G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30012307
Length (bp)794
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30012307) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30012307) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30012307) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30012307) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012307

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30012307SMESG000023846.1 dd_Smed_v4_477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012307SMESG000023846.1 dd_Smed_v4_477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012307SMESG000023846.1 dd_Smed_v4_477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30012307SMESG000023846.1 dd_Smed_v4_477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012307SMESG000023846.1 dd_Smed_v4_477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30012307SMESG000023846.1 dd_Smed_v4_477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012307SMESG000023846.1 dd_Smed_v4_477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012307SMESG000023846.1 dd_Smed_v4_477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30012307SMESG000023846.1 dd_Smed_v6_477_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012307SMESG000023846.1 OX_Smed_1.0.03756ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 51.6026 bits (122), Expect = 4.896e-8
Identity = 33/101 (32.67%), Postives = 50/101 (49.50%), Query Frame = 1
Query:  136 KMAEWQHGLCGCFSDCGTCLL-SYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNA 435
            + + WQ G+C CFSDCG CL  ++  PC  +G    A  + C LCG             +R   R + GI G+ C D +A+  CP C++ Q  +++    A
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCG---------TSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRA 111          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 51.6026 bits (122), Expect = 4.896e-8
Identity = 33/101 (32.67%), Postives = 50/101 (49.50%), Query Frame = 1
Query:  136 KMAEWQHGLCGCFSDCGTCLL-SYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNA 435
            + + WQ G+C CFSDCG CL  ++  PC  +G    A  + C LCG             +R   R + GI G+ C D +A+  CP C++ Q  +++    A
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCG---------TSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRA 111          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 51.6026 bits (122), Expect = 4.896e-8
Identity = 33/101 (32.67%), Postives = 50/101 (49.50%), Query Frame = 1
Query:  136 KMAEWQHGLCGCFSDCGTCLL-SYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNA 435
            + + WQ G+C CFSDCG CL  ++  PC  +G    A  + C LCG             +R   R + GI G+ C D +A+  CP C++ Q  +++    A
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCG---------TSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRA 111          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 51.6026 bits (122), Expect = 4.896e-8
Identity = 33/101 (32.67%), Postives = 50/101 (49.50%), Query Frame = 1
Query:  136 KMAEWQHGLCGCFSDCGTCLL-SYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNA 435
            + + WQ G+C CFSDCG CL  ++  PC  +G    A  + C LCG             +R   R + GI G+ C D +A+  CP C++ Q  +++    A
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCG---------TSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRA 111          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: ponzr10 (plac8 onzin related protein 10 [Source:ZFIN;Acc:ZDB-GENE-081107-68])

HSP 1 Score: 46.595 bits (109), Expect = 4.832e-6
Identity = 36/127 (28.35%), Postives = 57/127 (44.88%), Query Frame = 1
Query:  127 NKLKMAEWQHGLCGCFSDCGTCLLSYIV-PCYLVGKDAEAVGDSCF----LCGLGYLVIYG---CVGAI---VRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLA-MNAAAMSIERD*IIQ 471
            +K +   W  G+C CF D  +C  +Y   PC+      E    +C     + G   +  +G   CV  +   +R  +R K  I G+ C D+  SC C  CS  Q ++E+ A  NA  M +    ++Q
Sbjct:   11 SKPQETLWNSGICDCFQDLNSCCYAYWCCPCFACSTAGEFGESTCLPLVDILGPAVMASFGVAFCVPPVTMSLRVAIRHKYNIRGSICNDIAVSCCCVMCSWCQMNREIKARKNAPNMILTTQPLVQ 137          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: BX005027.2 (plac8 onzin related protein 10 [Source:NCBI gene;Acc:100001900])

HSP 1 Score: 46.595 bits (109), Expect = 5.195e-6
Identity = 36/127 (28.35%), Postives = 57/127 (44.88%), Query Frame = 1
Query:  127 NKLKMAEWQHGLCGCFSDCGTCLLSYIV-PCYLVGKDAEAVGDSCF----LCGLGYLVIYG---CVGAI---VRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLA-MNAAAMSIERD*IIQ 471
            +K +   W  G+C CF D  +C  +Y   PC+      E    +C     + G   +  +G   CV  +   +R  +R K  I G+ C D+  SC C  CS  Q ++E+ A  NA  M +    ++Q
Sbjct:   13 SKPQETLWNSGICDCFQDLNSCCYAYWCCPCFACSTAGEFGESTCLPLVDILGPAVMASFGVAFCVPPVTMSLRVAIRHKYNIRGSICNDIAVSCCCVMCSWCQMNREIKARKNAPNMILTTQPLVQ 139          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 51.9878 bits (123), Expect = 3.060e-8
Identity = 36/104 (34.62%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  136 KMAEWQHGLCGCFSDCGTCLLSYIVPCYL-VGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEV---LAMNA 435
            + + WQ  LC CFSDCG CL      C+  +G    A  + C LCG             +R   R + GI G+ C D + + +CP CSV Q  +++    AMNA
Sbjct:   19 QNSNWQTSLCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCG---------TTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDINRRRAMNA 111          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 51.9878 bits (123), Expect = 3.060e-8
Identity = 36/104 (34.62%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  136 KMAEWQHGLCGCFSDCGTCLLSYIVPCYL-VGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEV---LAMNA 435
            + + WQ  LC CFSDCG CL      C+  +G    A  + C LCG             +R   R + GI G+ C D + + +CP CSV Q  +++    AMNA
Sbjct:   19 QNSNWQTSLCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCG---------TTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDINRRRAMNA 111          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 51.9878 bits (123), Expect = 3.060e-8
Identity = 36/104 (34.62%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  136 KMAEWQHGLCGCFSDCGTCLLSYIVPCYL-VGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEV---LAMNA 435
            + + WQ  LC CFSDCG CL      C+  +G    A  + C LCG             +R   R + GI G+ C D + + +CP CSV Q  +++    AMNA
Sbjct:   19 QNSNWQTSLCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCG---------TTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDINRRRAMNA 111          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P0CW97|PCR3_ARATH (Protein PLANT CADMIUM RESISTANCE 3 OS=Arabidopsis thaliana OX=3702 GN=PCR3 PE=3 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.154e-8
Identity = 35/113 (30.97%), Postives = 53/113 (46.90%), Query Frame = 1
Query:  109 SSRLH*NKLKMAEWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAV---GDSCFLCGLGYLVIYGCVG------AIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEV 420
            S  L  N     EW  G C CFSDC  C ++++ PC   G+ A+ V     SC   G  Y+++    G       I R K+R +  I G+ C D +    C  C++ Q ++E+
Sbjct:    3 SQHLQANPHAEGEWSTGFCDCFSDCQNCCITWLCPCITFGQVADIVDRGNTSCGTAGALYVLLAAITGCGCLYSCIYRGKIRAQYNIRGDGCTDCLKHFCCELCALTQEYREL 115          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9LQU4|PCR2_ARATH (Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana OX=3702 GN=PCR2 PE=1 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 7.762e-8
Identity = 35/113 (30.97%), Postives = 49/113 (43.36%), Query Frame = 1
Query:  109 SSRLH*NKLKMAEWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLG------YLVIYGCV---GAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEV 420
            +  LH       EW  G C CFSDC  C +++  PC   G+ AE V      CG          V+ GC        R K+R +  I G+ C D +    C  CS+ Q ++E+
Sbjct:    3 AQHLHAKPHAEGEWSTGFCDCFSDCKNCCITFWCPCITFGQVAEIVDRGSTSCGTAGALYALIAVVTGCACIYSCFYRGKMRAQYNIKGDDCTDCLKHFCCELCSLTQQYREL 115          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|D9HP20|CNR4_MAIZE (Cell number regulator 4 OS=Zea mays OX=4577 GN=CNR4 PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 1.005e-7
Identity = 37/113 (32.74%), Postives = 52/113 (46.02%), Query Frame = 1
Query:  145 EWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLV----------------IYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNA 435
            EW  GLCGCFSDC +C LS++ PC   G+ AE +      CGL  L+                IY C     R+K+R    +    C D     WC  C+++Q ++E+    A
Sbjct:   10 EWTTGLCGCFSDCKSCCLSFLCPCIPFGQVAEVLDKGMTSCGLAGLLYCLLLHAGVAVVPCHCIYTCT---YRRKLRAAYDLPPEPCADCCVHMWCGPCAISQMYRELKNRGA 119          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JI48|PLAC8_MOUSE (Placenta-specific gene 8 protein OS=Mus musculus OX=10090 GN=Plac8 PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 2.140e-7
Identity = 36/104 (34.62%), Postives = 50/104 (48.08%), Query Frame = 1
Query:  136 KMAEWQHGLCGCFSDCGTCLLSYIVPCYL-VGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEV---LAMNA 435
            + + WQ  LC CFSDCG CL      C+  +G    A  + C LCG             +R   R + GI G+ C D + + +CP CSV Q  +++    AMNA
Sbjct:   19 QNSNWQTSLCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCG---------TTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDINRRRAMNA 111          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9NZF1|PLAC8_HUMAN (Placenta-specific gene 8 protein OS=Homo sapiens OX=9606 GN=PLAC8 PE=2 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 2.351e-7
Identity = 33/101 (32.67%), Postives = 50/101 (49.50%), Query Frame = 1
Query:  136 KMAEWQHGLCGCFSDCGTCLL-SYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNA 435
            + + WQ G+C CFSDCG CL  ++  PC  +G    A  + C LCG             +R   R + GI G+ C D +A+  CP C++ Q  +++    A
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCG---------TSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRA 111          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A267F6N5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018526g1 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 2.515e-34
Identity = 59/107 (55.14%), Postives = 77/107 (71.96%), Query Frame = 1
Query:  139 MAEWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD 459
            MA+++HGLCGCF DCG C+++Y VPCY  GK+AEAVGDSC LCGL +L +  CVGAIVR K+REK+GI+G+F  D      CP C++ Q  QEV  M+     +ER+
Sbjct:    1 MADFKHGLCGCFDDCGLCIITYFVPCYTFGKNAEAVGDSCVLCGLAFLFVSPCVGAIVRGKIREKQGINGSFIGDFFVHLCCPLCALVQDAQEVKEMSPGGQVVERE 107          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8JBM9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001673g1 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.168e-33
Identity = 58/105 (55.24%), Postives = 78/105 (74.29%), Query Frame = 1
Query:  145 EWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD 459
            +++HGLCGCF D G C+++Y+VPCY  GK+AEAV +SC LCG+GYL +  C+GAIVR K+REK+GI G F  DL+A   CP C++ Q  QEV AM  A  ++ER+
Sbjct:    4 QFKHGLCGCFDDFGLCIVTYLVPCYTFGKNAEAVQESCLLCGIGYLFVSPCLGAIVRGKIREKQGIPGRFVSDLLAHLCCPLCALMQDAQEVKAMAPAGSAVERE 108          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8H2V8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.279e-33
Identity = 58/105 (55.24%), Postives = 78/105 (74.29%), Query Frame = 1
Query:  145 EWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD 459
            +++HGLCGCF D G C+++Y+VPCY  GK+AEAV +SC LCG+GYL +  C+GAIVR K+REK+GI G F  DL+A   CP C++ Q  QEV AM  A  ++ER+
Sbjct:   66 QFKHGLCGCFDDFGLCIVTYLVPCYTFGKNAEAVQESCLLCGIGYLFVSPCLGAIVRGKIREKQGIPGRFVSDLLAHLCCPLCALMQDAQEVKAMAPAGSAVERE 170          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8GZL5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033858g1 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 3.688e-31
Identity = 57/108 (52.78%), Postives = 77/108 (71.30%), Query Frame = 1
Query:  139 MAEWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAM-NAAAMSIERD 459
            M++++HGLCGCF DCG C+++Y +PCY  GK AEAVGDSC LC +GYL +  CVGA++R KVR+K+GI+G F  D      CP C++ Q  QEV  M   +A S+ER+
Sbjct:    1 MSQYRHGLCGCFDDCGICIVAYFLPCYTHGKTAEAVGDSCVLCAIGYLFVAPCVGAVIRGKVRDKQGIAGGFVGDFFTYLCCPLCALVQDAQEVKDMVPPSAQSLERE 108          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8GYB9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.644e-30
Identity = 55/98 (56.12%), Postives = 70/98 (71.43%), Query Frame = 1
Query:  121 H*NKLKMAEWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQ 414
            H     MA+++HGLCGCF DCG C+++Y VPCY  GK+AEAVGDSC LCGL +L +  CVGAIVR K+REK+GI+G+F  D      CP C++ Q  Q
Sbjct:   30 HEGPRSMADFKHGLCGCFDDCGLCIITYFVPCYTFGKNAEAVGDSCVLCGLAFLFVSPCVGAIVRGKIREKQGINGSFIGDFFVHLCCPLCALVQDAQ 127          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ponzr10 (placenta-specific gene 8 protein-like [Source:NCBI gene;Acc:103030477])

HSP 1 Score: 45.8246 bits (107), Expect = 6.520e-6
Identity = 32/124 (25.81%), Postives = 55/124 (44.35%), Query Frame = 1
Query:  136 KMAEWQHGLCGCFSDCGTCLLSYIV-PCYLVGKDAEAVGDSCF----LCGLGYLVIYG---CVGAI---VRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD*IIQI 474
            ++  W  GLC C  D   C  ++   PC+      +   + C     +CG   +  +G   CV  +   +R  VR +  ISG+ C D+  +C+C  CS  Q ++E+      AM I    ++ +
Sbjct:   17 RVTFWTTGLCDCCQDMNNCCFAFWCCPCHACSTTEKFGENRCLPLVDICGPAVMAAFGVAICVPPVALSMRVAVRYRYQISGDICEDIAITCFCAWCSWCQMNREITQRQQRAMVISSQPVVPV 140          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO50068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFB0])

HSP 1 Score: 104.375 bits (259), Expect = 1.455e-28
Identity = 52/94 (55.32%), Postives = 68/94 (72.34%), Query Frame = 1
Query:  145 EWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYL--VIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEV 420
            +W +GL GCF+DCGTCL++YI PCY  GK+AEAVGDSC LCGL +   V+   V + VR K+RE+ GISG+F  D  A+  CP CS+ Q+ Q+V
Sbjct:    4 DWNNGLFGCFNDCGTCLITYIAPCYTFGKNAEAVGDSCLLCGLAFFVPVVDLIVMSSVRGKIREQHGISGSFIGDCAATICCPFCSLVQSAQQV 97          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO44794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR8])

HSP 1 Score: 91.6633 bits (226), Expect = 1.244e-23
Identity = 47/108 (43.52%), Postives = 67/108 (62.04%), Query Frame = 1
Query:  148 WQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCV----GAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD 459
            W  G+CGCF D  TC L+Y  PC + GK+AEAVG++CFL   G+L   GCV    GA +R+K+REK GI G+F  D +   +CP C+ +Q  +E+ A   +  ++ R 
Sbjct:    3 WSSGICGCFEDINTCALTYFCPCVVAGKNAEAVGENCFL--HGFLSTLGCVGIFCGAKIREKIREKHGIEGSFGNDCIMHWFCPLCAYSQEARELKARCPSGQAMARS 108          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO36116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJK5])

HSP 1 Score: 80.8777 bits (198), Expect = 1.769e-19
Identity = 45/109 (41.28%), Postives = 62/109 (56.88%), Query Frame = 1
Query:  139 MAEWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCV--GAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD 459
            M ++ +GL GCFSD   CL +Y VPCY  GK AEAVG+ C +CG+  +V    +     +R KVRE++GI G+F  DL+ +  C  CS+ Q   E+        SI R 
Sbjct:    1 MGQFSNGLFGCFSDIPLCLTTYCVPCYTFGKTAEAVGEDCLMCGIVLMVPCANIWFATQIRGKVREQKGIEGSFVNDLLMTWCCGFCSIIQEALEMGVKAPIGNSIARS 109          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO42612 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W1])

HSP 1 Score: 50.8322 bits (120), Expect = 3.689e-8
Identity = 29/92 (31.52%), Postives = 47/92 (51.09%), Query Frame = 1
Query:  145 EWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEV 420
            +W  G+CGCF D G+CLL Y  PC+L+   ++ +G+ C         + G     +R K+R ++ I G+   D  A    P C + Q  +E+
Sbjct:   53 DWHSGMCGCFDDIGSCLLGYFCPCFLLIDVSQRMGEGCCFPCCCPGALVG-----LRVKLRVEQNIQGSLINDYCAVQCLPLCVLCQLSREL 139          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023846.1 (SMESG000023846.1)

HSP 1 Score: 217.238 bits (552), Expect = 1.963e-72
Identity = 106/107 (99.07%), Postives = 106/107 (99.07%), Query Frame = 1
Query:  139 MAEWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD 459
            MAEWQHGLCGCFSDCGTCLLSY VPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD
Sbjct:    1 MAEWQHGLCGCFSDCGTCLLSYFVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD 107          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023842.1 (SMESG000023842.1)

HSP 1 Score: 119.013 bits (297), Expect = 6.607e-34
Identity = 68/107 (63.55%), Postives = 83/107 (77.57%), Query Frame = 1
Query:  139 MAEWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD 459
            M EW+HGLCGC  DCGTCLL+Y VPCYL+GKDAEAVGDSCFLCG G L    C+ A VR KVR++R I+G+F  DL+ +  C CC VAQ HQEV+AM  ++M+IER+
Sbjct:    1 MGEWEHGLCGCCDDCGTCLLTYFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE 107          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023831.1 (SMESG000023831.1)

HSP 1 Score: 118.242 bits (295), Expect = 1.544e-33
Identity = 55/107 (51.40%), Postives = 71/107 (66.36%), Query Frame = 1
Query:  139 MAEWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD 459
            M++WQ G+CGCF D GTC+L+Y  PCYLVG DAE V  +C LC + +L    C+   +R KVR KR I G  C D V S + PCC+VAQ H EV  M+  AM++ER+
Sbjct:    1 MSDWQQGICGCFGDLGTCVLAYFAPCYLVGLDAETVDKNCVLCCIAFLFFPPCITCHIRGKVRSKRNIPGGSCNDCVVSLFLPCCTVAQMHHEVKHMSGTAMALERE 107          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023836.1 (SMESG000023836.1)

HSP 1 Score: 116.701 bits (291), Expect = 4.620e-33
Identity = 58/107 (54.21%), Postives = 73/107 (68.22%), Query Frame = 1
Query:  139 MAEWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD 459
            M+EWQ G+CGCF D GTCLLSY VPCYL+G DAEAV +SC LCG+  +    C+   VR K+REK+ I G  C D + S +  CC+VAQ H EV  M   A+S+ER+
Sbjct:    1 MSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVISIFFPPCIICYVRGKIREKQNIDGGCCTDCLCSFFLGCCAVAQMHHEVKHMQGNAISLERE 107          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000060403.1 (SMESG000060403.1)

HSP 1 Score: 109.768 bits (273), Expect = 2.763e-30
Identity = 49/104 (47.12%), Postives = 66/104 (63.46%), Query Frame = 1
Query:  145 EWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVG-AIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIE 453
            +WQHGLC CF DCG CL+++  PCY VG DAEAVG++C LCG   L    C    ++R  +R+++ I G++C D     WCPCC+ AQ HQE    +  +MS E
Sbjct:   10 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVFFWCPCCTTAQMHQETYEFSPHSMSRE 113          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PLAC84.896e-832.67placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
PLAC84.896e-832.67placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
PLAC84.896e-832.67placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
PLAC84.896e-832.67placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ponzr104.832e-628.35plac8 onzin related protein 10 [Source:ZFIN;Acc:ZD... [more]
BX005027.25.195e-628.35plac8 onzin related protein 10 [Source:NCBI gene;A... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Plac83.060e-834.62placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
Plac83.060e-834.62placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
Plac83.060e-834.62placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0CW97|PCR3_ARATH2.154e-830.97Protein PLANT CADMIUM RESISTANCE 3 OS=Arabidopsis ... [more]
sp|Q9LQU4|PCR2_ARATH7.762e-830.97Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis ... [more]
sp|D9HP20|CNR4_MAIZE1.005e-732.74Cell number regulator 4 OS=Zea mays OX=4577 GN=CNR... [more]
sp|Q9JI48|PLAC8_MOUSE2.140e-734.62Placenta-specific gene 8 protein OS=Mus musculus O... [more]
sp|Q9NZF1|PLAC8_HUMAN2.351e-732.67Placenta-specific gene 8 protein OS=Homo sapiens O... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F6N52.515e-3455.14Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JBM92.168e-3355.24Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H2V83.279e-3355.24Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GZL53.688e-3152.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GYB92.644e-3056.12Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ponzr106.520e-625.81placenta-specific gene 8 protein-like [Source:NCBI... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO500681.455e-2855.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447941.244e-2343.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361161.769e-1941.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426123.689e-831.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023846.11.963e-7299.07SMESG000023846.1[more]
SMESG000023842.16.607e-3463.55SMESG000023842.1[more]
SMESG000023831.11.544e-3351.40SMESG000023831.1[more]
SMESG000023836.14.620e-3354.21SMESG000023836.1[more]
SMESG000060403.12.763e-3047.12SMESG000060403.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012307 ID=SMED30012307|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=794bp
TTTTTCTCATAGAATCCACATCGATTAATTTCCCGAATTCTCATTGTTTA
ATTCTTGTTTCAGCACTTTTTTTATTTAAATACAGCAACCGGGACTATGA
TAGACATATCTTCGAGGTTGCATTAAAACAAATTGAAAATGGCAGAATGG
CAACATGGATTATGCGGCTGTTTTTCTGACTGTGGAACCTGTTTATTATC
TTATATTGTGCCGTGCTATTTGGTGGGAAAGGATGCTGAAGCCGTTGGTG
ATAGCTGTTTCCTTTGCGGTCTAGGTTATTTGGTTATTTACGGGTGCGTT
GGAGCAATTGTTCGAAAAAAGGTCAGAGAAAAGCGAGGCATATCTGGAAA
CTTTTGCTTTGATCTTGTTGCCAGTTGTTGGTGTCCGTGTTGTTCGGTCG
CTCAAACCCATCAGGAAGTGCTGGCCATGAATGCTGCTGCCATGTCTATT
GAGAGGGATTAAATTATACAGATCTTCGATATTATGTGATGGGGCAACAT
TATTAACTTTTTTGATAACCGAAAAAATAGACATGAAATATTATGGATAT
TGGATAAGTAATAGATTGAGTGTTGAAGTTGAAATTTGTTTATGATTTCC
TTATTTTGAATTTGAATGAGTGAATAGCATGAGGTTTTAGGCAAATATAT
CTTGACTTTGTGTTTATACAGATTCCCAACCGAATTTTGAAAGGAATGAA
TTCTTAAGTTTATTATGGGAGTCCCCAAATGGTTGGCCATGTTTCTATAC
AAATAAATTAAACTGATGCAAGTATGGTGAGATAAAAACTAAAT
back to top

protein sequence of SMED30012307-orf-1

>SMED30012307-orf-1 ID=SMED30012307-orf-1|Name=SMED30012307-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=108bp
MAEWQHGLCGCFSDCGTCLLSYIVPCYLVGKDAEAVGDSCFLCGLGYLVI
YGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAA
AMSIERD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR006461PLAC_motif_containing
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006461PLAC8 motif-containing proteinPFAMPF04749PLAC8coord: 4..93
e-value: 1.9E-20
score: 73.7
IPR006461PLAC8 motif-containing proteinTIGRFAMTIGR01571TIGR01571coord: 3..94
e-value: 1.4E-22
score: 78.4
IPR006461PLAC8 motif-containing proteinPANTHERPTHR15907FAMILY NOT NAMEDcoord: 2..99
NoneNo IPR availablePANTHERPTHR15907:SF102coord: 2..99
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 39..58