DNA-directed RNA polymerases I, II, and III subunit RPABC1

Overview
NameDNA-directed RNA polymerases I, II, and III subunit RPABC1
Smed IDSMED30012308
Length (bp)665
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA-directed RNA polymerases I, II, and III subunit RPABC1 (SMED30012308) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA-directed RNA polymerases I, II, and III subunit RPABC1 (SMED30012308) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA-directed RNA polymerases I, II, and III subunit RPABC1 (SMED30012308) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA-directed RNA polymerases I, II, and III subunit RPABC1 (SMED30012308) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012308

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012308h1SMcG0013987 SmedASXL_005385SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012308h1SMcG0013987 SmedASXL_005385SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
enteric muscle cellSMED30012308h1SMcG0013987 dd_Smed_v4_6572_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Human
Match: POLR2E (RNA polymerase II subunit E [Source:HGNC Symbol;Acc:HGNC:9192])

HSP 1 Score: 198.749 bits (504), Expect = 7.145e-64
Identity = 90/207 (43.48%), Postives = 147/207 (71.01%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + E+FK +  +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RA+I+++  +TPSAK  L +MA + +++E F + EL++N+T+H LVP+H V++ EE  E+L RY ++E+Q+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPK-YILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Human
Match: POLR2E (RNA polymerase II subunit E [Source:HGNC Symbol;Acc:HGNC:9192])

HSP 1 Score: 198.749 bits (504), Expect = 7.145e-64
Identity = 90/207 (43.48%), Postives = 147/207 (71.01%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + E+FK +  +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RA+I+++  +TPSAK  L +MA + +++E F + EL++N+T+H LVP+H V++ EE  E+L RY ++E+Q+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPK-YILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Human
Match: POLR2E (RNA polymerase II subunit E [Source:HGNC Symbol;Acc:HGNC:9192])

HSP 1 Score: 198.749 bits (504), Expect = 7.145e-64
Identity = 90/207 (43.48%), Postives = 147/207 (71.01%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + E+FK +  +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RA+I+++  +TPSAK  L +MA + +++E F + EL++N+T+H LVP+H V++ EE  E+L RY ++E+Q+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPK-YILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Human
Match: POLR2E (RNA polymerase II subunit E [Source:HGNC Symbol;Acc:HGNC:9192])

HSP 1 Score: 168.318 bits (425), Expect = 5.460e-52
Identity = 76/186 (40.86%), Postives = 129/186 (69.35%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKG 582
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + E+FK +  +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RA+I+++  +TPSAK  L +MA + +++E F + EL++N+T+H LVP+H V++ EE  E+L RY ++E+Q+PRIQ  DP++RYFG+K+G
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPK-YILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRG 188          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Human
Match: POLR2E (RNA polymerase II subunit E [Source:HGNC Symbol;Acc:HGNC:9192])

HSP 1 Score: 166.777 bits (421), Expect = 9.077e-52
Identity = 80/208 (38.46%), Postives = 128/208 (61.54%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIVY 648
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + E+FK +  +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RA+I+++  +TPSAK                             LVP+H V++ EE  E+L RY ++E+Q+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V+
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQ----------------------------LVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVH 183          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Celegans
Match: rpb-5 (DNA-directed RNA polymerases I, II, and III subunit RPABC1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5K2])

HSP 1 Score: 209.534 bits (532), Expect = 1.269e-68
Identity = 97/207 (46.86%), Postives = 150/207 (72.46%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLN------ADRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E E ++LWRIR T +QM++DRGYLV   E +   E FK ++ +        R++L+I+  H +DPA+ ++VFF +D K+ ++ I+     M+  N  RAII+++  +TPSAK  + +MA + +M+E F E+EL+VN+T+H LVP+H V+++EEK E+L RY +K+SQ+PRIQQ DP++RYFG+++G + KI+R SETAG+YITYR+V
Sbjct:    5 ELETYRLWRIRKTVLQMVHDRGYLVAQDELDQPLETFKVQYGDRPSEKKPARSDLTILVAHNDDPADQMFVFFPEDAKIGIKTIKAICQQMQEQNISRAIIVVQTGMTPSAKQSIGDMAPK-YMLEHFLEAELMVNITEHELVPEHVVMTAEEKAELLARYKLKDSQLPRIQQCDPVARYFGLRRGQVVKIIRPSETAGRYITYRLV 210          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Fly
Match: Rpb5 (gene:FBgn0033571 transcript:FBtr0088237)

HSP 1 Score: 199.519 bits (506), Expect = 1.479e-64
Identity = 94/207 (45.41%), Postives = 146/207 (70.53%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLN------ADRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E E +KLWRIR T MQ+ +DRGYLVT  E + + E FK  F +        R++L ++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RAI++++  +TPSAK  L +MA + +++E F ESEL++N+T+H LVP+H V++ EEK+E+L RY +KE+ + RIQ  DP++RYFG+K+G + KI+R SETAG+YI+YR+V
Sbjct:    4 EAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSEKRPARSDLIVLVAHNDDPTDQMFVFFPEEPKIGIKTIKTYCTRMQEENIHRAIVVVQGGMTPSAKQSLVDMAPK-YILEQFLESELLINITEHELVPEHVVMTVEEKQELLSRYKLKENMLMRIQAGDPVARYFGLKRGQVVKIIRSSETAGRYISYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Fly
Match: Rpb5 (gene:FBgn0033571 transcript:FBtr0331935)

HSP 1 Score: 199.519 bits (506), Expect = 1.479e-64
Identity = 94/207 (45.41%), Postives = 146/207 (70.53%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLN------ADRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E E +KLWRIR T MQ+ +DRGYLVT  E + + E FK  F +        R++L ++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RAI++++  +TPSAK  L +MA + +++E F ESEL++N+T+H LVP+H V++ EEK+E+L RY +KE+ + RIQ  DP++RYFG+K+G + KI+R SETAG+YI+YR+V
Sbjct:    4 EAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSEKRPARSDLIVLVAHNDDPTDQMFVFFPEEPKIGIKTIKTYCTRMQEENIHRAIVVVQGGMTPSAKQSLVDMAPK-YILEQFLESELLINITEHELVPEHVVMTVEEKQELLSRYKLKENMLMRIQAGDPVARYFGLKRGQVVKIIRSSETAGRYISYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Zebrafish
Match: polr2eb (polymerase (RNA) II (DNA directed) polypeptide E, b [Source:ZFIN;Acc:ZDB-GENE-040801-83])

HSP 1 Score: 204.527 bits (519), Expect = 2.403e-66
Identity = 93/207 (44.93%), Postives = 150/207 (72.46%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + ++F+++F +        RN+L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RAII+++  +TPSAK  L +MA + +++E F + EL++N+T+H LVP+H V++ EE  E+L RY +KESQ+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLDEFRSQFGDKPSEGRPRRNDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKMYCQRMQEENITRAIIVVQMGMTPSAKQSLVDMAPK-YILEQFLQQELLINITEHELVPEHIVMTKEEVTELLARYKLKESQLPRIQAGDPVARYFGLKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Zebrafish
Match: CABZ01024418.1 (polymerase (RNA) II (DNA directed) polypeptide E, a [Source:NCBI gene;Acc:100330570])

HSP 1 Score: 200.29 bits (508), Expect = 9.673e-65
Identity = 91/207 (43.96%), Postives = 148/207 (71.50%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLN------ADRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + ++FK +F +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RA+I+++  +TPSAK  L +MA + +++E F + EL++N+T+H LVP+H V++ EE  E+L RY +KE+Q+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTVMQLCHDRGYLVTQDELDQTLDEFKIQFGDRPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEELKVGIKTIKMYCQRMQEENITRAVIVVQTGMTPSAKQSLVDMAPK-YILEQFLQQELLINITEHELVPEHIVMTKEEVTELLARYKLKETQLPRIQCSDPVARYFGLKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Xenopus
Match: polr2e (polymerase (RNA) II (DNA directed) polypeptide E, 25kDa [Source:NCBI gene;Acc:549227])

HSP 1 Score: 200.675 bits (509), Expect = 9.725e-65
Identity = 90/207 (43.48%), Postives = 148/207 (71.50%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + ++FK +F +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RA+I+++  +TPSAK  L +MA + +++E F + EL++N+T+H LVP+H V++ +E  E+L RY ++ESQ+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLDEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKMYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPK-YILEQFLQQELLINITEHELVPEHVVMTKDEVTELLARYKLRESQLPRIQAGDPVARYFGLKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Xenopus
Match: polr2e (polymerase (RNA) II (DNA directed) polypeptide E, 25kDa [Source:NCBI gene;Acc:549227])

HSP 1 Score: 168.318 bits (425), Expect = 2.005e-52
Identity = 80/207 (38.65%), Postives = 128/207 (61.84%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + ++FK +F +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RA+I+++  +TPSAK                             LVP+H V++ +E  E+L RY ++ESQ+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLDEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKMYCQRMQEENITRALIVVQQGMTPSAKQ----------------------------LVPEHVVMTKDEVTELLARYKLRESQLPRIQAGDPVARYFGLKRGQVVKIIRPSETAGRYITYRLV 182          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Mouse
Match: Polr2e (polymerase (RNA) II (DNA directed) polypeptide E [Source:MGI Symbol;Acc:MGI:1913670])

HSP 1 Score: 203.756 bits (517), Expect = 5.268e-66
Identity = 92/207 (44.44%), Postives = 148/207 (71.50%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + E+FK +F +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RA+I+++  +TPSAK  L +MA + +++E F + EL++N+T+H LVP+H V++ EE  E+L RY ++ESQ+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPK-YVLEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. UniProt/SwissProt
Match: sp|A8XGH1|RPAB1_CAEBR (DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Caenorhabditis briggsae OX=6238 GN=rpb-5 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.320e-68
Identity = 98/207 (47.34%), Postives = 150/207 (72.46%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLN------ADRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E E ++LWRIR T +QM++DRGYLV  +E +   E FK  F +        R++L+I+  H +DPA+ ++VFF +D K+ ++ I+     M+  N  RAII+++  +TPSAK  + +MA + +M+E F E+EL+VN+T+H LVP+H V+++EEK E+L RY +K+SQ+PRIQQ DP++RYFG+++G + KI+R SETAG+YITYR+V
Sbjct:    5 ELETYRLWRIRKTVLQMVHDRGYLVAQEELDQPLETFKETFGDRPSEKKPARSDLTILVAHNDDPADQMFVFFPEDTKIGIKTIKAICQQMQEQNISRAIIVVQTGMTPSAKQSIGDMAPK-YMLEHFLEAELMVNITEHELVPEHVVMTAEEKAELLARYKLKDSQLPRIQQCDPVARYFGLRRGQVVKIIRPSETAGRYITYRLV 210          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. UniProt/SwissProt
Match: sp|Q9N5K2|RPAB1_CAEEL (DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Caenorhabditis elegans OX=6239 GN=rpb-5 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.614e-67
Identity = 97/207 (46.86%), Postives = 150/207 (72.46%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLN------ADRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E E ++LWRIR T +QM++DRGYLV   E +   E FK ++ +        R++L+I+  H +DPA+ ++VFF +D K+ ++ I+     M+  N  RAII+++  +TPSAK  + +MA + +M+E F E+EL+VN+T+H LVP+H V+++EEK E+L RY +K+SQ+PRIQQ DP++RYFG+++G + KI+R SETAG+YITYR+V
Sbjct:    5 ELETYRLWRIRKTVLQMVHDRGYLVAQDELDQPLETFKVQYGDRPSEKKPARSDLTILVAHNDDPADQMFVFFPEDAKIGIKTIKAICQQMQEQNISRAIIVVQTGMTPSAKQSIGDMAPK-YMLEHFLEAELMVNITEHELVPEHVVMTAEEKAELLARYKLKDSQLPRIQQCDPVARYFGLRRGQVVKIIRPSETAGRYITYRLV 210          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. UniProt/SwissProt
Match: sp|B0BNE2|RPAB1_RAT (DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Rattus norvegicus OX=10116 GN=Polr2e PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 3.685e-65
Identity = 92/207 (44.44%), Postives = 148/207 (71.50%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + E+FK +F +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RA+I+++  +TPSAK  L +MA + +++E F + EL++N+T+H LVP+H V++ EE  E+L RY ++ESQ+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPK-YVLEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. UniProt/SwissProt
Match: sp|Q80UW8|RPAB1_MOUSE (DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Mus musculus OX=10090 GN=Polr2e PE=1 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 3.685e-65
Identity = 92/207 (44.44%), Postives = 148/207 (71.50%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + E+FK +F +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RA+I+++  +TPSAK  L +MA + +++E F + EL++N+T+H LVP+H V++ EE  E+L RY ++ESQ+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPK-YVLEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. UniProt/SwissProt
Match: sp|Q5R587|RPAB1_PONAB (DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Pongo abelii OX=9601 GN=POLR2E PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 4.281e-64
Identity = 90/207 (43.48%), Postives = 148/207 (71.50%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + E+F+ +F +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RA+I+++  +TPSAK  L +MA + +++E F + EL++N+T+H LVP+H V++ EE  E+L RY ++E+Q+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFRAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPK-YILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. TrEMBL
Match: A0A0R3SVP3 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9658 PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 2.496e-69
Identity = 100/203 (49.26%), Postives = 153/203 (75.37%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNA-DRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIR-NTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            +DE +KLWRI+ T ++M  DRGYLV  KE E S EDFK    +   R EL +V NH+EDP++++YVFF DD+++ ++ IR Y+D M+  +  +AI+++R   +TP+AK+ + E++     +E F+E+EL+VN+T+H LVP+H VL++EEK E+L+RY +KESQ+P++Q  DP++RY+G+K+G + +I R SETAG+YITYRIV
Sbjct:    2 DDETYKLWRIKKTILKMCLDRGYLVMQKELEQSLEDFKESMGDPPSRKELLMVVNHEEDPSDMLYVFFPDDDRVNMKTIRAYVDQMQHDSCTKAILVLREGGLTPAAKSAIAELSASKITMECFYENELMVNITEHKLVPEHRVLTTEEKHELLERYRLKESQLPKMQSSDPVARYYGLKRGQVVRINRPSETAGRYITYRIV 204          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. TrEMBL
Match: A0A0L8GSH7 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22028709mg PE=3 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 3.858e-68
Identity = 99/207 (47.83%), Postives = 151/207 (72.95%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLN------ADRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E E +KLWRIR T MQ+ +DRGYLVT  E + + E+FK++F +        R++L ++  H +DP + ++VFF +D K+ ++ I+ Y   M+  N  RAII+++  +TPSAK  L +MA + +++E F E+EL+VN+T H+LVP+H V++ EEK E+L RY +KESQ+PR+QQ DP++RYFG+K+G + KIVR SETAG+Y++YR+V
Sbjct:    4 EQETYKLWRIRRTVMQICHDRGYLVTQDELDQTLEEFKDQFGDKPSERRPARSDLIVLVAHNDDPTDQMFVFFPEDPKVGIKTIKTYCQRMQEENITRAIIVVQAGMTPSAKQALVDMAPK-YILEQFLEAELLVNITSHMLVPEHVVMTPEEKSELLQRYKLKESQLPRVQQGDPVARYFGLKRGQVVKIVRPSETAGRYVSYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. TrEMBL
Match: A0A2C9JI21 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106061391 PE=3 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.665e-67
Identity = 98/207 (47.34%), Postives = 152/207 (73.43%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLN------ADRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            + E +KLWRIR T MQ+ +DRGYLVT +E + + + FK +F +        R++L ++  H +DP + ++VFF D+ K+ ++ I+ Y   M+  N  RAII+++  +TPSAK  L EMA + +++E F ESEL++N+T+H+LVP+H V++ EEK E+L+RY +KESQ+PRIQQ DP++RYFG+K+G + KI+R SETAG+Y++YR+V
Sbjct:    4 QQETYKLWRIRKTVMQLCHDRGYLVTQEELDQTLDGFKAQFGDKPSERKPSRSDLIVLVAHNDDPTDQMFVFFPDESKVGIKTIKTYCQRMQEENIMRAIIVVQQGMTPSAKQALVEMAPK-YILEQFIESELLINITEHMLVPEHKVMTPEEKVELLNRYKLKESQLPRIQQGDPVARYFGLKRGQVVKIIRPSETAGRYVSYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. TrEMBL
Match: A0A0R3U238 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS490 PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 2.288e-67
Identity = 100/201 (49.75%), Postives = 154/201 (76.62%), Query Frame = 1
Query:   49 EVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNA-DRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRN-TITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E +KLWRI+ T ++M +DRGYLV  KE + + E+FK    +   R +L +V NH+EDPA+++YVFF ++EK+ ++ IR Y+D M+  +T +AI++++   +TP+AK  + EMA   + +E F+E+EL+VN+T+H LVP+H VL++EEKKE+LDRY +KESQ+P++Q  DP++RY+G+K+G + +I R SETAG+YITYRIV
Sbjct:    6 ETYKLWRIKKTILKMCHDRGYLVMQKELDQTLEEFKEAVGDPPSRKDLLMVVNHEEDPADMLYVFFPEEEKVNMKTIRAYVDQMQQDHTYKAILVLQERGLTPAAKTAIAEMA-HKYTLESFYENELMVNITEHQLVPQHSVLTTEEKKELLDRYRLKESQLPKMQASDPVARYYGLKRGQVVRINRPSETAGRYITYRIV 205          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. TrEMBL
Match: A0A0R3VTQ3 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS636 PE=3 SV=2)

HSP 1 Score: 215.312 bits (547), Expect = 2.288e-67
Identity = 101/203 (49.75%), Postives = 156/203 (76.85%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNA-DRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNT-ITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E E +KLWRI+ T ++M +DRGYLV  KE + + ++FK    +   R +L +V NH+EDPA+++YVFF +++K+ ++ IR Y+D M+  +T +AI+++R+  +TP+AK  + EMA   + +E F+E+EL+VN+T+H LVPKH VL++EEKKE+LDRY +KESQ+P++Q  DP++RY+G+K+G + +I R SETAG+YITYRIV
Sbjct:    4 ECETYKLWRIKKTILKMCHDRGYLVMQKELDQTLDEFKEAVGDPPSRKDLLMVVNHEEDPADMLYVFFPEEDKVNMKTIRAYVDQMQQDHTYKAILVLRDGGLTPAAKTAISEMA-HKYTLESFYENELMVNITEHQLVPKHSVLTNEEKKELLDRYRLKESQLPKMQVSDPVARYYGLKRGQVVRINRPSETAGRYITYRIV 205          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Cavefish
Match: POLR2E (RNA polymerase II subunit E [Source:NCBI gene;Acc:103030076])

HSP 1 Score: 204.142 bits (518), Expect = 2.704e-66
Identity = 93/207 (44.93%), Postives = 149/207 (71.98%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + ++FK++F +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RAII+++  +TPSAK  L +MA + +++E F + EL++N+T+H LVP+H V++ EE  E+L RY +KESQ+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLDEFKSQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKMYCQRMQEENITRAIIVVQMGMTPSAKQSLVDMAPK-YILEQFLQQELLINITEHELVPEHIVMTKEEVTELLARYKLKESQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Yeast
Match: RPB5 (RNA polymerase subunit ABC27; common to RNA polymerases I, II, and III; contacts DNA and affects transactivation [Source:SGD;Acc:S000000358])

HSP 1 Score: 167.162 bits (422), Expect = 1.213e-52
Identity = 84/216 (38.89%), Postives = 136/216 (62.96%), Query Frame = 1
Query:   28 MNSVKEDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNA----DRNELSIVANHQEDP------ANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            M+   E  + +LWR   T  +M+ DRGY +T +E E+  EDFK ++ ++     R  +S  AN  E+          ++V F D+  + V+ ++ ++  ++  N +  I + +N ITPSA  ++  +   +  IE F+E+ L+VN+T H LVPKH  LSS+EK+E+L RY +KESQ+PRIQ+ DP++ Y G+K+G++ KI+RKSET+G+Y +YRI 
Sbjct:    1 MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPAT--IETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRIC 214          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Nematostella
Match: EDO45411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT72])

HSP 1 Score: 187.193 bits (474), Expect = 4.029e-60
Identity = 89/206 (43.20%), Postives = 142/206 (68.93%), Query Frame = 1
Query:   46 DEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLN------ADRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            D  +K WRIR T MQ+ N    L+   E + + E FK +F +        R++LSI+  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RA+I+++  +TPSAK  L +MA + +++E F E+EL++N+T+H LVP+H +++ +EK+E+L RY +KE Q+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    5 DLTYKFWRIRKTVMQVCNG---LILRDELDKTLEQFKEQFGDRPSEGRPSRSDLSILVAHNDDPTDQMFVFFPEEPKVGIKTIKQYCQRMQEENISRAVIVVQLGMTPSAKQALVDMAPK-YILEQFVEAELMINITEHELVPEHVLMTPDEKQELLLRYKLKEHQLPRIQSGDPVARYFGLKRGQVVKIIRPSETAGRYITYRLV 206          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Medaka
Match: POLR2E (RNA polymerase II subunit E [Source:NCBI gene;Acc:101160893])

HSP 1 Score: 204.912 bits (520), Expect = 1.200e-66
Identity = 94/207 (45.41%), Postives = 149/207 (71.98%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + E+FK++F +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RAII+++  +TPSAK  L +MA + +++E F + EL++N+T+H LVP+H V++ EE  E+L RY +KESQ+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKSQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKMYCQRMQEENITRAIIVVQMGMTPSAKQSLVDMAPK-YILEQFLQQELLINITEHELVPEHIVMTKEEVTELLARYKLKESQLPRIQAGDPVARYFGLKRGQVVKIIRPSETAGRYITYRLV 209          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Medaka
Match: POLR2E (RNA polymerase II subunit E [Source:NCBI gene;Acc:101160893])

HSP 1 Score: 172.94 bits (437), Expect = 1.858e-54
Identity = 84/207 (40.58%), Postives = 129/207 (62.32%), Query Frame = 1
Query:   43 EDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD------RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            E+E ++LW+IR T MQ+ +DRGYLVT  E + + E+FK++F +        R +L+++  H +DP + ++VFF ++ K+ ++ I+ Y   M+  N  RAII+++  +TPSAK                             LVP+H V++ EE  E+L RY +KESQ+PRIQ  DP++RYFG+K+G + KI+R SETAG+YITYR+V
Sbjct:    4 EEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKSQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKMYCQRMQEENITRAIIVVQMGMTPSAKQ----------------------------LVPEHIVMTKEEVTELLARYKLKESQLPRIQAGDPVARYFGLKRGQVVKIIRPSETAGRYITYRLV 182          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Planmine SMEST
Match: SMESG000036424.1 (SMESG000036424.1)

HSP 1 Score: 425.631 bits (1093), Expect = 5.837e-154
Identity = 207/207 (100.00%), Postives = 207/207 (100.00%), Query Frame = 1
Query:   28 MNSVKEDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNADRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIVY 648
            MNSVKEDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNADRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIVY
Sbjct:    1 MNSVKEDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNADRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIVY 207          
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Planmine SMEST
Match: SMESG000072788.1 (SMESG000072788.1)

HSP 1 Score: 102.064 bits (253), Expect = 1.194e-26
Identity = 62/194 (31.96%), Postives = 107/194 (55.15%), Query Frame = 1
Query:   67 RIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNADRNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAIIIIRNTITPSAKNILEEMAKESF-MIEVFHESELIVNVTKHVLVPKHYVLSSEEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKYITYRIV 645
            RIR   M+ML+DRGY + N     +++ FK  F+N +  +L+I   +  + +  ++ F  D  K ++     Y+ C + ++   AI I ++ +     N + E+   +  ++E F E EL VNV++H  VP+H +LS  EK  VL++Y     Q PRI   DP+++Y+   +  MF I+R+ +   +Y TYR+V
Sbjct:   22 RIRQHTMEMLHDRGYKIENNI--TNDKCFKEHFINKELKDLNISCLNSRNESIYVHFFGCDIRKSSIDDSLKYL-CEQDYDG--AIFIFKDPMNSIISNRVAEVNFNNLILLETFIEDELTVNVSRHSFVPRHILLSESEKLAVLEKYRSTADQFPRIFVTDPVAKYYRAARNQMFHIIRQYDDGEQYDTYRMV 210          
The following BLAST results are available for this feature:
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POLR2E7.145e-6443.48RNA polymerase II subunit E [Source:HGNC Symbol;Ac... [more]
POLR2E7.145e-6443.48RNA polymerase II subunit E [Source:HGNC Symbol;Ac... [more]
POLR2E7.145e-6443.48RNA polymerase II subunit E [Source:HGNC Symbol;Ac... [more]
POLR2E5.460e-5240.86RNA polymerase II subunit E [Source:HGNC Symbol;Ac... [more]
POLR2E9.077e-5238.46RNA polymerase II subunit E [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpb-51.269e-6846.86DNA-directed RNA polymerases I, II, and III subuni... [more]
back to top
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rpb51.479e-6445.41gene:FBgn0033571 transcript:FBtr0088237[more]
Rpb51.479e-6445.41gene:FBgn0033571 transcript:FBtr0331935[more]
back to top
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
polr2eb2.403e-6644.93polymerase (RNA) II (DNA directed) polypeptide E, ... [more]
CABZ01024418.19.673e-6543.96polymerase (RNA) II (DNA directed) polypeptide E, ... [more]
back to top
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
polr2e9.725e-6543.48polymerase (RNA) II (DNA directed) polypeptide E, ... [more]
polr2e2.005e-5238.65polymerase (RNA) II (DNA directed) polypeptide E, ... [more]
back to top
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Polr2e5.268e-6644.44polymerase (RNA) II (DNA directed) polypeptide E [... [more]
back to top
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8XGH1|RPAB1_CAEBR3.320e-6847.34DNA-directed RNA polymerases I, II, and III subuni... [more]
sp|Q9N5K2|RPAB1_CAEEL1.614e-6746.86DNA-directed RNA polymerases I, II, and III subuni... [more]
sp|B0BNE2|RPAB1_RAT3.685e-6544.44DNA-directed RNA polymerases I, II, and III subuni... [more]
sp|Q80UW8|RPAB1_MOUSE3.685e-6544.44DNA-directed RNA polymerases I, II, and III subuni... [more]
sp|Q5R587|RPAB1_PONAB4.281e-6443.48DNA-directed RNA polymerases I, II, and III subuni... [more]
back to top
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SVP32.496e-6949.26Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0L8GSH73.858e-6847.83Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A2C9JI211.665e-6747.34Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A0R3U2382.288e-6749.75Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3VTQ32.288e-6749.75Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
POLR2E2.704e-6644.93RNA polymerase II subunit E [Source:NCBI gene;Acc:... [more]
back to top
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RPB51.213e-5238.89RNA polymerase subunit ABC27; common to RNA polyme... [more]
back to top
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO454114.029e-6043.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
POLR2E1.200e-6645.41RNA polymerase II subunit E [Source:NCBI gene;Acc:... [more]
POLR2E1.858e-5440.58RNA polymerase II subunit E [Source:NCBI gene;Acc:... [more]
back to top
BLAST of DNA-directed RNA polymerases I, II, and III subunit RPABC1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000036424.15.837e-154100.00SMESG000036424.1[more]
SMESG000072788.11.194e-2631.96SMESG000072788.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012308 ID=SMED30012308|Name=DNA-directed RNA polymerases I, II, and III subunit RPABC1|organism=Schmidtea mediterranea sexual|type=transcript|length=665bp
ATTTAATATTTGAATAATATTTGAATAATGAATTCGGTTAAAGAAGATGA
AGTTTTTAAGTTATGGCGCATTAGAATTACTGCAATGCAGATGCTAAATG
ACAGGGGTTATTTAGTTACTAACAAAGAATTTGAAATTTCCGAAGAAGAT
TTCAAAAATAGATTTTTAAACGCTGATAGAAATGAACTATCAATTGTAGC
AAATCATCAAGAAGATCCAGCTAACATTATTTATGTATTTTTCTCCGACG
ATGAAAAGCTAGCTGTTCAACACATTCGTAACTACATTGATTGCATGAAA
AGTCACAACACTAAACGAGCAATAATAATAATTAGAAACACAATCACACC
TTCAGCTAAGAATATTCTAGAAGAAATGGCCAAAGAAAGTTTTATGATTG
AAGTTTTTCATGAAAGTGAACTGATTGTAAATGTTACCAAACATGTTTTA
GTTCCAAAACACTATGTTTTGTCTAGCGAGGAAAAAAAAGAAGTTTTAGA
TCGATATTTAGTTAAAGAAAGTCAAATGCCCCGCATTCAGCAAAAAGATC
CAATTTCAAGATATTTTGGTGTAAAAAAAGGTGATATGTTTAAAATAGTG
AGAAAATCGGAAACAGCAGGAAAATATATTACATATAGAATTGTGTATTA
ATAAATTTTAATTTT
back to top

protein sequence of SMED30012308-orf-1

>SMED30012308-orf-1 ID=SMED30012308-orf-1|Name=SMED30012308-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=208bp
MNSVKEDEVFKLWRIRITAMQMLNDRGYLVTNKEFEISEEDFKNRFLNAD
RNELSIVANHQEDPANIIYVFFSDDEKLAVQHIRNYIDCMKSHNTKRAII
IIRNTITPSAKNILEEMAKESFMIEVFHESELIVNVTKHVLVPKHYVLSS
EEKKEVLDRYLVKESQMPRIQQKDPISRYFGVKKGDMFKIVRKSETAGKY
ITYRIVY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
GO:0005665DNA-directed RNA polymerase II, core complex
GO:0005666DNA-directed RNA polymerase III complex
GO:0005736DNA-directed RNA polymerase I complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR035913RPB5-like_sf
IPR036710RNA_pol_Rpb5_N_sf
IPR039531Rpb5-like
IPR000783RNA_pol_subH/Rpb5_C
IPR005571RNA_pol_Rpb5_N
IPR014381DNA_RNA_pol_RPB5_euk/virus
IPR020608RNA_pol_subH/Rpb5_CS
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006360transcription from RNA polymerase I promoter
GO:0006366transcription from RNA polymerase II promoter
GO:0006383transcription from RNA polymerase III promoter
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003899DNA-directed 5'-3' RNA polymerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR035913RPB5-like RNA polymerase subunit superfamilyGENE3DG3DSA:3.90.940.20coord: 135..206
e-value: 7.0E-33
score: 114.2
IPR035913RPB5-like RNA polymerase subunit superfamilySUPERFAMILYSSF55287RPB5-like RNA polymerase subunitcoord: 132..207
IPR000783RNA polymerase, subunit H/Rpb5 C-terminalPFAMPF01191RNA_pol_Rpb5_Ccoord: 134..206
e-value: 4.3E-32
score: 109.8
IPR005571RNA polymerase, Rpb5, N-terminalPFAMPF03871RNA_pol_Rpb5_Ncoord: 6..89
e-value: 1.2E-24
score: 86.7
IPR036710RNA polymerase Rpb5, N-terminal domain superfamilyGENE3DG3DSA:3.40.1340.10coord: 4..134
e-value: 8.6E-41
score: 141.2
IPR036710RNA polymerase Rpb5, N-terminal domain superfamilySUPERFAMILYSSF53036Eukaryotic RPB5 N-terminal domaincoord: 6..135
IPR014381DNA-directed RNA polymerase RPB5 subunit, eukaryote/virusPIRSFPIRSF000747RPB5coord: 1..207
e-value: 8.5E-75
score: 248.4
IPR039531DNA-directed RNA polymerase subunit Rpb5-likePANTHERPTHR10535DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC1coord: 5..206
NoneNo IPR availablePANTHERPTHR10535:SF0DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC1coord: 5..206
NoneNo IPR availablePRODOMPD005155coord: 141..206
e-value: 4.0E-19
score: 231.0
IPR020608RNA polymerase, subunit H/Rpb5, conserved sitePROSITEPS01110RNA_POL_H_23KDcoord: 139..152