V-type proton ATPase subunit D

Overview
NameV-type proton ATPase subunit D
Smed IDSMED30012306
Length (bp)1059
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of V-type proton ATPase subunit D (SMED30012306) t-SNE clustered cells

Violin plots show distribution of expression levels for V-type proton ATPase subunit D (SMED30012306) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of V-type proton ATPase subunit D (SMED30012306) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for V-type proton ATPase subunit D (SMED30012306) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012306

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012306SMESG000071275.1 Contig5665GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30012306SMESG000071275.1 dd_Smed_v4_1391_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012306SMESG000071275.1 dd_Smed_v4_1391_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30012306SMESG000071275.1 dd_Smed_v4_1391_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30012306SMESG000071275.1 dd_Smed_v4_1391_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012306SMESG000071275.1 Contig39570uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012306SMESG000071275.1 Contig39570newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of V-type proton ATPase subunit D vs. Ensembl Human
Match: ATP6V1D (ATPase H+ transporting V1 subunit D [Source:HGNC Symbol;Acc:HGNC:13527])

HSP 1 Score: 286.574 bits (732), Expect = 7.251e-96
Identity = 148/203 (72.91%), Postives = 174/203 (85.71%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGKDRI IFPSRMAQT MK RLKGAQ G +LLKKKSDALT++FRQILKKII+ K  MG VM+++ FSLAE KF  +G+ +  V+QNV KAQ+K+++ K+NVAGV LPVFE  +EG +SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIP+IERTL YII ELDEREREEFYRL
Sbjct:    1 MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFT-AGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. Ensembl Human
Match: ATP6V1D (ATPase H+ transporting V1 subunit D [Source:HGNC Symbol;Acc:HGNC:13527])

HSP 1 Score: 286.574 bits (732), Expect = 7.251e-96
Identity = 148/203 (72.91%), Postives = 174/203 (85.71%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGKDRI IFPSRMAQT MK RLKGAQ G +LLKKKSDALT++FRQILKKII+ K  MG VM+++ FSLAE KF  +G+ +  V+QNV KAQ+K+++ K+NVAGV LPVFE  +EG +SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIP+IERTL YII ELDEREREEFYRL
Sbjct:    1 MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFT-AGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. Ensembl Human
Match: ATP6V1D (ATPase H+ transporting V1 subunit D [Source:HGNC Symbol;Acc:HGNC:13527])

HSP 1 Score: 216.083 bits (549), Expect = 4.426e-69
Identity = 103/146 (70.55%), Postives = 125/146 (85.62%), Query Frame = 3
Query:  243 MGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MG VM+++ FSLAE KF  +G+ +  V+QNV KAQ+K+++ K+NVAGV LPVFE  +EG +SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIP+IERTL YII ELDEREREEFYRL
Sbjct:    3 MGEVMREAAFSLAEAKFT-AGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRL 147          
BLAST of V-type proton ATPase subunit D vs. Ensembl Human
Match: ATP6V1D (ATPase H+ transporting V1 subunit D [Source:HGNC Symbol;Acc:HGNC:13527])

HSP 1 Score: 197.208 bits (500), Expect = 6.618e-62
Identity = 106/160 (66.25%), Postives = 133/160 (83.12%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLD 551
            MSGKDRI IFPSRMAQT MK RLKGAQ G +LLKKKSDALT++FRQILKKII+ K  MG VM+++ FSLAE KF  +G+ +  V+QNV KAQ+K+++ K+NVAGV LPVFE  +EG +SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQ+SF  L+
Sbjct:    1 MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFT-AGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQSSFPGLN 159          
BLAST of V-type proton ATPase subunit D vs. Ensembl Human
Match: ATP6V1D (ATPase H+ transporting V1 subunit D [Source:HGNC Symbol;Acc:HGNC:13527])

HSP 1 Score: 174.481 bits (441), Expect = 2.534e-53
Identity = 83/108 (76.85%), Postives = 96/108 (88.89%), Query Frame = 3
Query:  357 KSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            ++ K+NVAGV LPVFE  +EG +SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIP+IERTL YII ELDEREREEFYRL
Sbjct:    1 RAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRL 108          
BLAST of V-type proton ATPase subunit D vs. Ensembl Celegans
Match: vha-14 (V-type proton ATPase subunit D [Source:UniProtKB/Swiss-Prot;Acc:P34462])

HSP 1 Score: 259.996 bits (663), Expect = 1.090e-85
Identity = 132/201 (65.67%), Postives = 161/201 (80.10%), Query Frame = 3
Query:   78 GKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            GKDRI +FPSRMAQT MK RLKGAQKGHSLLKKK+DAL ++FR IL+KI++ K  MG VMK++ FSLAE KF  +G+ +  V+QNV +AQ +V+  KENV GV LPVF+   +G ++Y+LTGL  GG  I RLKKNY KA++LLV LA+LQT F+TLDE IK TNRRVNAIEHVIIP+IE TL YI+ ELDE EREEF+R+
Sbjct:    5 GKDRIAVFPSRMAQTLMKTRLKGAQKGHSLLKKKADALNLRFRDILRKIVENKVLMGEVMKEAAFSLAEAKFT-AGDFSHTVIQNVSQAQYRVRMKKENVVGVFLPVFDAYQDGPDAYDLTGLGKGGANIARLKKNYNKAIELLVELATLQTCFITLDEAIKVTNRRVNAIEHVIIPRIENTLTYIVTELDEMEREEFFRM 204          
BLAST of V-type proton ATPase subunit D vs. Ensembl Celegans
Match: vha-14 (V-type proton ATPase subunit D [Source:UniProtKB/Swiss-Prot;Acc:P34462])

HSP 1 Score: 259.996 bits (663), Expect = 1.090e-85
Identity = 132/201 (65.67%), Postives = 161/201 (80.10%), Query Frame = 3
Query:   78 GKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            GKDRI +FPSRMAQT MK RLKGAQKGHSLLKKK+DAL ++FR IL+KI++ K  MG VMK++ FSLAE KF  +G+ +  V+QNV +AQ +V+  KENV GV LPVF+   +G ++Y+LTGL  GG  I RLKKNY KA++LLV LA+LQT F+TLDE IK TNRRVNAIEHVIIP+IE TL YI+ ELDE EREEF+R+
Sbjct:    5 GKDRIAVFPSRMAQTLMKTRLKGAQKGHSLLKKKADALNLRFRDILRKIVENKVLMGEVMKEAAFSLAEAKFT-AGDFSHTVIQNVSQAQYRVRMKKENVVGVFLPVFDAYQDGPDAYDLTGLGKGGANIARLKKNYNKAIELLVELATLQTCFITLDEAIKVTNRRVNAIEHVIIPRIENTLTYIVTELDEMEREEFFRM 204          
BLAST of V-type proton ATPase subunit D vs. Ensembl Celegans
Match: vha-14 (V-type proton ATPase subunit D [Source:UniProtKB/Swiss-Prot;Acc:P34462])

HSP 1 Score: 259.996 bits (663), Expect = 1.090e-85
Identity = 132/201 (65.67%), Postives = 161/201 (80.10%), Query Frame = 3
Query:   78 GKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            GKDRI +FPSRMAQT MK RLKGAQKGHSLLKKK+DAL ++FR IL+KI++ K  MG VMK++ FSLAE KF  +G+ +  V+QNV +AQ +V+  KENV GV LPVF+   +G ++Y+LTGL  GG  I RLKKNY KA++LLV LA+LQT F+TLDE IK TNRRVNAIEHVIIP+IE TL YI+ ELDE EREEF+R+
Sbjct:    5 GKDRIAVFPSRMAQTLMKTRLKGAQKGHSLLKKKADALNLRFRDILRKIVENKVLMGEVMKEAAFSLAEAKFT-AGDFSHTVIQNVSQAQYRVRMKKENVVGVFLPVFDAYQDGPDAYDLTGLGKGGANIARLKKNYNKAIELLVELATLQTCFITLDEAIKVTNRRVNAIEHVIIPRIENTLTYIVTELDEMEREEFFRM 204          
BLAST of V-type proton ATPase subunit D vs. Ensembl Fly
Match: Vha36-1 (gene:FBgn0022097 transcript:FBtr0087335)

HSP 1 Score: 279.256 bits (713), Expect = 2.310e-93
Identity = 146/203 (71.92%), Postives = 167/203 (82.27%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGKDR+ IFPSR AQ  MK RL GAQKGH LLKKK+DAL M+FR IL KII+ K  MG VMK++ FSLAE KF  SG+INQ+VLQNV KAQIK+++ K+NVAGV LPVFE   +G ++YEL GL+ GGQQ+ +LKKNY  A+ LLV LASLQTSFVTLDEVIK TNRRVNAIEHVIIP+I+RTL YII ELDE EREEFYRL
Sbjct:    1 MSGKDRLPIFPSRGAQMLMKARLAGAQKGHGLLKKKADALQMRFRLILGKIIETKTLMGDVMKEAAFSLAEAKFT-SGDINQVVLQNVTKAQIKIRTKKDNVAGVTLPVFESYQDGSDTYELAGLARGGQQLAKLKKNYQSAVKLLVELASLQTSFVTLDEVIKITNRRVNAIEHVIIPRIDRTLAYIISELDELEREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. Ensembl Fly
Match: Vha36-3 (gene:FBgn0040377 transcript:FBtr0345706)

HSP 1 Score: 272.322 bits (695), Expect = 1.347e-90
Identity = 141/203 (69.46%), Postives = 167/203 (82.27%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            M+ KDR+ IFPSR AQT MK RL GA KGH LLKKK+DAL M+FR IL KII+ K  MG VMK++ FSLAEVKF  +G+INQ+VLQNV KAQIK+++ K+NVAGV LP+FE   +G ++YEL GL+ GGQQ+ +LKKNY  A+ LLV LASLQTSFVTLD+VIK TNRRVNAIEHVIIP+I RT++YII ELDE EREEFYRL
Sbjct:    1 MAAKDRLPIFPSRGAQTLMKSRLAGATKGHGLLKKKADALQMRFRLILGKIIETKTLMGQVMKEAAFSLAEVKFT-TGDINQIVLQNVTKAQIKIRTKKDNVAGVTLPIFEPYTDGVDTYELAGLARGGQQLAKLKKNYQSAVRLLVQLASLQTSFVTLDDVIKVTNRRVNAIEHVIIPRINRTIEYIISELDELEREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. Ensembl Fly
Match: Vha36-3 (gene:FBgn0040377 transcript:FBtr0339401)

HSP 1 Score: 272.322 bits (695), Expect = 1.347e-90
Identity = 141/203 (69.46%), Postives = 167/203 (82.27%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            M+ KDR+ IFPSR AQT MK RL GA KGH LLKKK+DAL M+FR IL KII+ K  MG VMK++ FSLAEVKF  +G+INQ+VLQNV KAQIK+++ K+NVAGV LP+FE   +G ++YEL GL+ GGQQ+ +LKKNY  A+ LLV LASLQTSFVTLD+VIK TNRRVNAIEHVIIP+I RT++YII ELDE EREEFYRL
Sbjct:    1 MAAKDRLPIFPSRGAQTLMKSRLAGATKGHGLLKKKADALQMRFRLILGKIIETKTLMGQVMKEAAFSLAEVKFT-TGDINQIVLQNVTKAQIKIRTKKDNVAGVTLPIFEPYTDGVDTYELAGLARGGQQLAKLKKNYQSAVRLLVQLASLQTSFVTLDDVIKVTNRRVNAIEHVIIPRINRTIEYIISELDELEREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. Ensembl Fly
Match: Vha36-2 (gene:FBgn0033706 transcript:FBtr0088000)

HSP 1 Score: 129.028 bits (323), Expect = 7.305e-34
Identity = 77/203 (37.93%), Postives = 117/203 (57.64%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            M+ +D + IFPSR     MK R+  A++G  LLK+K DA+ MK R++ +   D        M+++ FS+A+     +    QMV ++   A + ++  +  + GV L   E+  +G  ++ L GLS GG Q+ R++ +Y KAL  LV  ASL+     L+     TN RVNA+EHV+IP ++ T  YI  EL+E ERE+FYRL
Sbjct:    1 MAKRDILPIFPSRANSVIMKQRVLAARRGVGLLKRKRDAIDMKLRELRRIRFDQDMHGDEAMRNAIFSMAKANLLGADFKPQMVSRS-HVATVSLRRTEIKIVGVKLNTLELETKGVGAFPLAGLSCGGMQVSRIRDSYTKALKALVEFASLEYQVRMLEAASLQTNMRVNALEHVVIPILQNTYNYICGELEEFEREDFYRL 202          
BLAST of V-type proton ATPase subunit D vs. Ensembl Zebrafish
Match: atp6v1d (ATPase H+ transporting V1 subunit D [Source:ZFIN;Acc:ZDB-GENE-040426-727])

HSP 1 Score: 294.278 bits (752), Expect = 4.101e-99
Identity = 151/203 (74.38%), Postives = 176/203 (86.70%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGK+RI+IFPSRMAQT MK RLKGAQ G SLLKKKSDAL+M+FRQIL+KII+ K  MG VM+++ FSLAE KFA +G+ +  V+QNV KAQ+KV++ K+NVAGV LPVFE   EGG+SYELTGL+ GG+Q+ RLK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIP+IERTL YII ELDEREREEFYRL
Sbjct:    1 MSGKERIDIFPSRMAQTIMKARLKGAQTGRSLLKKKSDALSMRFRQILRKIIETKTLMGEVMREAAFSLAEAKFA-AGDFSTTVIQNVNKAQVKVRAKKDNVAGVTLPVFEHYQEGGDSYELTGLARGGEQLSRLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLTYIITELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. Ensembl Xenopus
Match: gpbp1 (GC-rich promoter binding protein 1 [Source:Xenbase;Acc:XB-GENE-979389])

HSP 1 Score: 289.656 bits (740), Expect = 4.133e-97
Identity = 149/203 (73.40%), Postives = 174/203 (85.71%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGKDRI +FPSRMAQT MK RLKGAQ G +LLKKKSDALTM+FRQILKKII+ K  MG VM+++ FSLAE KF  +G+ +  V+QNV KAQ+KV++ ++NVAGV LPVFE   EGG+SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIPKIERTL YI+ ELDEREREEFYRL
Sbjct:    1 MSGKDRIEVFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTMRFRQILKKIIETKMLMGEVMREAAFSLAEAKFT-AGDFSTTVIQNVNKAQVKVRAKRDNVAGVTLPVFEHYQEGGDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPKIERTLSYIVTELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. Ensembl Xenopus
Match: gpbp1 (GC-rich promoter binding protein 1 [Source:Xenbase;Acc:XB-GENE-979389])

HSP 1 Score: 263.848 bits (673), Expect = 3.732e-87
Identity = 138/190 (72.63%), Postives = 162/190 (85.26%), Query Frame = 3
Query:  111 MAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MAQT MK RLKGAQ G +LLKKKSDALTM+FRQILKKII+ K  MG VM+++ FSLAE KF  +G+ +  V+QNV KAQ+KV++ ++NVAGV LPVFE   EGG+SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIPKIERTL YI+ ELDEREREEFYRL
Sbjct:    1 MAQTIMKARLKGAQTGRNLLKKKSDALTMRFRQILKKIIETKMLMGEVMREAAFSLAEAKFT-AGDFSTTVIQNVNKAQVKVRAKRDNVAGVTLPVFEHYQEGGDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPKIERTLSYIVTELDEREREEFYRL 189          
BLAST of V-type proton ATPase subunit D vs. Ensembl Xenopus
Match: gpbp1 (GC-rich promoter binding protein 1 [Source:Xenbase;Acc:XB-GENE-979389])

HSP 1 Score: 261.151 bits (666), Expect = 5.750e-86
Identity = 137/189 (72.49%), Postives = 161/189 (85.19%), Query Frame = 3
Query:  114 AQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            AQT MK RLKGAQ G +LLKKKSDALTM+FRQILKKII+ K  MG VM+++ FSLAE KF  +G+ +  V+QNV KAQ+KV++ ++NVAGV LPVFE   EGG+SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIPKIERTL YI+ ELDEREREEFYRL
Sbjct:   11 AQTIMKARLKGAQTGRNLLKKKSDALTMRFRQILKKIIETKMLMGEVMREAAFSLAEAKFT-AGDFSTTVIQNVNKAQVKVRAKRDNVAGVTLPVFEHYQEGGDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPKIERTLSYIVTELDEREREEFYRL 198          
BLAST of V-type proton ATPase subunit D vs. Ensembl Mouse
Match: Atp6v1d (ATPase, H+ transporting, lysosomal V1 subunit D [Source:MGI Symbol;Acc:MGI:1921084])

HSP 1 Score: 285.804 bits (730), Expect = 8.039e-96
Identity = 148/203 (72.91%), Postives = 174/203 (85.71%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGKDRI IFPSRMAQT MK RLKGAQ G +LLKKKSDALT++FRQILKKII+ K  MG VM+++ FSLAE KF  +G+ +  V+QNV KAQ+K+++ K+NVAGV LPVFE  +EG +SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIP+IERTL YII ELDEREREEFYRL
Sbjct:    1 MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFT-AGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. UniProt/SwissProt
Match: sp|Q5RCS8|VATD_PONAB (V-type proton ATPase subunit D OS=Pongo abelii OX=9601 GN=ATP6V1D PE=2 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 3.482e-95
Identity = 148/203 (72.91%), Postives = 174/203 (85.71%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGKDRI IFPSRMAQT MK RLKGAQ G +LLKKKSDALT++FRQILKKII+ K  MG VM+++ FSLAE KF  +G+ +  V+QNV KAQ+K+++ K+NVAGV LPVFE  +EG +SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIP+IERTL YII ELDEREREEFYRL
Sbjct:    1 MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFT-AGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. UniProt/SwissProt
Match: sp|Q9Y5K8|VATD_HUMAN (V-type proton ATPase subunit D OS=Homo sapiens OX=9606 GN=ATP6V1D PE=1 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 3.482e-95
Identity = 148/203 (72.91%), Postives = 174/203 (85.71%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGKDRI IFPSRMAQT MK RLKGAQ G +LLKKKSDALT++FRQILKKII+ K  MG VM+++ FSLAE KF  +G+ +  V+QNV KAQ+K+++ K+NVAGV LPVFE  +EG +SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIP+IERTL YII ELDEREREEFYRL
Sbjct:    1 MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFT-AGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. UniProt/SwissProt
Match: sp|P57746|VATD_MOUSE (V-type proton ATPase subunit D OS=Mus musculus OX=10090 GN=Atp6v1d PE=1 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 5.623e-95
Identity = 148/203 (72.91%), Postives = 174/203 (85.71%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGKDRI IFPSRMAQT MK RLKGAQ G +LLKKKSDALT++FRQILKKII+ K  MG VM+++ FSLAE KF  +G+ +  V+QNV KAQ+K+++ K+NVAGV LPVFE  +EG +SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIP+IERTL YII ELDEREREEFYRL
Sbjct:    1 MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFT-AGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. UniProt/SwissProt
Match: sp|O97755|VATD_RABIT (V-type proton ATPase subunit D OS=Oryctolagus cuniculus OX=9986 GN=ATP6V1D PE=2 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 1.419e-94
Identity = 147/203 (72.41%), Postives = 173/203 (85.22%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGKDRI IFPSRMAQT MK RLKGAQ G +LLKKKSDALT++FRQILKKII+ K  MG VM+++ FSLAE KF  +G+ +   +QNV KAQ+K+++ K+NVAGV LPVFE  +EG +SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIP+IERTL YII ELDEREREEFYRL
Sbjct:    1 MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFT-AGDFSTTAIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. UniProt/SwissProt
Match: sp|P39942|VATD_BOVIN (V-type proton ATPase subunit D OS=Bos taurus OX=9913 GN=ATP6V1D PE=1 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 3.318e-94
Identity = 147/203 (72.41%), Postives = 173/203 (85.22%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGKDRI IFPSRMAQT MK RLKGAQ G +LLKKKSDALT++FRQILKKII+ K  MG VM+++ FSLAE KF  +G+ +  V+QNV KAQ+K+++ K+NVAGV LPVFE  +EG +SYELTGL+ GG+Q+ +LK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVN IEHVIIP+IERTL YII ELDEREREEFYRL
Sbjct:    1 MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFT-AGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNRIEHVIIPRIERTLAYIITELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. TrEMBL
Match: A0A183QEC4 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 7.445e-100
Identity = 157/204 (76.96%), Postives = 180/204 (88.24%), Query Frame = 3
Query:   72 MSGK-DRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSG+ DR NIFPSRMAQT+MK RLKGAQKGH LLK+K+DALT++FR ILK+II  KQ MG VMK++ FSLA VKF  + NIN +VLQNV KAQ KVK+ KENVAGV LPVF+V+ EG ++YELTGL+GGGQQIDRLKKNY+KA+DLLV+LASLQTSF+TLD++IKATNRRVNAIE VIIPKIERTL YI QELDEREREEFYRL
Sbjct:    1 MSGQGDRFNIFPSRMAQTAMKGRLKGAQKGHRLLKRKADALTVRFRGILKQIIQAKQSMGEVMKEANFSLASVKFTTAANINSLVLQNVTKAQRKVKTDKENVAGVQLPVFKVVVEGSDTYELTGLAGGGQQIDRLKKNYSKAVDLLVDLASLQTSFITLDDIIKATNRRVNAIEFVIIPKIERTLNYITQELDEREREEFYRL 204          
BLAST of V-type proton ATPase subunit D vs. TrEMBL
Match: G4VGY6 (Putative atp synthase subunit d OS=Schistosoma mansoni OX=6183 GN=Smp_103200 PE=3 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.911e-99
Identity = 157/204 (76.96%), Postives = 180/204 (88.24%), Query Frame = 3
Query:   72 MSGK-DRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSG+ DR NIFPSRMAQT+MK RLKGAQKGH LLK+K+DALT++FR ILK+II  KQ MG VMK++ FSLA VKF  + NIN +VLQNV KAQ KVK+ KENVAGV LPVF+V+ EG ++YELTGL+GGGQQIDRLKKNY+KA+DLLV+LASLQTSF+TLD++IKATNRRVNAIE VIIPKIERTL YI QELDEREREEFYRL
Sbjct:    1 MSGQGDRFNIFPSRMAQTAMKGRLKGAQKGHRLLKRKADALTVRFRGILKQIIQAKQSMGEVMKEANFSLASVKFTTAANINSLVLQNVTKAQRKVKTDKENVAGVQLPVFKVVVEGSDTYELTGLAGGGQQIDRLKKNYSKAVDLLVDLASLQTSFITLDDIIKATNRRVNAIEFVIIPKIERTLNYITQELDEREREEFYRL 204          
BLAST of V-type proton ATPase subunit D vs. TrEMBL
Match: A0A1S3HPT6 (V-type proton ATPase subunit D OS=Lingula unguis OX=7574 GN=LOC106156711 PE=3 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 2.479e-99
Identity = 155/203 (76.35%), Postives = 176/203 (86.70%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGKDRIN+FPSRMA T MK RLKGAQKGHSLLKKK+DALT++FR ILK+II+ K  MG VMK++ FSLAE KFA +G+   MVLQNV KAQ+KV+S K+NVAGV LPVFE   +G ++YELTGLS GGQQID+LKKNYAKA++LLV LASLQTSFVTLDEVIK TNRRVNAIEHVIIP+IE+TL YI  ELDEREREEFYRL
Sbjct:    1 MSGKDRINVFPSRMAMTIMKARLKGAQKGHSLLKKKADALTLRFRLILKRIIETKTTMGEVMKEAAFSLAEAKFA-TGDFTHMVLQNVSKAQVKVRSKKDNVAGVSLPVFEQYQDGTDTYELTGLSRGGQQIDKLKKNYAKAVELLVELASLQTSFVTLDEVIKITNRRVNAIEHVIIPRIEKTLAYITTELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. TrEMBL
Match: A0A0X3PB22 (V-type proton ATPase subunit D OS=Schistocephalus solidus OX=70667 GN=VATD PE=4 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 2.822e-99
Identity = 152/203 (74.88%), Postives = 176/203 (86.70%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MS  D IN+FPSRMAQT+MK +L GAQKGHSLLKKKSDALT++FR IL KII+ K  MG VM+++ FSLA VKFA   NINQ+V+QNV KAQIKVK  K+NVAGV LP+F+   EG ++YELTGLSGGGQQID+LKK YA+A++LLVNLASLQTSFVTLD VIK TNRRVNAIEHVIIP++ERT+QYIIQELDEREREEF+RL
Sbjct:    1 MSSGDMINVFPSRMAQTNMKAQLLGAQKGHSLLKKKSDALTIRFRGILSKIIEAKMAMGDVMREANFSLAAVKFASIANINQLVIQNVAKAQIKVKLTKDNVAGVTLPIFQTYTEGSDAYELTGLSGGGQQIDKLKKAYARAVELLVNLASLQTSFVTLDGVIKITNRRVNAIEHVIIPRVERTIQYIIQELDEREREEFFRL 203          
BLAST of V-type proton ATPase subunit D vs. TrEMBL
Match: A0A183KH49 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS14348 PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 4.010e-99
Identity = 156/204 (76.47%), Postives = 180/204 (88.24%), Query Frame = 3
Query:   72 MSGK-DRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSG+ DR NIFPSRMAQT+MK RLKGAQKGH LLK+K+DALT++FR ILK+II  KQ MG VMK++ FSLA VKF  + NIN +VLQNV KAQ KVK+ KENVAGV LPVF+V+ EG ++YELTGL+GGGQQIDRLKKNY+KA+DLLV+LASLQTSF+TLD++IKATNRRVNAIE VIIPKIERTL YI QELDEREREEF+RL
Sbjct:    1 MSGQGDRFNIFPSRMAQTAMKGRLKGAQKGHRLLKRKADALTVRFRSILKQIIQAKQAMGEVMKEANFSLASVKFTTAANINSLVLQNVTKAQRKVKTDKENVAGVQLPVFKVVVEGSDTYELTGLAGGGQQIDRLKKNYSKAVDLLVDLASLQTSFITLDDIIKATNRRVNAIEFVIIPKIERTLNYITQELDEREREEFFRL 204          
BLAST of V-type proton ATPase subunit D vs. Ensembl Cavefish
Match: atp6v1d (ATPase H+ transporting V1 subunit D [Source:NCBI gene;Acc:103046603])

HSP 1 Score: 293.123 bits (749), Expect = 1.022e-98
Identity = 150/203 (73.89%), Postives = 176/203 (86.70%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGKDRI+IFPSRMAQT MK RLKGAQ G +LLKKK+DAL+M+FRQIL+KII+ K  MG VM+++ FSLAE KFA +G+ +  V+QNV KAQ+KV++ K+NVAGV LPVFE   EGG+SYELTGL+ GG+Q+ RLK+NYAKA++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIP+IERTL YII ELDEREREEFYRL
Sbjct:    1 MSGKDRIDIFPSRMAQTIMKARLKGAQTGRNLLKKKADALSMRFRQILRKIIETKTLMGEVMREAAFSLAEAKFA-AGDFSTTVIQNVNKAQVKVRAKKDNVAGVTLPVFEHYQEGGDSYELTGLARGGEQLSRLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLTYIITELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. Ensembl Sea Lamprey
Match: atp6v1d (ATPase H+ transporting V1 subunit D [Source:ZFIN;Acc:ZDB-GENE-040426-727])

HSP 1 Score: 288.886 bits (738), Expect = 8.131e-98
Identity = 149/203 (73.40%), Postives = 175/203 (86.21%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGKDRI++FPSRMAQT MK RLKGAQ G SLLKKK+DAL+M+FRQILKKIID K  MG VM+++ FSLAE KF  +G+ +  V+QNV +AQ+KVK+ K+NVAGV LPVFE  +EGG+SYELTGL+ GG+Q+ +LKKNY KA++LL+ LASLQTSFVTLDE IK TNRRVNAIEHVIIP+IERTL YII ELDEREREEFYRL
Sbjct:    1 MSGKDRIDVFPSRMAQTIMKARLKGAQTGRSLLKKKADALSMRFRQILKKIIDTKMLMGDVMREAAFSLAEAKFT-AGDFSTTVIQNVNRAQVKVKAKKDNVAGVTLPVFEHYSEGGDSYELTGLARGGEQLAKLKKNYGKAVELLIELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIISELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. Ensembl Yeast
Match: VMA8 (Subunit D of the V1 peripheral membrane domain of V-ATPase; part of the electrogenic proton pump found throughout the endomembrane system; plays a role in the coupling of proton transport and ATP hydrolysis; the V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase) has eight subunits [Source:SGD;Acc:S000000777])

HSP 1 Score: 208.764 bits (530), Expect = 1.940e-66
Identity = 116/204 (56.86%), Postives = 149/204 (73.04%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFE-VINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSG +R  +FP+RM    MK +LKGA +G+SLLK+KS+ALT +FR I K+I D KQ MG VM+ + FSLAEV +A   NI   V ++V  A+ KV++ +ENV+GV L  FE  I+   N + LTGL  GGQQ+ R K+ Y++A++ LV LASLQT+F+ LDEVIK TNRRVNAIEHVIIP+ E T+ YI  ELDE +REEFYRL
Sbjct:    1 MSG-NREQVFPTRMTLGLMKTKLKGANQGYSLLKRKSEALTKRFRDITKRIDDAKQKMGRVMQTAAFSLAEVSYATGENIGYQVQESVSTARFKVRARQENVSGVYLSQFESYIDPEINDFRLTGLGRGGQQVQRAKEIYSRAVETLVELASLQTAFIILDEVIKVTNRRVNAIEHVIIPRTENTIAYINSELDELDREEFYRL 203          
BLAST of V-type proton ATPase subunit D vs. Ensembl Nematostella
Match: EDO41280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z2])

HSP 1 Score: 274.633 bits (701), Expect = 2.413e-92
Identity = 141/200 (70.50%), Postives = 169/200 (84.50%), Query Frame = 3
Query:   81 KDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            KDRIN+FPSRMA T+MK RLKGAQKGHSLLKKK+DALT++FR+ILK IID K  MG +MK++TFSLAE  FA +G+ +  VL+NV KAQ K+K  K+NVAGV+LP+FE +++G NSYELTGLS GGQQ+ + ++ Y KA+ LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIP+IE T+ YI+ ELDEREREEFYRL
Sbjct:    3 KDRINVFPSRMALTTMKARLKGAQKGHSLLKKKADALTLRFRKILKNIIDTKHLMGEIMKEATFSLAEATFA-AGDFSTTVLENVDKAQTKIKMRKDNVAGVLLPIFEPVSDGTNSYELTGLSRGGQQLSKCQEVYGKAVKLLVELASLQTSFVTLDEAIKLTNRRVNAIEHVIIPRIENTVSYILGELDEREREEFYRL 201          
BLAST of V-type proton ATPase subunit D vs. Ensembl Medaka
Match: atp6v1d (ATPase H+ transporting V1 subunit D [Source:NCBI gene;Acc:101165436])

HSP 1 Score: 289.656 bits (740), Expect = 2.527e-97
Identity = 147/203 (72.41%), Postives = 176/203 (86.70%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRL 680
            MSGK+RI++FPSRMAQT MK RLKGAQ G +LLKKKSDAL+M+FRQIL+KII+ K  MG VM+++ FSLAE KFA +G+ +  V+QNV KAQ+KV++ K+NVAGV LPVFE   EGG+SYELTGL+ GG+Q+ RLK+NYA+A++LLV LASLQTSFVTLDE IK TNRRVNAIEHVIIP+I+RTL YII ELDEREREEFYRL
Sbjct:    1 MSGKERIDVFPSRMAQTIMKARLKGAQTGRNLLKKKSDALSMRFRQILRKIIETKTKMGEVMREAAFSLAEAKFA-AGDFSTTVIQNVNKAQVKVRAKKDNVAGVTLPVFEHYQEGGDSYELTGLARGGEQLSRLKRNYARAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIDRTLTYIITELDEREREEFYRL 202          
BLAST of V-type proton ATPase subunit D vs. Planmine SMEST
Match: SMESG000071275.1 (SMESG000071275.1)

HSP 1 Score: 420.239 bits (1079), Expect = 6.461e-149
Identity = 252/252 (100.00%), Postives = 252/252 (100.00%), Query Frame = 3
Query:   72 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRXXXXXXXXXXXXMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRLXXXXXXXXXXXXXXXXXXXXXXXXXVDVAESGARTIKELAEDEDEMLFN 827
            MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRQILKKIIDIKQDMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRLKKIQEKKKKIKEAAAAERLAAGIDAVDVAESGARTIKELAEDEDEMLFN
Sbjct:    1 MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRQILKKIIDIKQDMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKENVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLASLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEFYRLKKIQEKKKKIKEAAAAERLAAGIDAVDVAESGARTIKELAEDEDEMLFN 252          
The following BLAST results are available for this feature:
BLAST of V-type proton ATPase subunit D vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP6V1D7.251e-9672.91ATPase H+ transporting V1 subunit D [Source:HGNC S... [more]
ATP6V1D7.251e-9672.91ATPase H+ transporting V1 subunit D [Source:HGNC S... [more]
ATP6V1D4.426e-6970.55ATPase H+ transporting V1 subunit D [Source:HGNC S... [more]
ATP6V1D6.618e-6266.25ATPase H+ transporting V1 subunit D [Source:HGNC S... [more]
ATP6V1D2.534e-5376.85ATPase H+ transporting V1 subunit D [Source:HGNC S... [more]
back to top
BLAST of V-type proton ATPase subunit D vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
vha-141.090e-8565.67V-type proton ATPase subunit D [Source:UniProtKB/... [more]
vha-141.090e-8565.67V-type proton ATPase subunit D [Source:UniProtKB/... [more]
vha-141.090e-8565.67V-type proton ATPase subunit D [Source:UniProtKB/... [more]
back to top
BLAST of V-type proton ATPase subunit D vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Vha36-12.310e-9371.92gene:FBgn0022097 transcript:FBtr0087335[more]
Vha36-31.347e-9069.46gene:FBgn0040377 transcript:FBtr0345706[more]
Vha36-31.347e-9069.46gene:FBgn0040377 transcript:FBtr0339401[more]
Vha36-27.305e-3437.93gene:FBgn0033706 transcript:FBtr0088000[more]
back to top
BLAST of V-type proton ATPase subunit D vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp6v1d4.101e-9974.38ATPase H+ transporting V1 subunit D [Source:ZFIN;A... [more]
back to top
BLAST of V-type proton ATPase subunit D vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gpbp14.133e-9773.40GC-rich promoter binding protein 1 [Source:Xenbase... [more]
gpbp13.732e-8772.63GC-rich promoter binding protein 1 [Source:Xenbase... [more]
gpbp15.750e-8672.49GC-rich promoter binding protein 1 [Source:Xenbase... [more]
back to top
BLAST of V-type proton ATPase subunit D vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Atp6v1d8.039e-9672.91ATPase, H+ transporting, lysosomal V1 subunit D [S... [more]
back to top
BLAST of V-type proton ATPase subunit D vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RCS8|VATD_PONAB3.482e-9572.91V-type proton ATPase subunit D OS=Pongo abelii OX=... [more]
sp|Q9Y5K8|VATD_HUMAN3.482e-9572.91V-type proton ATPase subunit D OS=Homo sapiens OX=... [more]
sp|P57746|VATD_MOUSE5.623e-9572.91V-type proton ATPase subunit D OS=Mus musculus OX=... [more]
sp|O97755|VATD_RABIT1.419e-9472.41V-type proton ATPase subunit D OS=Oryctolagus cuni... [more]
sp|P39942|VATD_BOVIN3.318e-9472.41V-type proton ATPase subunit D OS=Bos taurus OX=99... [more]
back to top
BLAST of V-type proton ATPase subunit D vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183QEC47.445e-10076.96Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
G4VGY61.911e-9976.96Putative atp synthase subunit d OS=Schistosoma man... [more]
A0A1S3HPT62.479e-9976.35V-type proton ATPase subunit D OS=Lingula unguis O... [more]
A0A0X3PB222.822e-9974.88V-type proton ATPase subunit D OS=Schistocephalus ... [more]
A0A183KH494.010e-9976.47Uncharacterized protein OS=Schistosoma curassoni O... [more]
back to top
BLAST of V-type proton ATPase subunit D vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp6v1d1.022e-9873.89ATPase H+ transporting V1 subunit D [Source:NCBI g... [more]
back to top
BLAST of V-type proton ATPase subunit D vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp6v1d8.131e-9873.40ATPase H+ transporting V1 subunit D [Source:ZFIN;A... [more]
back to top
BLAST of V-type proton ATPase subunit D vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VMA81.940e-6656.86Subunit D of the V1 peripheral membrane domain of ... [more]
back to top
BLAST of V-type proton ATPase subunit D vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO412802.413e-9270.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of V-type proton ATPase subunit D vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp6v1d2.527e-9772.41ATPase H+ transporting V1 subunit D [Source:NCBI g... [more]
back to top
BLAST of V-type proton ATPase subunit D vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000071275.16.461e-149100.00SMESG000071275.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012306 ID=SMED30012306|Name=V-type proton ATPase subunit D|organism=Schmidtea mediterranea sexual|type=transcript|length=1059bp
ATAATAACTAAACATTTTAAATTTTTTGGAAGTTGTTTTTGTAACTAAAG
CGATACAATAATTCATTTACAATGTCGGGAAAAGATAGAATAAATATATT
TCCATCCAGAATGGCTCAAACATCCATGAAACTGCGTTTGAAAGGGGCCC
AAAAAGGTCATAGTTTATTAAAAAAGAAATCTGATGCCCTGACAATGAAG
TTTAGACAGATATTGAAAAAAATAATTGATATTAAACAAGATATGGGAAG
TGTTATGAAAGATTCTACATTTTCATTGGCCGAAGTAAAATTTGCGCATA
GTGGTAATATTAATCAAATGGTGTTGCAAAATGTTGGTAAAGCTCAAATT
AAAGTAAAATCTGCCAAAGAAAATGTAGCTGGTGTTGTCTTACCCGTATT
TGAAGTCATCAATGAAGGTGGAAACAGTTACGAATTGACTGGTCTCTCTG
GCGGTGGCCAACAAATCGATCGATTAAAAAAGAATTATGCTAAAGCTTTA
GATCTGTTAGTAAATTTAGCATCACTGCAAACCTCGTTTGTGACTTTGGA
TGAAGTCATTAAAGCGACAAATCGGCGAGTTAACGCCATTGAGCACGTCA
TTATACCAAAAATTGAGAGAACTCTACAATATATTATCCAGGAACTCGAT
GAACGAGAACGAGAGGAGTTTTATCGATTGAAAAAGATCCAAGAAAAGAA
AAAGAAAATAAAAGAAGCCGCCGCAGCAGAAAGATTGGCAGCTGGCATCG
ATGCTGTCGATGTTGCGGAATCTGGAGCCAGAACGATTAAGGAACTAGCT
GAGGATGAGGATGAAATGTTATTCAATTAATTGCACTGAATGCAGTCGAA
TAAGATCCAGCATAATATTATTGTTATTACTCGAGATGCCGATGTTGAAT
TTTCAATTAGTAAATATTTATGTCTTTGATAGTTAATATTCTATAAATTT
GATAAATAATTGAGAGTTCATTAATTATTGATCCAGTAAAGCAAATGCTA
ATTTATGGGAAATTTGGATTGTTTTTTATAAATATATTTATTTTTGGGTT
CGAAAAAAA
back to top

protein sequence of SMED30012306-orf-1

>SMED30012306-orf-1 ID=SMED30012306-orf-1|Name=SMED30012306-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=253bp
MSGKDRINIFPSRMAQTSMKLRLKGAQKGHSLLKKKSDALTMKFRQILKK
IIDIKQDMGSVMKDSTFSLAEVKFAHSGNINQMVLQNVGKAQIKVKSAKE
NVAGVVLPVFEVINEGGNSYELTGLSGGGQQIDRLKKNYAKALDLLVNLA
SLQTSFVTLDEVIKATNRRVNAIEHVIIPKIERTLQYIIQELDEREREEF
YRLKKIQEKKKKIKEAAAAERLAAGIDAVDVAESGARTIKELAEDEDEML
FN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR002699V_ATPase_D
Vocabulary: molecular function
TermDefinition
GO:0042626ATPase activity, coupled to transmembrane movement of substances
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 203..223
NoneNo IPR availablePANTHERPTHR11671:SF1V-TYPE PROTON ATPASE SUBUNIT Dcoord: 1..220
IPR002699ATPase, V1 complex, subunit DTIGRFAMTIGR00309TIGR00309coord: 8..212
e-value: 1.2E-61
score: 205.9
IPR002699ATPase, V1 complex, subunit DPFAMPF01813ATP-synt_Dcoord: 17..208
e-value: 1.3E-73
score: 247.0
IPR002699ATPase, V1 complex, subunit DPANTHERPTHR11671V-TYPE ATP SYNTHASE SUBUNIT Dcoord: 1..220