
Query:  218 KFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVK-SGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSN-SKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
            KFV WNV GLR+C+K    K +  E+ D+V L ETKC E     E  F N  K+   +  K  GYAG GL +K  P+ +  GIGD E D  GR I AE+  FYFI AYVPNSG  LV L  R   W+      +K +D+ KPVI  GDLNV+H EIDL+NP+SN +KTAGFT  ER  F+ +LE +   DTFR ++P     Y+FWS + NSR +++GWRLDY+++S R++  +   ++ +S+MGSDH P+V+ + F
Sbjct:   35 KFVCWNVAGLRACVKKSDFKEVLAEEPDLVFLGETKCKEWPPEMEETFKNYTKTLVVSTEKNGGYAGVGLLSKCAPMKVHKGIGDPEFDTAGRLIIAEFSKFYFIGAYVPNSGAKLVNLEKR-GRWEKLLTEKMKEMDEKKPVIYGGDLNVAHNEIDLKNPESNRNKTAGFTDQERGWFSEMLE-LGFTDTFRAMHPDEK-KYSFWSYLANSRQKDVGWRLDYYVVSNRIMNKVKRSDIMSSVMGSDHAPVVMQIDF 288          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Celegans
Match: exo-3 (DNA-(apurinic or apyrimidinic site) lyase [Source:UniProtKB/TrEMBL;Acc:Q564V5])

HSP 1 Score: 120.168 bits (300), Expect = 1.302e-32
Identity = 67/144 (46.53%), Postives = 82/144 (56.94%), Query Frame = 2
Query:  218 KFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVK-SGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVI 646
            KFV WNV GLR+C+K    K +  E+ D+V L ETKC E     E  F N  K+   +  K  GYAG GL +K  P+ +  GIGD E D  GR I AE+  FYFI AYVPNSG  LV L  R   W+      +K +D+ KPVI
Sbjct:   35 KFVCWNVAGLRACVKKSDFKEVLAEEPDLVFLGETKCKEWPPEMEETFKNYTKTLVVSTEKNGGYAGVGLLSKCAPMKVHKGIGDPEFDTAGRLIIAEFSKFYFIGAYVPNSGAKLVNLEKR-GRWEKLLTEKMKEMDEKKPVI 177          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Fly
Match: Rrp1 (gene:FBgn0004584 transcript:FBtr0077678)

HSP 1 Score: 301.597 bits (771), Expect = 8.592e-97
Identity = 140/263 (53.23%), Postives = 183/263 (69.58%), Query Frame = 2
Query:  191 FGLLAN--WNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLY 973
            F L A+  +N+K  SWNV GLR+ +K  GL+ +  E+ DI  LQETKC    LP E   L  Y  YW   +  GYAG  +Y+K+ PI+++YGIG++E D+ GR ITAEYE FY I  YVPNSGR LV L  R   W+  F  Y+K LD LKPV++CGD+NVSH  IDLENPK+N+K AGFT +ER+  T LL  +  +DTFRH+YP R GAYTFW+ M N+R+RN+GWRLDY L+S+R +P +   E+R+  +GSDHCPI ++
Sbjct:  417 FALPADKEFNLKICSWNVAGLRAWLKKDGLQLIDLEEPDIFCLQETKCANDQLPEEVTRLPGYHPYWL-CMPGGYAGVAIYSKIMPIHVEYGIGNEEFDDVGRMITAEYEKFYLINVYVPNSGRKLVNLEPRMR-WEKLFQAYVKKLDALKPVVICGDMNVSHMPIDLENPKNNTKNAGFTQEERDKMTELL-GLGFVDTFRHLYPDRKGAYTFWTYMANARARNVGWRLDYCLVSERFVPKVVEHEIRSQCLGSDHCPITIF 676          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Fly
Match: Rrp1 (gene:FBgn0004584 transcript:FBtr0290241)

HSP 1 Score: 301.212 bits (770), Expect = 2.512e-96
Identity = 140/263 (53.23%), Postives = 183/263 (69.58%), Query Frame = 2
Query:  191 FGLLAN--WNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLY 973
            F L A+  +N+K  SWNV GLR+ +K  GL+ +  E+ DI  LQETKC    LP E   L  Y  YW   +  GYAG  +Y+K+ PI+++YGIG++E D+ GR ITAEYE FY I  YVPNSGR LV L  R   W+  F  Y+K LD LKPV++CGD+NVSH  IDLENPK+N+K AGFT +ER+  T LL  +  +DTFRH+YP R GAYTFW+ M N+R+RN+GWRLDY L+S+R +P +   E+R+  +GSDHCPI ++
Sbjct:  444 FALPADKEFNLKICSWNVAGLRAWLKKDGLQLIDLEEPDIFCLQETKCANDQLPEEVTRLPGYHPYWL-CMPGGYAGVAIYSKIMPIHVEYGIGNEEFDDVGRMITAEYEKFYLINVYVPNSGRKLVNLEPRMR-WEKLFQAYVKKLDALKPVVICGDMNVSHMPIDLENPKNNTKNAGFTQEERDKMTELL-GLGFVDTFRHLYPDRKGAYTFWTYMANARARNVGWRLDYCLVSERFVPKVVEHEIRSQCLGSDHCPITIF 703          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Zebrafish
Match: apex1 (APEX nuclease (multifunctional DNA repair enzyme) 1 [Source:NCBI gene;Acc:406730])

HSP 1 Score: 310.071 bits (793), Expect = 1.490e-104
Identity = 142/257 (55.25%), Postives = 190/257 (73.93%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYM 976
            NMK  SWNV+GLR+ +K  GL +++ ED DI+ LQETKC E  LP +   + +Y   YW+ +  K GY+G  +  K  P+N+ YGIG +EHD+EGR ITAE+ +F+ +TAYVPN+ RGLVRL+YRK +WD  F  YL  LD  KP+++CGDLNV+H+EIDL+NPK N K AGFT +ER GFT LLE+    D+FR +YP +  AYTFW+ M N+RS+N+GWRLDYF++S  LLP LC+ ++RN+ MGSDHCPI L++
Sbjct:   54 NMKITSWNVDGLRAWVKKNGLDWVRKEDPDILCLQETKCAEKALPADITGMPEYPHKYWAGSEDKEGYSGVAMLCKTEPLNVTYGIGKEEHDKEGRVITAEFPDFFLVTAYVPNASRGLVRLDYRK-TWDVDFRAYLCGLDARKPLVLCGDLNVAHQEIDLKNPKGNRKNAGFTPEEREGFTQLLEA-GFTDSFRELYPDQAYAYTFWTYMMNARSKNVGWRLDYFVLSSALLPGLCDSKIRNTAMGSDHCPITLFL 308          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Zebrafish
Match: apex1 (APEX nuclease (multifunctional DNA repair enzyme) 1 [Source:NCBI gene;Acc:406730])

HSP 1 Score: 310.071 bits (793), Expect = 1.490e-104
Identity = 142/257 (55.25%), Postives = 190/257 (73.93%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYM 976
            NMK  SWNV+GLR+ +K  GL +++ ED DI+ LQETKC E  LP +   + +Y   YW+ +  K GY+G  +  K  P+N+ YGIG +EHD+EGR ITAE+ +F+ +TAYVPN+ RGLVRL+YRK +WD  F  YL  LD  KP+++CGDLNV+H+EIDL+NPK N K AGFT +ER GFT LLE+    D+FR +YP +  AYTFW+ M N+RS+N+GWRLDYF++S  LLP LC+ ++RN+ MGSDHCPI L++
Sbjct:   54 NMKITSWNVDGLRAWVKKNGLDWVRKEDPDILCLQETKCAEKALPADITGMPEYPHKYWAGSEDKEGYSGVAMLCKTEPLNVTYGIGKEEHDKEGRVITAEFPDFFLVTAYVPNASRGLVRLDYRK-TWDVDFRAYLCGLDARKPLVLCGDLNVAHQEIDLKNPKGNRKNAGFTPEEREGFTQLLEA-GFTDSFRELYPDQAYAYTFWTYMMNARSKNVGWRLDYFVLSSALLPGLCDSKIRNTAMGSDHCPITLFL 308          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Zebrafish
Match: apex1 (APEX nuclease (multifunctional DNA repair enzyme) 1 [Source:NCBI gene;Acc:406730])

HSP 1 Score: 310.457 bits (794), Expect = 3.013e-104
Identity = 142/257 (55.25%), Postives = 190/257 (73.93%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYM 976
            NMK  SWNV+GLR+ +K  GL +++ ED DI+ LQETKC E  LP +   + +Y   YW+ +  K GY+G  +  K  P+N+ YGIG +EHD+EGR ITAE+ +F+ +TAYVPN+ RGLVRL+YRK +WD  F  YL  LD  KP+++CGDLNV+H+EIDL+NPK N K AGFT +ER GFT LLE+    D+FR +YP +  AYTFW+ M N+RS+N+GWRLDYF++S  LLP LC+ ++RN+ MGSDHCPI L++
Sbjct:   84 NMKITSWNVDGLRAWVKKNGLDWVRKEDPDILCLQETKCAEKALPADITGMPEYPHKYWAGSEDKEGYSGVAMLCKTEPLNVTYGIGKEEHDKEGRVITAEFPDFFLVTAYVPNASRGLVRLDYRK-TWDVDFRAYLCGLDARKPLVLCGDLNVAHQEIDLKNPKGNRKNAGFTPEEREGFTQLLEA-GFTDSFRELYPDQAYAYTFWTYMMNARSKNVGWRLDYFVLSSALLPGLCDSKIRNTAMGSDHCPITLFL 338          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Zebrafish
Match: apex1 (APEX nuclease (multifunctional DNA repair enzyme) 1 [Source:NCBI gene;Acc:406730])

HSP 1 Score: 310.457 bits (794), Expect = 3.113e-104
Identity = 142/257 (55.25%), Postives = 190/257 (73.93%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYM 976
            NMK  SWNV+GLR+ +K  GL +++ ED DI+ LQETKC E  LP +   + +Y   YW+ +  K GY+G  +  K  P+N+ YGIG +EHD+EGR ITAE+ +F+ +TAYVPN+ RGLVRL+YRK +WD  F  YL  LD  KP+++CGDLNV+H+EIDL+NPK N K AGFT +ER GFT LLE+    D+FR +YP +  AYTFW+ M N+RS+N+GWRLDYF++S  LLP LC+ ++RN+ MGSDHCPI L++
Sbjct:   85 NMKITSWNVDGLRAWVKKNGLDWVRKEDPDILCLQETKCAEKALPADITGMPEYPHKYWAGSEDKEGYSGVAMLCKTEPLNVTYGIGKEEHDKEGRVITAEFPDFFLVTAYVPNASRGLVRLDYRK-TWDVDFRAYLCGLDARKPLVLCGDLNVAHQEIDLKNPKGNRKNAGFTPEEREGFTQLLEA-GFTDSFRELYPDQAYAYTFWTYMMNARSKNVGWRLDYFVLSSALLPGLCDSKIRNTAMGSDHCPITLFL 339          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Zebrafish
Match: apex1 (APEX nuclease (multifunctional DNA repair enzyme) 1 [Source:NCBI gene;Acc:406730])

HSP 1 Score: 150.214 bits (378), Expect = 9.448e-44
Identity = 71/137 (51.82%), Postives = 96/137 (70.07%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYL 616
            NMK  SWNV+GLR+ +K  GL +++ ED DI+ LQETKC E  LP +   + +Y   YW+ +  K GY+G  +  K  P+N+ YGIG +EHD+EGR ITAE+ +F+ +TAYVPN+ RGLVRL+YRK +WD  F  YL
Sbjct:   53 NMKITSWNVDGLRAWVKKNGLDWVRKEDPDILCLQETKCAEKALPADITGMPEYPHKYWAGSEDKEGYSGVAMLCKTEPLNVTYGIGKEEHDKEGRVITAEFPDFFLVTAYVPNASRGLVRLDYRK-TWDVDFRAYL 188          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Xenopus
Match: apex1 (APEX nuclease (multifunctional DNA repair enzyme) 1 [Source:NCBI gene;Acc:394929])

HSP 1 Score: 301.982 bits (772), Expect = 2.120e-100
Identity = 142/259 (54.83%), Postives = 187/259 (72.20%), Query Frame = 2
Query:  206 NWNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNA-VKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYM 976
             + +K  SWNV+G+R+ IK QGL ++++ED  I+ LQE KC E  LP E K + +Y   YW+    K GY+G  +  K  P+N+ YGIG +EHD+EGR ITAE+++F+ I AYVPNS RGLVRL+YR+  WD  F  YLK LD  KP+I+CGDLNV+H+EIDL+NPK+N KT GFT  ER GF  LL    L D+FR +YP +  AYTFW+ M N+R++N+GWRLDYF++SK L P LC+ ++R+ IMGSDHCPI L M
Sbjct:  105 KYTLKISSWNVDGIRAWIKKQGLNWVREEDPHIMCLQEIKCAEKLLPPEIKDMPEYPHKYWACPDEKEGYSGVAMLCKDKPVNVTYGIGIEEHDKEGRVITAEFDSFFLIAAYVPNSSRGLVRLDYRQR-WDVDFRAYLKGLDSKKPLILCGDLNVAHQEIDLKNPKTNKKTPGFTPQERQGFGELLAEGYL-DSFRELYPDKPSAYTFWTYMMNARAKNVGWRLDYFVLSKALRPALCDSKVRSKIMGSDHCPITLLM 361          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Xenopus
Match: apex2 (apurinic/apyrimidinic endodeoxyribonuclease 2 [Source:NCBI gene;Acc:448512])

HSP 1 Score: 95.5153 bits (236), Expect = 4.263e-21
Identity = 92/318 (28.93%), Postives = 131/318 (41.19%), Query Frame = 2
Query:  215 MKFVSWNVNGLRSCIKAQGLKYLKDE-DADIVALQETKCPESDLPNEAKFLNDYKSYWS-NAVKSGYAGSGLYTK--MNPINIKYGI--------------GDKEH---------DEEGRTITAEY---------ENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKT-----LDKLKPVIVCGDLNVSHKEID----------LENPKSN-------SKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIM-----GSDHCPIVLYMK 979
            MK VSWN+NG+R+     GLK   D  DADI+ LQETK     L   +  +  Y SY+S +  +SGY+G   + K    P   + G+              G+ E          D+EGR +  ++         E    I  Y P   R       RK ++   F   L+T     L K   VI+ GD+N SH+ +D           ENP                  D   G      S    D+FR+ +P +  A+T W +   +R  N G R+DY L +  L+     +E  +SI+     GSDHCP+   MK
Sbjct:    1 MKIVSWNINGIRA--TRVGLKETLDSLDADIICLQETKVTRDLLDEPSAIVEGYNSYFSFSRGRSGYSGVATFCKSSTTPWAAEEGLSGMLCNHTGSIGCYGNTEEFLEEELQSLDQEGRAVLTQHRIRNCEGKEETLTVINVYCP---RADPEKPERK-TYKLRFYRLLQTRAEAILQKGGHVIILGDVNTSHRPLDHCDPTDLETFEENPGRQWLNQFLGDPVPSQKGDSETGTPPSGGSGRFYDSFRYFHPTQRNAFTCWCSASGARQTNYGTRIDYILGNSELV----EREFLDSIIMPEVEGSDHCPVKAVMK 308          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Xenopus
Match: apex2 (apurinic/apyrimidinic endodeoxyribonuclease 2 [Source:NCBI gene;Acc:448512])

HSP 1 Score: 95.5153 bits (236), Expect = 4.485e-21
Identity = 92/319 (28.84%), Postives = 132/319 (41.38%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDE-DADIVALQETKCPESDLPNEAKFLNDYKSYWS-NAVKSGYAGSGLYTK--MNPINIKYGI--------------GDKEH---------DEEGRTITAEY---------ENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKT-----LDKLKPVIVCGDLNVSHKEIDL----------ENPKSN-------SKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIM-----GSDHCPIVLYMK 979
            +MK VSWN+NG+R+     GLK   D  DADI+ LQETK     L   +  +  Y SY+S +  +SGY+G   + K    P   + G+              G+ E          D+EGR +  ++         E    I  Y P   R       RK ++   F   L+T     L K   VI+ GD+N SH+ +D           ENP                  D   G      S    D+FR+ +P +  A+T W +   +R  N G R+DY L +  L+     +E  +SI+     GSDHCP+   MK
Sbjct:   46 SMKIVSWNINGIRA--TRVGLKETLDSLDADIICLQETKVTRDLLDEPSAIVEGYNSYFSFSRGRSGYSGVATFCKSSTTPWAAEEGLSGMLCNHTGSIGCYGNTEEFLEEELQSLDQEGRAVLTQHRIRNCEGKEETLTVINVYCP---RADPEKPERK-TYKLRFYRLLQTRAEAILQKGGHVIILGDVNTSHRPLDHCDPTDLETFEENPGRQWLNQFLGDPVPSQKGDSETGTPPSGGSGRFYDSFRYFHPTQRNAFTCWCSASGARQTNYGTRIDYILGNSELV----EREFLDSIIMPEVEGSDHCPVKAVMK 354          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Xenopus
Match: ENSXETT00000053674.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:60770347:60773049:1 gene:ENSXETG00000017154.1 transcript:ENSXETT00000053674.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 1.984e-9
Identity = 64/256 (25.00%), Postives = 102/256 (39.84%), Query Frame = 2
Query:  215 MKFVSWNVNGLRSCIK-AQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDP-SFLNYLKTL---DKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIV 967
             K +S NV G  S IK  +   +     AD++ LQE     +  P    F   +  +  +   +   G G++       +   I     D EGR          +I AYV      L  + Y   + D   F + L  L   ++  P+I+CGD N+   +       S  +T+         F+ LL S  LID +R   P     ++ +S         +  R+D+  +S  L+P L +  + N I  SDHCPI+
Sbjct:    3 FKILSLNVQGFNSPIKRTKAFTFFNSLQADVICLQEMHFSHTSFPKY--FHRKFSRFILSTSSTKTKGVGIFFHTA---LALTIDKTLIDPEGR----------YIIAYVCIGDSPLTIVTYYTPNIDQIEFFSKLIDLCYSNQQGPLILCGDSNLVWNDRLDRLSLSGKQTSLSALKATRSFSELLNSFSLIDAWREKNP-EVKQFSHYS-----APHKVSSRIDHIFLSPSLVPLLYSSRMLN-ISWSDHCPIL 236          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Xenopus
Match: ENSXETT00000033329.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:64297530:64302659:-1 gene:ENSXETG00000007576.1 transcript:ENSXETT00000033329.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 8.938e-8
Identity = 68/262 (25.95%), Postives = 119/262 (45.42%), Query Frame = 2
Query:  203 ANWNMKFVSWNVNGLRSCIK-AQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYW--SNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEY----ENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVS-HKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPI 964
            +N N   +S+NVNG+   +K AQ ++      A IV LQET   +   PN    L  Y   +  +N +K     +G+ T ++  ++ +   D   D EGR +  +     +       YVPNSG    +++Y +      F+  L+   K   +I+ GD N++ +  +D  + KSN    G    +     ++   ++LID +R I P +     F      S++  +  R+DY   S+R L    + ++ NS + SDH  +
Sbjct:   57 SNMNCNVLSYNVNGINEPVKRAQIMRECIKSKAMIVMLQETHFKQKHTPNIV--LKSYPQVYMSNNPIKK---ATGVLTLIHK-DLPFKYIDSLSDNEGRYLLIKGKLVDQMCTIANVYVPNSG----QISYLRQ-----FMRILENFSK-GSIILGGDFNMALNPLVDSSSKKSNISYKGLKEAK-----SIFAELQLIDVWRAINPKKRDYTHF------SKTFTVYSRIDYIFTSQRWLHLFNSADIGNSHL-SDHASV 290          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Mouse
Match: Apex1 (apurinic/apyrimidinic endonuclease 1 [Source:MGI Symbol;Acc:MGI:88042])

HSP 1 Score: 314.309 bits (804), Expect = 4.389e-106
Identity = 143/259 (55.21%), Postives = 189/259 (72.97%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L      YWS    K GY+G GL ++  P+ + YGIG++EHD+EGR I AE+E+F  +TAYVPN+GRGLVRL YR+  WD +F  +LK L   KP+++CGDLNV+H+EIDL NPK N K AGFT  ER GF  LL++V L D+FRH+YP+   AYTFW+ M N+RS+N+GWRLDYFL+S  LLP LC+ ++R+  +GSDHCPI LY+  
Sbjct:   60 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLTHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFESFVLVTAYVPNAGRGLVRLEYRQR-WDEAFRKFLKDLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL 317          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Mouse
Match: Apex1 (apurinic/apyrimidinic endonuclease 1 [Source:MGI Symbol;Acc:MGI:88042])

HSP 1 Score: 268.47 bits (685), Expect = 1.630e-88
Identity = 130/259 (50.19%), Postives = 170/259 (65.64%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L      YWS    K GY+G GL ++  P+ + YGI                       AYVPN+GRGLVRL YR+  WD +F  +LK L   KP+++CGDLNV+H+EIDL NPK N K AGFT  ER GF  LL++V L D+FRH+YP+   AYTFW+ M N+RS+N+GWRLDYFL+S  LLP LC+ ++R+  +GSDHCPI LY+  
Sbjct:   55 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLTHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGI-----------------------AYVPNAGRGLVRLEYRQR-WDEAFRKFLKDLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL 289          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Mouse
Match: Apex1 (apurinic/apyrimidinic endonuclease 1 [Source:MGI Symbol;Acc:MGI:88042])

HSP 1 Score: 174.866 bits (442), Expect = 5.205e-53
Identity = 82/156 (52.56%), Postives = 111/156 (71.15%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSH 673
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L      YWS    K GY+G GL ++  P+ + YGIG++EHD+EGR I AE+E+F  +TAYVPN+GRGLVRL YR+  WD +F  +LK L   KP+++CGDLNV+H
Sbjct:   60 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLTHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFESFVLVTAYVPNAGRGLVRLEYRQR-WDEAFRKFLKDLASRKPLVLCGDLNVAH 214          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Mouse
Match: Apex1 (apurinic/apyrimidinic endonuclease 1 [Source:MGI Symbol;Acc:MGI:88042])

HSP 1 Score: 129.798 bits (325), Expect = 4.637e-36
Identity = 61/118 (51.69%), Postives = 83/118 (70.34%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRG 559
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L      YWS    K GY+G GL ++  P+ + YGIG++EHD+EGR I AE+E+F  +TAYVPN+GRG
Sbjct:   60 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLTHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFESFVLVTAYVPNAGRG 177          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Mouse
Match: Apex2 (apurinic/apyrimidinic endonuclease 2 [Source:MGI Symbol;Acc:MGI:1924872])

HSP 1 Score: 85.5001 bits (210), Expect = 8.051e-18
Identity = 82/308 (26.62%), Postives = 130/308 (42.21%), Query Frame = 2
Query:  215 MKFVSWNVNGLRSCIKA----------QGLKYLKDE-DADIVALQETKCPESDLPNEAKFLNDY-KSYWSNAVKSGYAGSGLYTK--MNPINIKYGI--------GD---------------KEHDEEGRTITAEYE---------NFYFITAYVPNSGRGLV-RLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADE-RNGFTNLLESVE---------LIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQE-LRNSIMGSDHCPI 964
            ++ VSWN+NG+RS ++             L+ + DE DADIV LQETK     L      +  Y   +  +  +SGY+G   + K    P+  + G+        GD               +  D EGR +  +++             I  Y P++  G   RL ++   +    +     L     VI+ GDLN +H+ ID  +    S    F  D  R     LL +            +D++R+++P +  A+T WS +  +R  N G RLDY L  + L+ +      L   +MGSDHCP+
Sbjct:    2 LRVVSWNINGIRSPLQGLACQEPSSCPTALRRVLDELDADIVCLQETKVTRDVLTEPLAIVEGYNSYFSFSRSRSGYSGVATFCKDSATPVAAEEGLSGVFATLNGDIGCYGNMDEFTQEELRVLDSEGRALLTQHKIRTLEGKEKTLTLINVYCPHADPGKPERLTFKMRFYRLLQMRAEALLAAGSHVIILGDLNTAHRPIDHCD---ASSLECFEEDPGRKWMDGLLSNPGDEAGPHIGLFMDSYRYLHPKQQRAFTCWSVVSGARHLNYGSRLDYVLGDRALVIDTFQASFLLPEVMGSDHCPV 306          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. UniProt/SwissProt
Match: sp|P28352|APEX1_MOUSE (DNA-(apurinic or apyrimidinic site) lyase OS=Mus musculus OX=10090 GN=Apex1 PE=1 SV=2)

HSP 1 Score: 314.309 bits (804), Expect = 3.070e-105
Identity = 143/259 (55.21%), Postives = 189/259 (72.97%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L      YWS    K GY+G GL ++  P+ + YGIG++EHD+EGR I AE+E+F  +TAYVPN+GRGLVRL YR+  WD +F  +LK L   KP+++CGDLNV+H+EIDL NPK N K AGFT  ER GF  LL++V L D+FRH+YP+   AYTFW+ M N+RS+N+GWRLDYFL+S  LLP LC+ ++R+  +GSDHCPI LY+  
Sbjct:   60 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLTHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFESFVLVTAYVPNAGRGLVRLEYRQR-WDEAFRKFLKDLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL 317          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. UniProt/SwissProt
Match: sp|P43138|APEX1_RAT (DNA-(apurinic or apyrimidinic site) lyase OS=Rattus norvegicus OX=10116 GN=Apex1 PE=1 SV=2)

HSP 1 Score: 313.923 bits (803), Expect = 5.292e-105
Identity = 142/259 (54.83%), Postives = 189/259 (72.97%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDY-KSYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L      YWS    K GY+G GL ++  P+ + YGIG++EHD+EGR I AE+E+F  +TAYVPN+GRGLVRL YR+  WD +F  +LK L   KP+++CGDLNV+H+EIDL NPK N K AGFT  ER GF  +L++V L D+FRH+YP+   AYTFW+ M N+RS+N+GWRLDYFL+S  LLP LC+ ++R+  +GSDHCPI LY+  
Sbjct:   60 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLTHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFESFILVTAYVPNAGRGLVRLEYRQR-WDEAFRKFLKDLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGEMLQAVPLADSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL 317          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. UniProt/SwissProt
Match: sp|P23196|APEX1_BOVIN (DNA-(apurinic or apyrimidinic site) lyase OS=Bos taurus OX=9913 GN=APEX1 PE=1 SV=2)

HSP 1 Score: 313.538 bits (802), Expect = 7.182e-105
Identity = 142/259 (54.83%), Postives = 190/259 (73.36%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L+     YWS    K GY+G GL ++  P+ + YGIG++EHD+EGR I AEY+ F  +TAYVPN+GRGLVRL YR+  WD +F  +LK L   KP+++CGDLNV+H+EIDL NPK N K AGFT  ER GF  LL++V L D+FRH+YP+   AYTFW+ M N+RS+N+GWRLDYFL+S+ +LP LC+ ++R+  +GSDHCPI LY+  
Sbjct:   61 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPVELQELSGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEYDAFVLVTAYVPNAGRGLVRLEYRQR-WDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLTDSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSQSVLPALCDSKIRSKALGSDHCPITLYLAL 318          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. UniProt/SwissProt
Match: sp|P27695|APEX1_HUMAN (DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2)

HSP 1 Score: 312.768 bits (800), Expect = 1.198e-104
Identity = 143/259 (55.21%), Postives = 189/259 (72.97%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L      YWS    K GY+G GL ++  P+ + YGIGD+EHD+EGR I AE+++F  +TAYVPN+GRGLVRL YR+  WD +F  +LK L   KP+++CGDLNV+H+EIDL NPK N K AGFT  ER GF  LL++V L D+FRH+YP+   AYTFW+ M N+RS+N+GWRLDYFL+S  LLP LC+ ++R+  +GSDHCPI LY+  
Sbjct:   61 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQR-WDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL 318          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. UniProt/SwissProt
Match: sp|A1YES6|APEX1_GORGO (DNA-(apurinic or apyrimidinic site) lyase OS=Gorilla gorilla gorilla OX=9595 GN=APEX1 PE=3 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 3.719e-104
Identity = 142/259 (54.83%), Postives = 189/259 (72.97%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
             +K  SWNV+GLR+ IK +GL ++K+E  DI+ LQETKC E+ LP E + L      YWS    K GY+G GL ++  P+ + YGIG++EHD+EGR I AE+++F  +TAYVPN+GRGLVRL YR+  WD +F  +LK L   KP+++CGDLNV+H+EIDL NPK N K AGFT  ER GF  LL++V L D+FRH+YP+   AYTFW+ M N+RS+N+GWRLDYFL+S  LLP LC+ ++R+  +GSDHCPI LY+  
Sbjct:   61 TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSYQYWSAPXXKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQR-WDEAFRRFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL 318          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. TrEMBL
Match: A0A3Q0KFT6 (DNA-(apurinic or apyrimidinic site) lyase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 9.609e-125
Identity = 172/317 (54.26%), Postives = 227/317 (71.61%), Query Frame = 2
Query:   32 SKNVSNTKKEPFRQIKITKAKHQDENINNEMIQKTDKTQLYPGNTVVFANPSYFGLLANWNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
            SK  SN  ++   + K      +D+ + +   Q  D    YPG++   ANP    L + WN K VSWNVNG+R+ IK  G++Y+K E+ADI  +QETKCP   +P+EAK +  Y+S+WS+A K+GYAG+ L++K++PI + YGIG K HD+EGR ITAEY+ FY +TAYVPNSG+GL+RL YR+  WDP FL YL+ LD  KPVIVCGDLNV+H+EIDL  P++N KTAGFT  ER+GFT LL S  LIDT+RH YP R G Y+FWS    +RS N GWRLDYFL+S+R+L N+ +QE+R  + GSDHCP+VLY++ 
Sbjct:    3 SKRTSNVSRKKTVEKKPRNQSPKDKGLESPETQNLDWCTRYPGSSPELANP----LSSKWNFKIVSWNVNGIRAVIKNNGMEYIKKENADIFCIQETKCPLHKIPSEAK-VPSYQSFWSSADKAGYAGTALFSKISPIKVTYGIGKKMHDDEGRVITAEYDKFYLVTAYVPNSGQGLIRLPYREKEWDPDFLEYLRKLDSTKPVIVCGDLNVAHEEIDLARPETNHKTAGFTDQERSGFTKLLSSANLIDTYRHFYPDRRGVYSFWSYRTAARSINNGWRLDYFLVSERILANISDQEIRCGVTGSDHCPVVLYLQI 314          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. TrEMBL
Match: A0A095AEP8 (DNA-(apurinic or apyrimidinic site) lyase OS=Schistosoma haematobium OX=6185 GN=MS3_00415 PE=3 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 3.315e-123
Identity = 171/301 (56.81%), Postives = 221/301 (73.42%), Query Frame = 2
Query:   80 ITKAKHQDENINNEMIQKTDKTQLYPGNTVVFANPSYFGLLANWNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
            I K++   + I+ E  Q +D    YPG++   ANP    L   WN K VSWNVNG+R+ IK  G++Y+K E+ADI  +QETKCP   +P+EAK +  Y+S+WS+A K+GYAG+ L++K++PI + YGIG K HDEEGR ITAEY+ FY +TAYVPNSG+GLVRL YR+  WDP FL YL+ LD  KPVIVCGDLNV+H+EIDL  P++N KTAGFT  ER+GFT LL S  LIDT+RH YP R G Y+FWS    +R  N GWRLDYFL+S+R+L N+ +QE+R  + GSDHCP+VLY++ 
Sbjct:    2 ILKSRIYTDKIHVENTQNSDWCTRYPGSSPDLANP----LSPKWNFKIVSWNVNGIRAVIKNNGMEYIKKENADIFCIQETKCPLHKIPSEAK-VPSYQSFWSSADKAGYAGTALFSKISPIKVTYGIGKKLHDEEGRVITAEYDKFYLVTAYVPNSGQGLVRLPYREKEWDPDFLEYLRKLDSTKPVIVCGDLNVAHEEIDLARPETNHKTAGFTDQERSGFTKLLSSANLIDTYRHFYPDRRGVYSFWSYRTGARLINNGWRLDYFLVSERILTNVSDQEIRCGVTGSDHCPVVLYLQI 297          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. TrEMBL
Match: C1L4Q8 (DNA-(apurinic or apyrimidinic site) lyase OS=Schistosoma japonicum OX=6182 GN=APEX1 PE=2 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 3.643e-121
Identity = 172/319 (53.92%), Postives = 224/319 (70.22%), Query Frame = 2
Query:   35 KNVSNTKKEPFRQIKITKAKHQDENINNEMIQKTDKTQL-----YPGNTVVFANPSYFGLLANWNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYM 976
            K +SN  +E     K      +DEN+N+  +++     L     YPG++   A P    L A WN+K VSWNVNG+R+ IK  G++Y+K E+ADI  +QETKCP   +P+EAK L  Y+S+WS+A K+GYAG+ L++K+ P  + YGIG K HDEEGR ITAE++ FY +TAYVPN+G+GL RL YR+  WDP FL YL+ LD  KPVIVCGDLNV+H+EIDL  P +N KTAGFT  ER+GFT LL S  LIDT+RH YP R  AY+FWS    +R  N GWRLDYFL+S+R+L N+ +QE+R  + GSDHCP+VLY+
Sbjct:    4 KRISNVTREKTAVKKPRTKSSKDENLNSPDVEQLKTQNLNWCTKYPGSSPELAKP----LSATWNLKLVSWNVNGIRAVIKNGGMEYIKKENADIFCIQETKCPLHKIPSEAK-LPSYQSFWSSADKAGYAGTALFSKIAPKKVTYGIGRKVHDEEGRVITAEFDRFYLVTAYVPNAGQGLARLPYREKEWDPDFLEYLRKLDATKPVIVCGDLNVAHEEIDLARPDTNHKTAGFTDQERSGFTKLLSSANLIDTYRHFYPDRREAYSFWSYRTGARLINNGWRLDYFLVSQRILANVGDQEIRCGVTGSDHCPVVLYL 317          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. TrEMBL
Match: A0A4Z2CYC3 (DNA-(apurinic or apyrimidinic site) lyase OS=Schistosoma japonicum OX=6182 GN=EWB00_006433 PE=3 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 7.972e-121
Identity = 172/319 (53.92%), Postives = 223/319 (69.91%), Query Frame = 2
Query:   35 KNVSNTKKEPFRQIKITKAKHQDENINNEMIQKTDKTQL-----YPGNTVVFANPSYFGLLANWNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYM 976
            K +SN  +E     K      +DEN+N+  + +     L     YPG++   A P    L A WN+K VSWNVNG+R+ IK  G++Y+K E+ADI  +QETKCP   +P+EAK L  Y+S+WS+A K+GYAG+ L++K+ P  + YGIG K HDEEGR ITAE++ FY +TAYVPN+G+GL RL YR+  WDP FL YL+ LD  KPVIVCGDLNV+H+EIDL  P +N KTAGFT  ER+GFT LL S  LIDT+RH YP R  AY+FWS    +R  N GWRLDYFL+S+R+L N+ +QE+R  + GSDHCP+VLY+
Sbjct:   18 KRISNVTREKTAVKKPRTKSSKDENLNSPDVDQLKTQNLNWCTRYPGSSPELAKP----LSATWNLKLVSWNVNGIRAVIKNGGMEYIKKENADIFCIQETKCPLHKIPSEAK-LPSYQSFWSSADKAGYAGTALFSKIAPKKVTYGIGRKVHDEEGRVITAEFDRFYLVTAYVPNAGQGLARLPYREKEWDPDFLEYLRKLDATKPVIVCGDLNVAHEEIDLARPDTNHKTAGFTDQERSGFTKLLSSANLIDTYRHFYPDRREAYSFWSYRTGARLINNGWRLDYFLVSQRILANVSDQEIRCGVTGSDHCPVVLYL 331          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. TrEMBL
Match: A0A0X3Q412 (DNA-(apurinic or apyrimidinic site) lyase OS=Schistocephalus solidus OX=70667 GN=APEX1 PE=3 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 6.615e-118
Identity = 170/324 (52.47%), Postives = 222/324 (68.52%), Query Frame = 2
Query:   29 KSKNVSNTKKEPFRQIKITKAKHQDENINNEMIQKTDK------TQLYPGNTVVFANPSYFGLLANWNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
            K  +  N+K+E     +  K+K  D + + +++   D        + YPG+TV   +PS     ++W  K V+WNVNGLR+ IK  GL Y+ +E  D++ LQE KC   D+PN A  L+++KSYW  A K GYAG+GLY+K  PI +K+GIG KEHD EGRTITAEY+ F+ IT YVPNSGRGLVRL YR   WD +F  Y+K LDK KPVIV GDLNV+H+EIDL+NP  N KTAGFT +ER  FT  L   +L+DT+RH YP+R  AYTFWS M+N+R  N GWRLDYFL+S+R L ++ +QE R  ++GSDHCP+V Y+K 
Sbjct:   36 KIDSTHNSKEESENGRRSVKSKKTDSDTSLKVVNAEDTKPSYSWCRTYPGSTVSLMHPS-LKDSSSWTFKCVTWNVNGLRAWIKNGGLNYVLEEQPDVIGLQEIKCQLKDIPNAAN-LSEFKSYWFPADKPGYAGTGLYSKAAPITVKHGIGIKEHDNEGRTITAEYDKFFLITTYVPNSGRGLVRLKYRTEHWDKAFCEYVKQLDKKKPVIVSGDLNVAHEEIDLKNPDGNHKTAGFTDEERKSFTRFLADADLVDTYRHFYPNRRDAYTFWSTMKNARVSNSGWRLDYFLVSRRFLSHVVDQEFRCGVLGSDHCPVVTYIKL 357          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Cavefish
Match: apex1 (apurinic/apyrimidinic endodeoxyribonuclease 1 [Source:NCBI gene;Acc:103034265])

HSP 1 Score: 317.39 bits (812), Expect = 1.916e-107
Identity = 156/311 (50.16%), Postives = 211/311 (67.85%), Query Frame = 2
Query:   68 RQIKITKAKHQDENIN-NEMIQKTDKTQLYPGNTVVFANP-----SYFGLLANWNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYM 976
            R  K  +A   + N N  E   K  K    P   +++ +P     S  G  AN  MK  SWNV+GLR+ +K +GL +++ ED D++ LQETKC E  LP +   + +Y   YW+ +  K GY+G  +  K  PI + YGIG +EHD+EGR ITAE+ +F+ +TAYVPN+ RGLVRL+YRK +WD  F  YL  LDK KP+++CGDLNV+H+EIDL+NPK N K AGFT +ER GF+ LLE+    D+FR +YP +T AYTFW+ M N+RS+N+GWRLDYFL+S  LLP LC+ ++RN+ MGSDHCPI L++
Sbjct:    4 RAKKNEQAAADEANDNGTEPATKKGKKAKEPEAPILYEDPPDKLTSKDGRAAN--MKITSWNVDGLRAWVKKKGLDWVRQEDPDVLCLQETKCAEKSLPADITSMPEYPHKYWAGSEDKEGYSGVAMLCKTEPIKVSYGIGKEEHDKEGRVITAEFPSFFLVTAYVPNASRGLVRLDYRK-TWDVDFRAYLTDLDKKKPLVLCGDLNVAHQEIDLKNPKGNRKNAGFTPEEREGFSQLLEA-GFTDSFRELYPEQTNAYTFWTYMMNARSKNVGWRLDYFLLSAALLPGLCDSKIRNTAMGSDHCPITLHL 310          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Cavefish
Match: apex2 (apurinic/apyrimidinic endodeoxyribonuclease 2 [Source:NCBI gene;Acc:103032472])

HSP 1 Score: 102.834 bits (255), Expect = 9.913e-24
Identity = 86/320 (26.88%), Postives = 133/320 (41.56%), Query Frame = 2
Query:  215 MKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWS-NAVKSGYAGSGLYTK--MNPINIKYGI--------------GDKEH---------DEEGRTITAEY--------ENFYFITAYVPNSG-----RGLVRLNYRKNSWDPSFLNYLKT-----LDKLKPVIVCGDLNVSHKEIDLENPK-------------------------SNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLP-NLCNQELRNSIMGSDHCPI 964
            MK ++WN+NG+RS  K    K L   +ADI+ +QETK     L      ++ Y SY+S +  +SGY+G   + K    P   + G+              GD+           D EGR +  ++        E    I  Y P +      R L +L          F   L++     +     VI+ GD+N SH+ ID  +P                          ++ +     AD    F   +   + +DTFRH +P R GA+T WS +  +R  N G R+DY   S+ L+  +L N ++   + GSDHCP+
Sbjct:    1 MKIITWNINGIRS-FKYGIKKTLDSFNADIICVQETKVTRDLLDERTAVVDGYNSYFSFSRGRSGYSGVATFCKDSATPFAAEEGLTGLLVNNGEAVGCYGDQTAFSTEELQSLDGEGRAVITQHKLMGAEDPETLTVINVYCPRADPEKPERKLFKLQ---------FYRLLQSRAEAIVGSGSHVIILGDINTSHRPIDHCDPDDVDNFEKNPGRKWLNSFLYGSLENGTDDEEDEEKADSET-FQKFVPGGKFVDTFRHFHPTRVGAFTCWSTLTGARQTNYGTRIDYIFASRSLVEKSLQNADIMPEVEGSDHCPV 309          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Cavefish
Match: apex2 (apurinic/apyrimidinic endodeoxyribonuclease 2 [Source:NCBI gene;Acc:103032472])

HSP 1 Score: 102.449 bits (254), Expect = 1.208e-23
Identity = 86/320 (26.88%), Postives = 133/320 (41.56%), Query Frame = 2
Query:  215 MKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWS-NAVKSGYAGSGLYTK--MNPINIKYGI--------------GDKEH---------DEEGRTITAEY--------ENFYFITAYVPNSG-----RGLVRLNYRKNSWDPSFLNYLKT-----LDKLKPVIVCGDLNVSHKEIDLENPK-------------------------SNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLP-NLCNQELRNSIMGSDHCPI 964
            MK ++WN+NG+RS  K    K L   +ADI+ +QETK     L      ++ Y SY+S +  +SGY+G   + K    P   + G+              GD+           D EGR +  ++        E    I  Y P +      R L +L          F   L++     +     VI+ GD+N SH+ ID  +P                          ++ +     AD    F   +   + +DTFRH +P R GA+T WS +  +R  N G R+DY   S+ L+  +L N ++   + GSDHCP+
Sbjct:    1 MKIITWNINGIRS-FKYGIKKTLDSFNADIICVQETKVTRDLLDERTAVVDGYNSYFSFSRGRSGYSGVATFCKDSATPFAAEEGLTGLLVNNGEAVGCYGDQTAFSTEELQSLDGEGRAVITQHKLMGAEDPETLTVINVYCPRADPEKPERKLFKLQ---------FYRLLQSRAEAIVGSGSHVIILGDINTSHRPIDHCDPDDVDNFEKNPGRKWLNSFLYGSLENGTDDEEDEEKADSET-FQKFVPGGKFVDTFRHFHPTRVGAFTCWSTLTGARQTNYGTRIDYIFASRSLVEKSLQNADIMPEVEGSDHCPV 309          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Cavefish
Match: ENSAMXT00000048093.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000034.1:1232289:1236101:-1 gene:ENSAMXG00000042761.1 transcript:ENSAMXT00000048093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 8.662e-14
Identity = 82/279 (29.39%), Postives = 128/279 (45.88%), Query Frame = 2
Query:  206 NWNMKFVSWNVNGLRSCIK-AQGLKYLKDEDADIVALQETKCPESDLPN-EAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGR----TITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKP------VIVCGDLN-VSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGA-YTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF*VGKIK 1000
            N ++K V+WNV GL S +K ++   +L    ADI+ LQET    SD      K++   + Y S  +      S L  K    NI +     + D  GR    T T    +  F+  Y PN               DPSF    +++ KL P      +++ GD N V    +D ++P      AG  ++       L++S+ ++D +R   P  TG  ++F+SN+  + SR     +DYFLI  +L   L +    +SI+ SDHCP+ + + F V K K
Sbjct:    5 NSHLKIVTWNVRGLNSVLKRSKVFSHLNSLHADIMFLQETHIKHSDAHKLRCKWIG--QMYHSTFLTKARGVSILIRK----NIPFEHLLTKKDPNGRYLIVTGTILSRHVTFLNLYAPNFD-------------DPSFF---RSVFKLIPDMATTHLVIGGDFNCVLDPFMDKQSPP-----AGSPSNSTTVLNKLIQSLNIVDIWRLQNP--TGKDFSFFSNVHKTHSR-----IDYFLIDSKL-ATLASSSDYHSILISDHCPVSVSIDFGVEKAK 248          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Cavefish
Match: ENSAMXT00000052982.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000409.1:21:5030:-1 gene:ENSAMXG00000036080.1 transcript:ENSAMXT00000052982.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 1.096e-11
Identity = 72/261 (27.59%), Postives = 119/261 (45.59%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIK-AQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSY-WSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKP---VIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMK 979
            N+   SWNV G+   +K  +   +LK   ADI+ LQET     D  ++A+    + S  +     S   G  +  + N   + + + D + D +GR     Y         +P +   LV + Y  N  +P F   L  +        +I+ GD N     +D    K ++KT+      +    +LL+S  L+D +R  +P  T  ++F+S +  S SR     +DYFLIS  L+P + N  + + I+ SDH PI L ++
Sbjct:   11 NITLASWNVRGINHPLKRGKVFGHLKRLKADIIFLQETHI---DFSHQARLRTQWISQTFQTTFSSKARGVAILFRKN---VPFQLKDMKVDPQGR-----YIIISGNINSIPLT---LVNV-YGPNYDNPDFFRNLFNIIPFTSSDNIIIGGDFNCC---LDSNLDKLSAKTSPILVSAQ-ILNSLLKSTNLVDIWRLQHP-TTKGFSFYSPVHKSFSR-----IDYFLISSELVPRV-NSTVYHPILISDHSPITLTLQ 245          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Sea Lamprey
Match: apex1 (APEX nuclease (multifunctional DNA repair enzyme) 1 [Source:NCBI gene;Acc:406730])

HSP 1 Score: 296.975 bits (759), Expect = 1.910e-100
Identity = 134/258 (51.94%), Postives = 194/258 (75.19%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWSNAV-KSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNS-KTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYM 976
             +K  SWNV+G+R+ +K   L+++++ED D++ LQETKC E  LP E   + ++   +W+ +  K GY+G  L +K  PIN+  GIG +EHD+EGR ITAE+++F+ + AYVPNSGRGLVRL+YR+ +WD +F  +LK L   KP+++CGDLNV+H+EIDL+NPK+N  KT GFT  ER+GFT LL++   +D+FRH+YP    AYTFW+ M N+R++N+GWRLDYF++S+ LLP LC+ ++R+ +MGSDHCPI L +
Sbjct:   38 TLKITSWNVDGIRAWVKKNALEWVREEDPDVLCLQETKCAEKSLPAEVLDMPEFPHKFWACSDDKEGYSGVALLSKKKPINVTIGIGVEEHDKEGRVITAEFDDFFVVAAYVPNSGRGLVRLDYRE-TWDIAFRTFLKELQDRKPLVLCGDLNVAHQEIDLKNPKTNKNKTPGFTQRERDGFTELLKA-GFVDSFRHLYPEVPYAYTFWTYMMNARAKNVGWRLDYFVLSEALLPKLCDNKVRSKVMGSDHCPITLLL 293          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Yeast
Match: APN2 (Class II abasic (AP) endonuclease involved in repair of DNA damage; homolog of human HAP1 and E. coli exoIII [Source:SGD;Acc:S000000115])

HSP 1 Score: 65.0846 bits (157), Expect = 4.283e-12
Identity = 79/346 (22.83%), Postives = 129/346 (37.28%), Query Frame = 2
Query:  215 MKFVSWNVNGLRSCIKAQGLKYLKDE--------DADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKM----NPI-------------------------------NIKYGIGD-------------KEHDEEGRTITAEYE-NFYFITAYVP----NSGRG-LVRLNYRKNSWDPSFLNYLKTLDKL-KPVIVCGDLNVSHKEID-----------LENPKSNSKTAGFTADE------------RNGFTNLLESVEL---------IDTFRHIYPH-RTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPI 964
            ++F+++NVNG+R+    Q    +            ADI+  QE K  +  +    +    Y        + GY+G G + ++    +P+                               ++  GIG               E D EGR +  E       I+ Y P    +S  G + RL + K       L  ++ LDK+ K +++ GD+NV    ID           + +P   +K      D+            R  F  +L    L         IDT R I    R   YT W+ ++N R  N G R+D+ L+S +L   +   ++   I+GSDHCP+
Sbjct:   17 IRFLTFNVNGIRTFFHYQPFSQMNQSLRSVFDFFRADIITFQELKTEKLSISKWGRVDGFYSFISIPQTRKGYSGVGCWIRIPEKNHPLYHALQVVKAEEGITGYLTIKNGKHSAISYRNDVNQGIGGYDSLDPDLDEKSALELDSEGRCVMVELACGIVIISVYCPANSNSSEEGEMFRLRFLK-----VLLRRVRNLDKIGKKIVLMGDVNVCRDLIDSADTLEQFSIPITDPMGGTKLEAQYRDKAIQFIINPDTPHRRIFNQILADSLLPDASKRGILIDTTRLIQTRNRLKMYTVWNMLKNLRPSNYGSRIDFILVSLKLERCIKAADILPDILGSDHCPV 357          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Nematostella
Match: EDO33512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRZ2])

HSP 1 Score: 312.383 bits (799), Expect = 1.087e-106
Identity = 142/255 (55.69%), Postives = 191/255 (74.90%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYM 976
            N K  SWNVNGLR+ +K     ++  ED D+  +QETKC  +D+P EAK L  Y  YW++A + GY+G GL +K  PI + YG+G+KEHD+EGR ITAEYE+F+ +T+YVPNSGRGL RL YR+  W+  FL+YLK LD++KPVI+CGDLNV+HK+IDL NPK+N++TAGFT +ER  FT LL      DTFR +YP +  AYTFWS M  +R++N+GWRLDYF++S RL+P +C+  +R+ +MGSDHCP+ L +
Sbjct:    4 NFKITSWNVNGLRAWLKNNSKSFVSKEDPDVFCIQETKCALADIPKEAK-LAGYHCYWNSAEQKGYSGVGLCSKKEPIKVSYGMGNKEHDKEGRVITAEYEDFHLVTSYVPNSGRGLPRLGYRQQ-WNKDFLSYLKKLDEIKPVILCGDLNVAHKDIDLANPKTNTRTAGFTKEERADFTTLLGE-GFKDTFRELYPDKKSAYTFWSYMGGARAKNVGWRLDYFVVSDRLVPKVCDSIIRSRVMGSDHCPLSLLL 255          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Nematostella
Match: EDO46129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQL6])

HSP 1 Score: 114.775 bits (286), Expect = 1.713e-28
Identity = 99/314 (31.53%), Postives = 142/314 (45.22%), Query Frame = 2
Query:  215 MKFVSWNVNGLRSCIKAQGLK-YLKDEDADIVALQETKCPESDLPNEAKFLND-YKSYWS-NAVKSGYAGSGLYTK--MNPINIKYGI-------------GDKEH---------DEEGRTITAEYE----------NFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTL-DKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVEL----------------IDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQE-----LRNSIMGSDHCPIVLYMK 979
            MK ++WN+NGLR+  + + LK +L   +AD++  QETK    D+  EA  + D Y +++S + VKSGY+G   + K    P+  + G+             GD E          D EGRTI  E+           N Y   A + N  R   +L + +          +K L +  K VIV GD+N +HK ID  NP      + F    R     LL S+ L                ID+FR+ +P +  AYT WS    +R  N G R+DY L+     P L  QE     +R  + GSDHCP+V  +K
Sbjct:    1 MKILTWNINGLRAVTREKKLKDFLNSLEADVMCFQETKI-TRDMLEEATCMADGYTAFFSFSRVKSGYSGVATFCKDSTTPLAAEEGLTSQLSASPDIGFYGDDEEFTSDQLSRLDSEGRTILTEHTLSSGGTVVIINVYCPRADMENEDRIQFKLEFHR-----LLSKRVKALLNSGKHVIVLGDINAAHKPIDHCNPCKYEDFSSFPG--RAWLDELLVSLPLPDNSCDSSWKCVSGLLIDSFRYFHPLQREAYTNWSTSTGARQTNYGTRIDYILVD----PPLLQQEFVDCVIRPEVEGSDHCPVVCTLK 302          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Medaka
Match: apex1 (apurinic/apyrimidinic endodeoxyribonuclease 1 [Source:NCBI gene;Acc:101172621])

HSP 1 Score: 310.842 bits (795), Expect = 7.207e-105
Identity = 139/257 (54.09%), Postives = 189/257 (73.54%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYK-SYWS-NAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYM 976
            NMK  SWNV+GLR+ +K  GL ++++E  D++ LQETKC E DLP E   + +Y   YW+ +  K GY+G  + +K  P+ + YGIG +EHD+EGR ITAE+  F+ +TAYVPN+ RGLVRL+YRK +WD  F  YL  LD  KP+++CGDLNV+H+EIDL+NPK N K AGFT +ER GF+ LL +   +D+FR +YP +  AYTFW+ M NSR++N+GWRLDYFL+S  L+P LC+ ++RN  MGSDHCPI L++
Sbjct:   55 NMKITSWNVDGLRAWVKKGGLDWVREEAPDVLCLQETKCAEKDLPAEITSMPEYPHKYWAVSDDKEGYSGVAMLSKTEPLKVTYGIGKEEHDKEGRVITAEFPTFFLVTAYVPNASRGLVRLDYRK-TWDVDFQAYLTELDVQKPLVLCGDLNVAHQEIDLKNPKGNKKNAGFTPEEREGFSQLL-AAGFVDSFRELYPEQANAYTFWTYMMNSRAKNVGWRLDYFLLSSSLVPGLCDSKIRNKAMGSDHCPITLHL 309          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Medaka
Match: apex2 (sodium-coupled neutral amino acid transporter 3-like [Source:NCBI gene;Acc:101166627])

HSP 1 Score: 93.5893 bits (231), Expect = 1.274e-20
Identity = 84/310 (27.10%), Postives = 126/310 (40.65%), Query Frame = 2
Query:  215 MKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWS-NAVKSGYAGSGLYTK--MNPINIKYGI--------------GDKEH---------DEEGRTITA---------EYENFYFITAYVPNSG-----RGLVRLNYRKNSWDPSFLNYLK--TLDKLKPVIVCGDLNVSHKEIDLENPKSNSK-----------------TAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLL-PNLCNQELRNSIMGSDHCPI 964
            MK V+WN+NG+R+  K    + L   DADI+ +QETK     L   +  ++ Y SY+S +  +SGY+G   Y +    P+  + G+              GD+           D EGR +           E +    I  Y P +      R   +L + K       L +     L     VIV GD+N SH+ ID  +P   ++                 +     DE       L S   +DTFR  +P RT A+T WS +  +R  N G R+DY     +L        ++   + GSDHCP+
Sbjct:    1 MKIVTWNINGIRT-FKGGIKRALDLLDADIICVQETKVTRDLLDEGSAIVDGYNSYFSYSRGRSGYSGVATYCRDSATPLAAEEGLTGLLTNHDGAVGCYGDQTGFSSEELQLLDNEGRAMITKHRIMCQDQEEKTLTVINVYCPRADPEKPERKQFKLQFYK------LLQHRAEAVLKAGSHVIVLGDVNTSHRPIDHCDPCETNEFEDNPGRKWLNEFLHNGSPEDVLDEDPKQAPELNSGRFVDTFRLFHPTRTNAFTCWSTLTGARQTNYGTRIDYIFADCKLAEEQFVATDIMPEVEGSDHCPV 303          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Medaka
Match: apex2 (sodium-coupled neutral amino acid transporter 3-like [Source:NCBI gene;Acc:101166627])

HSP 1 Score: 93.2041 bits (230), Expect = 1.394e-20
Identity = 84/310 (27.10%), Postives = 126/310 (40.65%), Query Frame = 2
Query:  215 MKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWS-NAVKSGYAGSGLYTK--MNPINIKYGI--------------GDKEH---------DEEGRTITA---------EYENFYFITAYVPNSG-----RGLVRLNYRKNSWDPSFLNYLK--TLDKLKPVIVCGDLNVSHKEIDLENPKSNSK-----------------TAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLL-PNLCNQELRNSIMGSDHCPI 964
            MK V+WN+NG+R+  K    + L   DADI+ +QETK     L   +  ++ Y SY+S +  +SGY+G   Y +    P+  + G+              GD+           D EGR +           E +    I  Y P +      R   +L + K       L +     L     VIV GD+N SH+ ID  +P   ++                 +     DE       L S   +DTFR  +P RT A+T WS +  +R  N G R+DY     +L        ++   + GSDHCP+
Sbjct:    1 MKIVTWNINGIRT-FKGGIKRALDLLDADIICVQETKVTRDLLDEGSAIVDGYNSYFSYSRGRSGYSGVATYCRDSATPLAAEEGLTGLLTNHDGAVGCYGDQTGFSSEELQLLDNEGRAMITKHRIMCQDQEEKTLTVINVYCPRADPEKPERKQFKLQFYK------LLQHRAEAVLKAGSHVIVLGDVNTSHRPIDHCDPCETNEFEDNPGRKWLNEFLHNGSPEDVLDEDPKQAPELNSGRFVDTFRLFHPTRTNAFTCWSTLTGARQTNYGTRIDYIFADCKLAEEQFVATDIMPEVEGSDHCPV 303          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Medaka
Match: ENSORLT00000039325.1 (pep primary_assembly:ASM223467v1:16:8027194:8031964:1 gene:ENSORLG00000029798.1 transcript:ENSORLT00000039325.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 2.676e-11
Identity = 75/259 (28.96%), Postives = 112/259 (43.24%), Query Frame = 2
Query:  215 MKFVSWNVNGLRSCIK-AQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLN-YLKTLDKL--KPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMK 979
            ++ V+WNV+G  +  K  + +  LKD   D   LQET    S +   A    D+ + +S    S   G    T M    IK+       D EGR        F  +T    N    L  + Y  N  DP F + +   L +   K +I+ GDLN+    +D E  + N+         RN     +E   L D +R  +P +   YTF+S +  S SR     LDYFL++  LL ++  +   + I  SDH P+ L +K
Sbjct:    4 LRLVTWNVHGAGTREKRLKVMSKLKDLKTDFAFLQETHMSSSSVNILAT--ADFPNVYSACYNSRQRG---VTIMINREIKFTETSTVIDPEGR--------FIIVTLSTQNMQLCLANV-YAPNVDDPKFFHSFFSALSEHTDKSLIIAGDLNMC---LDPEMDRLNNTGNLRIWQSRNTVKQYMEDFGLCDVWRLFHPTK-RTYTFFSTVHQSYSR-----LDYFLVNSSLL-SIATEAQIHPITISDHAPVSLTLK 238          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Medaka
Match: ENSORLT00000027414.1 (pep primary_assembly:ASM223467v1:2:22811643:22817136:-1 gene:ENSORLG00000025057.1 transcript:ENSORLT00000027414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.017e-10
Identity = 72/260 (27.69%), Postives = 115/260 (44.23%), Query Frame = 2
Query:  212 NMKFVSWNVNGLRSCIK-AQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGR----TITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKT---LDKLKPVIVCGDLN-VSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPI 964
            ++  VSWNV GL S  K  + L +L D  ADI  LQET    S         + Y + +S +  S   G  +       N+ +   D   D EGR     I+ + ++F   + Y PN+              D SF +   T   +     +I+ GD+N V   E+D  +  +N +T    +  +    +L     L D +R  +P   G +TF+S + +S+S     RLDY L+S  LL  + +  + + I+ SDH P+
Sbjct:    3 SLNIVSWNVRGLGSGPKRLKVLNHLNDLKADIALLQETHLSLS--AGHLLCCSQYPAMYSASFNSKQRGVAVLINK---NVTFTHKDTVTDPEGRFVIINISIQNKDFCIASIYGPNAD-------------DSSFFHRFFTSLSVHSDSTIIIGGDVNLVLDPELDRLSTAANQRTWQSASILKQYMNDL----GLCDAWRSCHPSTKG-FTFFSPVHHSQS-----RLDYLLVSNSLLKEIKSSNI-HPIIISDHAPV 233          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Planmine SMEST
Match: SMESG000036124.1 (SMESG000036124.1)

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 319/320 (99.69%), Postives = 319/320 (99.69%), Query Frame = 2
Query:   23 MGKSKNVSNTKKEPFRQIKITKAKHQDENINNEMIQKTDKTQLYPGNTVVFANPSYFGLLANWNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 982
            MGKSKNVSNTKKEPFRQIKITKAKHQDENINNEMIQKTDKTQLYPGNTVV ANPSYFGLLANWNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF
Sbjct:    1 MGKSKNVSNTKKEPFRQIKITKAKHQDENINNEMIQKTDKTQLYPGNTVVSANPSYFGLLANWNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDKEHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKTLDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVLYMKF 320          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Planmine SMEST
Match: SMESG000034621.1 (SMESG000034621.1)

HSP 1 Score: 99.7525 bits (247), Expect = 4.251e-23
Identity = 95/332 (28.61%), Postives = 137/332 (41.27%), Query Frame = 2
Query:  206 NWNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNA-VKSGYAGSGLYTKMNPI----------------NIKYGIGDK-------------EHDEEGRTITAEY-------------ENFYFITAYVP-NSGRGLVRLNYRKNSWDPSFLNYLKTL---------DKLKP-----VIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLL-----------------ES--VELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVL 970
            N N K  SWNVNGL+S +K+     L + D+DI+  QE K  +  +      ++ Y SY+S    K GY+G G+Y + NPI                N K+   ++               + EGR I AE+                +    Y P        RL+Y+         N L TL         D+++      VI+ GDLN+ HK ID+ +  S       +   R  F  LL                 ES  + L+DTFR+++P   G Y+ W+     R  N G R+DY L SK L   + +  L   IMGSDHCP+ +
Sbjct:    2 NKNFKITSWNVNGLKS-LKSPVKSILNNFDSDIICFQEVKTSKEVVQYCQAIIDGYSSYFSFCKSKPGYSGVGIYCR-NPIIPNSMEEGLTEIIKKCNSKFRTNEEICAYLDIFVDDLLALESEGRAICAEFLVNNCKCGIKDVQHRIWIFNVYCPLAEPDNKERLDYKYQ------FNRLLTLALASINSINDEIECKMVNLVILAGDLNIVHKPIDMAD--SVPSQVFLSNPNRQWFDALLIESQRYLDLDFKPNHNSESYFLRLVDTFRYLHPDDLGCYSCWNTKVGGRQTNFGTRIDYILCSKELQNKIHDSSLLVDIMGSDHCPVTV 323          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Planmine SMEST
Match: SMESG000034621.1 (SMESG000034621.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.246e-11
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query:  767 VELIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQELRNSIMGSDHCPIVL 970
            + L+DTFR+++P   G Y+ W+     R  N G R+DY L SK L   + +  L   IMGSDHCP+ +
Sbjct:   45 LRLVDTFRYLHPDDLGCYSCWNTKVGGRQTNFGTRIDYILCSKELQNKIHDSSLLVDIMGSDHCPVTV 112          
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Planmine SMEST
Match: SMESG000034621.1 (SMESG000034621.1)

HSP 1 Score: 52.373 bits (124), Expect = 8.357e-8
Identity = 32/81 (39.51%), Postives = 46/81 (56.79%), Query Frame = 2
Query:  206 NWNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQETKCPESDLPNEAKFLNDYKSYWSNA-VKSGYAGSGLYTKMNPI 445
            N N K  SWNVNGL+S +K+     L + D+DI+  QE K  +  +      ++ Y SY+S    K GY+G G+Y + NPI
Sbjct:    2 NKNFKITSWNVNGLKS-LKSPVKSILNNFDSDIICFQEVKTSKEVVQYCQAIIDGYSSYFSFCKSKPGYSGVGIYCR-NPI 80          
The following BLAST results are available for this feature:
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
APEX12.495e-10555.21apurinic/apyrimidinic endodeoxyribonuclease 1 [Sou... [more]
APEX12.495e-10555.21apurinic/apyrimidinic endodeoxyribonuclease 1 [Sou... [more]
APEX12.495e-10555.21apurinic/apyrimidinic endodeoxyribonuclease 1 [Sou... [more]
APEX11.193e-7454.77apurinic/apyrimidinic endodeoxyribonuclease 1 [Sou... [more]
APEX11.663e-5645.97apurinic/apyrimidinic endodeoxyribonuclease 1 [Sou... [more]
back to top
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
exo-33.462e-7447.08DNA-(apurinic or apyrimidinic site) lyase [Source... [more]
exo-33.462e-7447.08DNA-(apurinic or apyrimidinic site) lyase [Source... [more]
exo-31.302e-3246.53DNA-(apurinic or apyrimidinic site) lyase [Source... [more]
back to top
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rrp18.592e-9753.23gene:FBgn0004584 transcript:FBtr0077678[more]
Rrp12.512e-9653.23gene:FBgn0004584 transcript:FBtr0290241[more]
back to top
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
apex11.490e-10455.25APEX nuclease (multifunctional DNA repair enzyme) ... [more]
apex11.490e-10455.25APEX nuclease (multifunctional DNA repair enzyme) ... [more]
apex13.013e-10455.25APEX nuclease (multifunctional DNA repair enzyme) ... [more]
apex13.113e-10455.25APEX nuclease (multifunctional DNA repair enzyme) ... [more]
apex19.448e-4451.82APEX nuclease (multifunctional DNA repair enzyme) ... [more]
back to top
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
apex12.120e-10054.83APEX nuclease (multifunctional DNA repair enzyme) ... [more]
apex24.263e-2128.93apurinic/apyrimidinic endodeoxyribonuclease 2 [Sou... [more]
apex24.485e-2128.84apurinic/apyrimidinic endodeoxyribonuclease 2 [Sou... [more]
ENSXETT00000053674.11.984e-925.00pep primary_assembly:Xenopus_tropicalis_v9.1:3:607... [more]
ENSXETT00000033329.18.938e-825.95pep primary_assembly:Xenopus_tropicalis_v9.1:6:642... [more]
back to top
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Apex14.389e-10655.21apurinic/apyrimidinic endonuclease 1 [Source:MGI S... [more]
Apex11.630e-8850.19apurinic/apyrimidinic endonuclease 1 [Source:MGI S... [more]
Apex15.205e-5352.56apurinic/apyrimidinic endonuclease 1 [Source:MGI S... [more]
Apex14.637e-3651.69apurinic/apyrimidinic endonuclease 1 [Source:MGI S... [more]
Apex28.051e-1826.62apurinic/apyrimidinic endonuclease 2 [Source:MGI S... [more]
back to top
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P28352|APEX1_MOUSE3.070e-10555.21DNA-(apurinic or apyrimidinic site) lyase OS=Mus m... [more]
sp|P43138|APEX1_RAT5.292e-10554.83DNA-(apurinic or apyrimidinic site) lyase OS=Rattu... [more]
sp|P23196|APEX1_BOVIN7.182e-10554.83DNA-(apurinic or apyrimidinic site) lyase OS=Bos t... [more]
sp|P27695|APEX1_HUMAN1.198e-10455.21DNA-(apurinic or apyrimidinic site) lyase OS=Homo ... [more]
sp|A1YES6|APEX1_GORGO3.719e-10454.83DNA-(apurinic or apyrimidinic site) lyase OS=Goril... [more]
back to top
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KFT69.609e-12554.26DNA-(apurinic or apyrimidinic site) lyase OS=Schis... [more]
A0A095AEP83.315e-12356.81DNA-(apurinic or apyrimidinic site) lyase OS=Schis... [more]
C1L4Q83.643e-12153.92DNA-(apurinic or apyrimidinic site) lyase OS=Schis... [more]
A0A4Z2CYC37.972e-12153.92DNA-(apurinic or apyrimidinic site) lyase OS=Schis... [more]
A0A0X3Q4126.615e-11852.47DNA-(apurinic or apyrimidinic site) lyase OS=Schis... [more]
back to top
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
apex11.916e-10750.16apurinic/apyrimidinic endodeoxyribonuclease 1 [Sou... [more]
apex29.913e-2426.88apurinic/apyrimidinic endodeoxyribonuclease 2 [Sou... [more]
apex21.208e-2326.88apurinic/apyrimidinic endodeoxyribonuclease 2 [Sou... [more]
ENSAMXT00000048093.18.662e-1429.39pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000052982.11.096e-1127.59pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
apex11.910e-10051.94APEX nuclease (multifunctional DNA repair enzyme) ... [more]
back to top
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
APN24.283e-1222.83Class II abasic (AP) endonuclease involved in repa... [more]
back to top
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO335121.087e-10655.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461291.713e-2831.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
apex17.207e-10554.09apurinic/apyrimidinic endodeoxyribonuclease 1 [Sou... [more]
apex21.274e-2027.10sodium-coupled neutral amino acid transporter 3-li... [more]
apex21.394e-2027.10sodium-coupled neutral amino acid transporter 3-li... [more]
ENSORLT00000039325.12.676e-1128.96pep primary_assembly:ASM223467v1:16:8027194:803196... [more]
ENSORLT00000027414.11.017e-1027.69pep primary_assembly:ASM223467v1:2:22811643:228171... [more]
back to top
BLAST of DNA-(apurinic or apyrimidinic site) lyase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000036124.10.000e+099.69SMESG000036124.1[more]
SMESG000034621.14.251e-2328.61SMESG000034621.1[more]
SMESG000034621.11.246e-1141.18SMESG000034621.1[more]
SMESG000034621.18.357e-839.51SMESG000034621.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012311 ID=SMED30012311|Name=DNA-(apurinic or apyrimidinic site) lyase|organism=Schmidtea mediterranea sexual|type=transcript|length=1033bp
GGTCGTTATAAATTAATTTAGCATGGGTAAATCTAAAAATGTTTCAAATA
CTAAAAAAGAACCTTTTAGACAAATTAAAATTACAAAAGCTAAACATCAA
GATGAAAATATAAATAATGAAATGATTCAAAAAACTGATAAAACTCAGTT
ATATCCAGGCAACACTGTTGTTTTTGCCAACCCTTCATATTTTGGTTTGT
TAGCTAATTGGAACATGAAATTTGTTTCTTGGAATGTTAATGGTCTTAGA
TCATGCATTAAAGCTCAAGGACTAAAATATCTAAAGGATGAAGATGCTGA
TATAGTTGCTTTACAAGAAACTAAATGTCCTGAATCTGACTTACCCAATG
AAGCCAAATTTCTAAATGATTATAAATCATATTGGTCAAATGCTGTAAAA
TCTGGTTATGCTGGATCTGGTTTATATACCAAAATGAATCCAATTAATAT
AAAATATGGGATTGGCGATAAAGAACATGATGAAGAAGGAAGAACAATCA
CAGCCGAATATGAAAATTTTTATTTCATTACTGCTTATGTCCCTAATTCC
GGAAGGGGATTAGTTCGATTAAATTATCGCAAAAATTCATGGGATCCTAG
TTTTTTAAATTATTTAAAAACCTTAGATAAATTGAAGCCAGTTATTGTTT
GCGGTGATTTGAATGTGTCACATAAGGAAATTGATTTAGAAAATCCCAAA
TCCAATTCAAAAACTGCCGGATTTACAGCTGATGAAAGAAATGGATTCAC
AAATTTACTGGAATCGGTTGAACTTATTGATACGTTTAGGCATATTTATC
CTCACCGAACTGGGGCTTATACATTTTGGAGCAACATGAGGAATTCTAGA
AGTCGCAATATTGGATGGAGATTGGACTATTTTTTAATATCAAAGAGACT
TCTTCCAAATTTGTGCAATCAAGAGTTGAGGAACAGTATTATGGGAAGCG
ATCATTGTCCAATTGTTCTATATATGAAATTTTAAGTTGGAAAGATTAAA
AGTCAATGTTTAATTGATCTGTAATAAATCGAT
back to top

protein sequence of SMED30012311-orf-1

>SMED30012311-orf-1 ID=SMED30012311-orf-1|Name=SMED30012311-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=321bp
MGKSKNVSNTKKEPFRQIKITKAKHQDENINNEMIQKTDKTQLYPGNTVV
FANPSYFGLLANWNMKFVSWNVNGLRSCIKAQGLKYLKDEDADIVALQET
KCPESDLPNEAKFLNDYKSYWSNAVKSGYAGSGLYTKMNPINIKYGIGDK
EHDEEGRTITAEYENFYFITAYVPNSGRGLVRLNYRKNSWDPSFLNYLKT
LDKLKPVIVCGDLNVSHKEIDLENPKSNSKTAGFTADERNGFTNLLESVE
LIDTFRHIYPHRTGAYTFWSNMRNSRSRNIGWRLDYFLISKRLLPNLCNQ
ELRNSIMGSDHCPIVLYMKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR036691Endo/exonu/phosph_ase_sf
IPR005135Endo/exonuclease/phosphatase
IPR020847AP_endonuclease_F1_BS
IPR020848AP_endonuclease_F1_CS
IPR004808AP_endonuc_1
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0004519endonuclease activity
GO:0004518nuclease activity
GO:0003906DNA-(apurinic or apyrimidinic site) lyase activity
GO:0016829lyase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
GO:0090305nucleic acid phosphodiester bond hydrolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTIGRFAMTIGR00195TIGR00195coord: 65..317
e-value: 1.2E-79
score: 265.5
NoneNo IPR availablePANTHERPTHR22748:SF6DNA-(APURINIC OR APYRIMIDINIC SITE) LYASEcoord: 11..319
NoneNo IPR availableCDDcd09087Ape1-like_AP-endocoord: 65..318
e-value: 3.37E-149
score: 417.338
IPR036691Endonuclease/exonuclease/phosphatase superfamilyGENE3DG3DSA:3.60.10.10coord: 21..319
e-value: 5.4E-91
score: 307.6
IPR036691Endonuclease/exonuclease/phosphatase superfamilySUPERFAMILYSSF56219DNase I-likecoord: 65..319
IPR005135Endonuclease/exonuclease/phosphatasePFAMPF03372Exo_endo_phoscoord: 68..311
e-value: 1.1E-17
score: 64.3
IPR004808AP endonuclease 1TIGRFAMTIGR00633TIGR00633coord: 65..318
e-value: 2.4E-93
score: 310.3
IPR004808AP endonuclease 1PANTHERPTHR22748AP ENDONUCLEASEcoord: 11..319
IPR004808AP endonuclease 1PROSITEPS51435AP_NUCLEASE_F1_4coord: 65..320
score: 47.107
IPR020848AP endonuclease 1, conserved sitePROSITEPS00727AP_NUCLEASE_F1_2coord: 253..269
IPR020848AP endonuclease 1, conserved sitePROSITEPS00728AP_NUCLEASE_F1_3coord: 279..290
IPR020847AP endonuclease 1, binding sitePROSITEPS00726AP_NUCLEASE_F1_1coord: 92..101