nuclear receptor TLX-1

Overview
Namenuclear receptor TLX-1 (AEZ56119.1)
Smed IDSMED30012299
Length (bp)1518
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nuclear receptor TLX-1 (SMED30012299) t-SNE clustered cells

Violin plots show distribution of expression levels for nuclear receptor TLX-1 (SMED30012299) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nuclear receptor TLX-1 (SMED30012299) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nuclear receptor TLX-1 (SMED30012299) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012299

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012299SMESG000027543.1 SmedASXL_013264SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30012299SMESG000027543.1 dd_Smed_v4_21347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30012299SMESG000027543.1 dd_Smed_v6_21347_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30012299SMESG000027543.1 OX_Smed_1.0.12486ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30012299SMESG000027543.1 dd_Smed_v4_21347_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nuclear receptor TLX-1 vs. Ensembl Human
Match: NR2E1 (nuclear receptor subfamily 2 group E member 1 [Source:HGNC Symbol;Acc:HGNC:7973])

HSP 1 Score: 213.386 bits (542), Expect = 1.213e-63
Identity = 138/398 (34.67%), Postives = 207/398 (52.01%), Query Frame = 1
Query:  325 MSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFN----ELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL---------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            MS    S+  +LD+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ +  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF     E       PS+ LP    F     ++   LE + +S                     ++ + +   +  GTP   +Y +      E +AR LF ++ W KS      L L  ++  +LLE  W +LF+L   +  +P +  +L+        +  + K   +I++   L + +++   L L ++E   LK I+           +L+S  N     A+QD     ++       PT   +      LL  +  I P+ I ++FF+KTIG +P+  L+SDM
Sbjct:    1 MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGG------CPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSL----------AQPTPKYPHEVNGTPM-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQL--MLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIGNVPITRLLSDM 379          
BLAST of nuclear receptor TLX-1 vs. Ensembl Human
Match: NR2E1 (nuclear receptor subfamily 2 group E member 1 [Source:HGNC Symbol;Acc:HGNC:7973])

HSP 1 Score: 208.764 bits (530), Expect = 1.909e-61
Identity = 135/388 (34.79%), Postives = 203/388 (52.32%), Query Frame = 1
Query:  355 LLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFN----ELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL---------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            +LD+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ +  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF     E       PS+ LP    F     ++   LE + +S                     ++ + +   +  GTP   +Y +      E +AR LF ++ W KS      L L  ++  +LLE  W +LF+L   +  +P +  +L+        +  + K   +I++   L + +++   L L ++E   LK I+           +L+S  N     A+QD     ++       PT   +      LL  +  I P+ I ++FF+KTIG +P+  L+SDM
Sbjct:   48 ILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGG------CPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSL----------AQPTPKYPHEVNGTPM-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQL--MLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIGNVPITRLLSDM 416          
BLAST of nuclear receptor TLX-1 vs. Ensembl Human
Match: NR2E3 (nuclear receptor subfamily 2 group E member 3 [Source:HGNC Symbol;Acc:HGNC:7974])

HSP 1 Score: 151.754 bits (382), Expect = 2.303e-40
Identity = 121/383 (31.59%), Postives = 181/383 (47.26%), Query Frame = 1
Query:  370 CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHN-----ILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESY------FSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLIN-QCAVLHQHLSK---LSLGSSEINILKQIIFL--DLKSLNKKLEV-AVQDACMDHVSRLCQLFDPTNKIAI--EACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            C+VC D SSGKHYGIYAC+GC+GFFKRS+R   +Y C+  +       G+C +DK HRNQC+ACRL+KC+ +GMN++AVQ+ER PRS+      +M  N  S          P+   P   +  +A          SLI+A                     E++ E  D     P+        S         E SAR LF  V W K+L     LP     +LLE  WS+LFLL A +  +P +   L+    +  ++     +L L + +  VL + +S+   L++  +E   +K ++    + + L     V A+QD     +S+  +   P+  +       LL ++  I    I  LFF+KTIG  P+  L+ DM 
Sbjct:   47 CRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGA-------GMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKL-------------EPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPP-EASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMF 408          
BLAST of nuclear receptor TLX-1 vs. Ensembl Human
Match: NR2E3 (nuclear receptor subfamily 2 group E member 3 [Source:HGNC Symbol;Acc:HGNC:7974])

HSP 1 Score: 138.272 bits (347), Expect = 8.173e-36
Identity = 99/304 (32.57%), Postives = 146/304 (48.03%), Query Frame = 1
Query:  370 CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHN-----ILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESY------FSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLIN-QCAVLHQHLSK---LSLGSSEINILKQIIFL 1224
            C+VC D SSGKHYGIYAC+GC+GFFKRS+R   +Y C+  +       G+C +DK HRNQC+ACRL+KC+ +GMN++AVQ+ER PRS+      +M  N  S          P+   P   +  +A          SLI+A                     E++ E  D     P+        S         E SAR LF  V W K+L     LP     +LLE  WS+LFLL A +  +P +   L+    +  ++     +L L + +  VL + +S+   L++  +E   +K ++  
Sbjct:   47 CRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGA-------GMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKL-------------EPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPP-EASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLF 329          
BLAST of nuclear receptor TLX-1 vs. Ensembl Human
Match: NR2F1 (nuclear receptor subfamily 2 group F member 1 [Source:HGNC Symbol;Acc:HGNC:7975])

HSP 1 Score: 110.153 bits (274), Expect = 8.030e-26
Identity = 98/405 (24.20%), Postives = 168/405 (41.48%), Query Frame = 1
Query:  304 DSHDTSFMSNTGN---SSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICK-NKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSKLS---LGSSEINILKQIIFLD-----------LKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            D  D     N G    +++    + C VC D SSGKHYG + C+GC  FFKRS+R +  Y C+ N++         C ID+ HRNQC+ CRL+KC+  GM           R +  R +            + P+   P   +  N + +         IS          + +    +  N+   IE                      EL+AR LF+ V W ++      LQ+  ++   LL   WS+LF+L A +  +P +   L+       S +S  + +  ++   +  + + KL    + S+E + LK I+              ++SL +K + A+++            F    K+ +    L ++  +  + I +LFF + +G+ P+  LI DM+
Sbjct:   10 DPQDDVAGGNPGGPNPAAQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRN---------CPIDQHHRNQCQYCRLKKCLKVGMR----------REAVQRGR------------MPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENI-------------------CELAARLLFSAVEWARNIPFFPDLQITDQVS--LLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRF---GKLLLR---LPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDML 356          
BLAST of nuclear receptor TLX-1 vs. Ensembl Celegans
Match: nhr-67 (Nuclear hormone receptor family member nhr-67 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVV3])

HSP 1 Score: 170.629 bits (431), Expect = 1.108e-47
Identity = 74/106 (69.81%), Postives = 90/106 (84.91%), Query Frame = 1
Query:  343 SSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMY 660
            SSRILLDV C+VC+DHSSGKHY I++CDGCAGFFKRSIR  R Y+CKN   KG    G CK+DKTHRNQCRACRL+KC++ GMNK+AVQHERGPR+S++R++  M+
Sbjct:   12 SSRILLDVDCRVCEDHSSGKHYSIFSCDGCAGFFKRSIRRHRQYVCKN---KGSPSEGQCKVDKTHRNQCRACRLRKCLEIGMNKDAVQHERGPRNSSLRRQQMMF 114          
BLAST of nuclear receptor TLX-1 vs. Ensembl Celegans
Match: fax-1 (Nuclear hormone receptor FAX-1 [Source:UniProtKB/TrEMBL;Acc:G5EDJ0])

HSP 1 Score: 123.25 bits (308), Expect = 1.247e-30
Identity = 72/173 (41.62%), Postives = 101/173 (58.38%), Query Frame = 1
Query:  271 NSSLDLSEDHWDSHDTSF--MSNTGNSSRILLDVP---CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPR-SSTVRKKVAM----YFNELS---HNILDPSSMLPFTKSFNNANNVKEE 750
            N+S+    DH      SF  M +    S      P   C VC D SSGKHYGI AC+GC+GFFKRS+R   +Y C+       +  G C +DK HRNQC+ACRL+KC++ GMNK+AVQ+ER PR ++T+R  + M    +F E +     I+  S+M+    S ++A++ K E
Sbjct:   64 NASVSPPLDHTTISVNSFPSMGSVKTDSPPTASSPTLCCAVCGDVSSGKHYGILACNGCSGFFKRSVRRRLIYRCQ-------AGTGNCVVDKAHRNQCQACRLKKCLNKGMNKDAVQNERQPRNTATIRPALDMDPQNFFREYAGAVSAIMGHSNMMKREDSPSSASDGKTE 229          
BLAST of nuclear receptor TLX-1 vs. Ensembl Celegans
Match: fax-1 (Nuclear hormone receptor FAX-1 [Source:UniProtKB/TrEMBL;Acc:G5EDJ0])

HSP 1 Score: 121.709 bits (304), Expect = 6.220e-30
Identity = 63/135 (46.67%), Postives = 89/135 (65.93%), Query Frame = 1
Query:  370 CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPR-SSTVRKKVAM----YFNELS---HNILDPSSMLPFTKSFNNANNVKEE 750
            C VC D SSGKHYGI AC+GC+GFFKRS+R   +Y C+       +  G C +DK HRNQC+ACRL+KC++ GMNK+AVQ+ER PR ++T+R  + M    +F E +     I+  S+M+    S ++A++ K E
Sbjct:  102 CAVCGDVSSGKHYGILACNGCSGFFKRSVRRRLIYRCQ-------AGTGNCVVDKAHRNQCQACRLKKCLNKGMNKDAVQNERQPRNTATIRPALDMDPQNFFREYAGAVSAIMGHSNMMKREDSPSSASDGKTE 229          
BLAST of nuclear receptor TLX-1 vs. Ensembl Celegans
Match: nhr-236 (Nuclear Hormone Receptor family [Source:UniProtKB/TrEMBL;Acc:Q9N418])

HSP 1 Score: 104.76 bits (260), Expect = 5.563e-25
Identity = 47/83 (56.63%), Postives = 56/83 (67.47%), Query Frame = 1
Query:  370 CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHER 618
            C+VC D +SG+HYG+ +CDGC GFFKRSIR +  Y CK          G C ID T RNQC+ACR QKC+   MN+ AVQHER
Sbjct:   13 CRVCGDRASGRHYGVLSCDGCRGFFKRSIRRNLRYSCKES--------GDCVIDVTRRNQCQACRFQKCITVAMNRHAVQHER 87          
BLAST of nuclear receptor TLX-1 vs. Ensembl Celegans
Match: nhr-62 (Nuclear hormone receptor family member nhr-62 [Source:UniProtKB/Swiss-Prot;Acc:O02279])

HSP 1 Score: 104.375 bits (259), Expect = 1.116e-23
Identity = 48/107 (44.86%), Postives = 65/107 (60.75%), Query Frame = 1
Query:  307 SHDTSFMSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPR 627
            +H T+     G      +++ C VC D + GKHYG+ AC+GC GFF+RS+ H+R Y+C+        + G C I K HRN CRACRL++C  +GMN  AVQ ER  R
Sbjct:   77 AHHTTTGHGRGRRKNSTINLVCVVCGDQAFGKHYGVNACNGCKGFFRRSVWHNRQYLCR--------FEGRCAIAKEHRNVCRACRLKQCFVAGMNPRAVQSERVER 175          
BLAST of nuclear receptor TLX-1 vs. Ensembl Fly
Match: tll (gene:FBgn0003720 transcript:FBtr0085709)

HSP 1 Score: 189.889 bits (481), Expect = 2.326e-54
Identity = 110/291 (37.80%), Postives = 149/291 (51.20%), Query Frame = 1
Query:  289 SEDHWDSHDTSFMSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMY---------FNELSHNILD--------PSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSEN---SIETFDDCIGTP--KSTIYFLQESYFSELSARSLFNTVHWIKSL----QLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMY 1083
            S D  D    S   +   SSRIL  VPCKVC+DHSSGKHYGIYACDGCAGFFKRSIR SR Y+CK++        G+C +DKTHRNQCRACRL+KC + GMNK+AVQHERGPR+ST+R+ +AMY           ++   IL         P   +P       A +    +  F    +A      +        +             + + + T     T   +   +  E +A  LF  V+WIKS+    +LP     +LLE +W + F+L   +  +P N   L++
Sbjct:    7 SPDMMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKRSIRRSRQYVCKSQK------QGLCVVDKTHRNQCRACRLRKCFEVGMNKDAVQHERGPRNSTLRRHMAMYKDAMMGAGEMPQIPAEILMNTAALTGFPGVPMPMPGLPQRAGHHPAHMAAFQPPPSAAAVLDLSVPRVPHHPVHQGHHGFFSPTAAYMNALATRALPPTPPLMAAEHIKETAAEHLFKNVNWIKSVRAFTELPMPDQLLLLEESWKEFFILAMAQYLMPMNFAQLLF 291          
BLAST of nuclear receptor TLX-1 vs. Ensembl Fly
Match: dsf (gene:FBgn0015381 transcript:FBtr0333245)

HSP 1 Score: 147.902 bits (372), Expect = 8.232e-38
Identity = 66/105 (62.86%), Postives = 77/105 (73.33%), Query Frame = 1
Query:  337 GNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKV 651
            G +   LLD+PCKVC D SSGKHYGIY+CDGC+GFFKRSI  +R+Y CK     GD   G C +DKTHRNQCRACRL KC  S MNK+AVQHERGPR   +  ++
Sbjct:    2 GTAGDRLLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCK---ATGD-LKGRCPVDKTHRNQCRACRLAKCFQSAMNKDAVQHERGPRKPKLHPQL 102          
BLAST of nuclear receptor TLX-1 vs. Ensembl Fly
Match: dsf (gene:FBgn0015381 transcript:FBtr0079145)

HSP 1 Score: 147.902 bits (372), Expect = 8.232e-38
Identity = 66/105 (62.86%), Postives = 77/105 (73.33%), Query Frame = 1
Query:  337 GNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKV 651
            G +   LLD+PCKVC D SSGKHYGIY+CDGC+GFFKRSI  +R+Y CK     GD   G C +DKTHRNQCRACRL KC  S MNK+AVQHERGPR   +  ++
Sbjct:    2 GTAGDRLLDIPCKVCGDRSSGKHYGIYSCDGCSGFFKRSIHRNRIYTCK---ATGD-LKGRCPVDKTHRNQCRACRLAKCFQSAMNKDAVQHERGPRKPKLHPQL 102          
BLAST of nuclear receptor TLX-1 vs. Ensembl Fly
Match: svp (gene:FBgn0003651 transcript:FBtr0082564)

HSP 1 Score: 125.176 bits (313), Expect = 2.137e-30
Identity = 99/380 (26.05%), Postives = 163/380 (42.89%), Query Frame = 1
Query:  361 DVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQLPKEI----VSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSKLS---LGSSEINILKQIIFLD-----------LKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            ++ C VC D SSGKHYG + C+GC  FFKRS+R +  Y C+            C ID+ HRNQC+ CRL+KC+  GM +EAVQ  R P     +  +A    +      DP  +  F     N ++     +   L         +     S    C    N +   + C                 EL+AR LF+ V W K++    E+       LL   WS+LF+L A +  +P +   L+       S ++  + +  ++   +  + + KL    + S+E + LK I+              ++SL +K + A+++ C          F    K+ +    L ++  +    I +LFF + +G+ P+  LI DM+
Sbjct:  197 NIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRGSR--------NCPIDQHHRNQCQYCRLKKCLKMGMRREAVQRGRVP---PTQPGLAGMHGQYQIANGDPMGIAGF-----NGHSYLSSYISLLL--------RAEPYPTSRYGQCMQPNNIMGIDNIC-----------------ELAARLLFSAVEWAKNIPFFPELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVTHIESLQEKSQCALEEYCRTQYPNQPTRF---GKLLLR---LPSLRTVSSQVIEQLFFVRLVGKTPIETLIRDML 529          
BLAST of nuclear receptor TLX-1 vs. Ensembl Fly
Match: svp (gene:FBgn0003651 transcript:FBtr0331183)

HSP 1 Score: 125.176 bits (313), Expect = 2.174e-30
Identity = 99/380 (26.05%), Postives = 163/380 (42.89%), Query Frame = 1
Query:  361 DVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQLPKEI----VSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSKLS---LGSSEINILKQIIFLD-----------LKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            ++ C VC D SSGKHYG + C+GC  FFKRS+R +  Y C+            C ID+ HRNQC+ CRL+KC+  GM +EAVQ  R P     +  +A    +      DP  +  F     N ++     +   L         +     S    C    N +   + C                 EL+AR LF+ V W K++    E+       LL   WS+LF+L A +  +P +   L+       S ++  + +  ++   +  + + KL    + S+E + LK I+              ++SL +K + A+++ C          F    K+ +    L ++  +    I +LFF + +G+ P+  LI DM+
Sbjct:  197 NIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRGSR--------NCPIDQHHRNQCQYCRLKKCLKMGMRREAVQRGRVP---PTQPGLAGMHGQYQIANGDPMGIAGF-----NGHSYLSSYISLLL--------RAEPYPTSRYGQCMQPNNIMGIDNIC-----------------ELAARLLFSAVEWAKNIPFFPELQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTDACGLSDVTHIESLQEKSQCALEEYCRTQYPNQPTRF---GKLLLR---LPSLRTVSSQVIEQLFFVRLVGKTPIETLIRDML 529          
BLAST of nuclear receptor TLX-1 vs. Ensembl Zebrafish
Match: nr2e1 (nuclear receptor subfamily 2, group E, member 1 [Source:ZFIN;Acc:ZDB-GENE-040801-127])

HSP 1 Score: 213.772 bits (543), Expect = 6.571e-64
Identity = 136/394 (34.52%), Postives = 210/394 (53.30%), Query Frame = 1
Query:  343 SSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILD------PSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL---------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            SSRIL D+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ +  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF    H  ++      PS+ +P    F     ++   LE + +++                    ++ + +   +  GTP   +Y +      E +AR LF ++ W KS      L LP ++  +LLE  W +LF+L   +  +P +  +L+        +  + +   +I++   L + +++   L L ++E   LK I+           +L+S  N     A+QD     ++       PT   +      LL  +  + P+ I ++FF+KTIG +P+  L+SDM
Sbjct:   19 SSRIL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGTQGG------CPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFR--GHKEVNGSSTHFPSTSIPGPPFFTTVTQLEPHNLELNTVTSTPERQAIVGL----------AQPTPKYPHEVSGTPM-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLPLPDQL--ILLEDAWRELFVLGIAQWAIPVDSSTLLAVSGMNTENTDSQRLNKIISEIQALQEVVTRFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNASAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSVGPSTIEEVFFKKTIGNVPITRLLSDM 390          
BLAST of nuclear receptor TLX-1 vs. Ensembl Zebrafish
Match: nr2e3 (nuclear receptor subfamily 2, group E, member 3 [Source:ZFIN;Acc:ZDB-GENE-041114-63])

HSP 1 Score: 143.665 bits (361), Expect = 1.833e-37
Identity = 115/390 (29.49%), Postives = 183/390 (46.92%), Query Frame = 1
Query:  370 CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKS---------FNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCD--NSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNT--------VHWIKSL----QLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL--DLKSLNKKLEVA-VQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            CKVC D SSGKHYGIYAC+GC+GFFKRS+R   +Y C+       +  G+C +DK HRNQC+ACRL+KC+ +GMNK+AVQ+ER PRS+   +  A+  ++   ++   +++ P + S           ++ +      + S  S +  N      S   +  C     E+  E  D     P+ +      + +      S++ T        V W K+L     LP     +LLE  WS+LFLL A +  +P ++  L+      +S     K     +   VL +  S+   L +  +E   LK I+    + + L    +V  +QD     +++      P+   +      LL ++  +    I  LFFQ+TIG  P+  L+ DM 
Sbjct:   46 CKVCSDTSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQ-------AGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQPRSTAQVRLDALDVDKDKEHLA--TTLEPTSSSTCSVISRPLLGSSISSSISSTDGSQHSNSPKNGHRFMASLMTAETCAKLEPEDVDENIDVTSNEPERSSPMYGSALYPSREPESVYETSARLLFMSVKWAKNLPVFSHLPFRDQVILLEEAWSELFLLCAIQWSLPLDNCPLLS--LPDLSPTGQGKGSPSASDVRVLQEVFSRFKPLQVDPTEFACLKAIVLFKPETRGLKDPEQVENLQDQSQVLLAQHIHTLYPSQVARFGRLLLLLPSLHFVSSERIEHLFFQRTIGNTPMEKLLCDMF 424          
BLAST of nuclear receptor TLX-1 vs. Ensembl Zebrafish
Match: nr2e3 (nuclear receptor subfamily 2, group E, member 3 [Source:ZFIN;Acc:ZDB-GENE-041114-63])

HSP 1 Score: 143.28 bits (360), Expect = 1.981e-37
Identity = 115/390 (29.49%), Postives = 183/390 (46.92%), Query Frame = 1
Query:  370 CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKS---------FNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCD--NSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNT--------VHWIKSL----QLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL--DLKSLNKKLEVA-VQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            CKVC D SSGKHYGIYAC+GC+GFFKRS+R   +Y C+       +  G+C +DK HRNQC+ACRL+KC+ +GMNK+AVQ+ER PRS+   +  A+  ++   ++   +++ P + S           ++ +      + S  S +  N      S   +  C     E+  E  D     P+ +      + +      S++ T        V W K+L     LP     +LLE  WS+LFLL A +  +P ++  L+      +S     K     +   VL +  S+   L +  +E   LK I+    + + L    +V  +QD     +++      P+   +      LL ++  +    I  LFFQ+TIG  P+  L+ DM 
Sbjct:   39 CKVCSDTSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQ-------AGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQPRSTAQVRLDALDVDKDKEHLA--TTLEPTSSSTCSVISRPLLGSSISSSISSTDGSQHSNSPKNGHRFMASLMTAETCAKLEPEDVDENIDVTSNEPERSSPMYGSALYPSREPESVYETSARLLFMSVKWAKNLPVFSHLPFRDQVILLEEAWSELFLLCAIQWSLPLDNCPLLS--LPDLSPTGQGKGSPSASDVRVLQEVFSRFKPLQVDPTEFACLKAIVLFKPETRGLKDPEQVENLQDQSQVLLAQHIHTLYPSQVARFGRLLLLLPSLHFVSSERIEHLFFQRTIGNTPMEKLLCDMF 417          
BLAST of nuclear receptor TLX-1 vs. Ensembl Zebrafish
Match: nr2f6b (nuclear receptor subfamily 2, group F, member 6b [Source:ZFIN;Acc:ZDB-GENE-040426-2351])

HSP 1 Score: 134.42 bits (337), Expect = 2.524e-34
Identity = 105/378 (27.78%), Postives = 162/378 (42.86%), Query Frame = 1
Query:  364 VPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQH---LSKLSLGSSEINILKQIIFLD-----------LKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            V C VC D SSGKHYG++ C+GC  FFKRSIR +  Y C++           C+ID+ HRNQC+ CRL+KC   GM KEAVQ  R P                SH  + P+SM+           +  +      +S         +          NS    +      G   S +         EL+AR LF+T+ W +++     LP      LL  +WS+LF+L A ++ +P +   L+       S +   + +  ++Q  V       L++L + S E + LK I               ++SL +K +VA+ +       R+ Q      +       L  +  +  N I +LFF + +G+ P+  LI DM
Sbjct:   51 VDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLNYTCRSNR--------ECQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPP---------------SHAGISPASMVGAGGDVGGGPGMGADFFNGQPVSELISQLLRAEPY-------PNSRYGAQCGQQLQGANSSMMGI---DNICELAARLLFSTIEWARNIPYFPDLPVSEQVALLRLSWSELFILNAAQSALPLHTAPLLAAAGFHSSPMPADRVVSFMDQVRVFQDQVDKLTRLQVDSVEYSCLKAIALFSPDACGLSDPAHVESLQEKAQVALTE-----YERM-QYPGQPQRFGRLLLRLPALRAVPANLISQLFFMRLVGKTPIETLIRDM 389          
BLAST of nuclear receptor TLX-1 vs. Ensembl Zebrafish
Match: nr2f6b (nuclear receptor subfamily 2, group F, member 6b [Source:ZFIN;Acc:ZDB-GENE-040426-2351])

HSP 1 Score: 134.42 bits (337), Expect = 2.524e-34
Identity = 105/378 (27.78%), Postives = 162/378 (42.86%), Query Frame = 1
Query:  364 VPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQH---LSKLSLGSSEINILKQIIFLD-----------LKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            V C VC D SSGKHYG++ C+GC  FFKRSIR +  Y C++           C+ID+ HRNQC+ CRL+KC   GM KEAVQ  R P                SH  + P+SM+           +  +      +S         +          NS    +      G   S +         EL+AR LF+T+ W +++     LP      LL  +WS+LF+L A ++ +P +   L+       S +   + +  ++Q  V       L++L + S E + LK I               ++SL +K +VA+ +       R+ Q      +       L  +  +  N I +LFF + +G+ P+  LI DM
Sbjct:   51 VDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLNYTCRSNR--------ECQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPP---------------SHAGISPASMVGAGGDVGGGPGMGADFFNGQPVSELISQLLRAEPY-------PNSRYGAQCGQQLQGANSSMMGI---DNICELAARLLFSTIEWARNIPYFPDLPVSEQVALLRLSWSELFILNAAQSALPLHTAPLLAAAGFHSSPMPADRVVSFMDQVRVFQDQVDKLTRLQVDSVEYSCLKAIALFSPDACGLSDPAHVESLQEKAQVALTE-----YERM-QYPGQPQRFGRLLLRLPALRAVPANLISQLFFMRLVGKTPIETLIRDM 389          
BLAST of nuclear receptor TLX-1 vs. Ensembl Xenopus
Match: NR2E1 (nuclear receptor subfamily 2 group E member 1 [Source:NCBI gene;Acc:100491500])

HSP 1 Score: 212.231 bits (539), Expect = 3.424e-63
Identity = 141/398 (35.43%), Postives = 212/398 (53.27%), Query Frame = 1
Query:  334 TGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILD------PSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL----------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            TG++SRIL D+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ +  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF    H  ++      PS+ LP    F   + ++   LE + IS                     ++ + +   +  G P   +Y +      E +AR LF ++ W KS      L L  ++  +LLE  W +LF+L   +  +P +  +L+        +  + K   +I++   L + +S+   L L ++E   LK I+            +L+S  N     A+QD     ++       PT   +      LL  +  I+P+ I ++FF+KTIG +P+  L+SDM
Sbjct:    5 TGSTSRIL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRSYVCKSGNQGG------CLVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFR--GHKEINGSTPHFPSAALPAPTFFTTVSQLEPHNLELTAISTTPERQTLVGL----------AQPTPKYPHEVNGAPL-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQL--MLLEDAWRELFVLGIAQWAIPVDASTLLAVSGMNSDNTESQKLNKIISEIQALQEVVSRFRQLRLDATEFACLKCIVTFKAGVPPHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSINPSTIEEVFFKKTIGNVPITRLLSDM 380          
BLAST of nuclear receptor TLX-1 vs. Ensembl Xenopus
Match: NR2E1 (nuclear receptor subfamily 2 group E member 1 [Source:NCBI gene;Acc:100491500])

HSP 1 Score: 206.453 bits (524), Expect = 5.195e-61
Identity = 135/388 (34.79%), Postives = 205/388 (52.84%), Query Frame = 1
Query:  355 LLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILD------PSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL---------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            +LD+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ +  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF    H  ++      PS+ LP    F   + ++   LE + IS                     ++ + +   +  G P   +Y +      E +AR LF ++ W KS+     L  +   +LLE  W +LF+L   +  +P +  +L+        +  + K   +I++   L + +S+   L L ++E   LK I+           +L+S  N     A+QD     ++       PT   +      LL  +  I+P+ I ++FF+KTIG +P+  L+SDM
Sbjct:   21 ILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRSYVCKSGNQGG------CLVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFR--GHKEINGSTPHFPSAALPAPTFFTTVSQLEPHNLELTAISTTPERQTLVGL----------AQPTPKYPHEVNGAPL-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDASTLLAVSGMNSDNTESQKLNKIISEIQALQEVVSRFRQLRLDATEFACLKCIVTFKAVPPHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSINPSTIEEVFFKKTIGNVPITRLLSDM 389          
BLAST of nuclear receptor TLX-1 vs. Ensembl Xenopus
Match: NR2E1 (nuclear receptor subfamily 2 group E member 1 [Source:NCBI gene;Acc:100491500])

HSP 1 Score: 206.068 bits (523), Expect = 1.039e-60
Identity = 136/391 (34.78%), Postives = 206/391 (52.69%), Query Frame = 1
Query:  355 LLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILD------PSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL----------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            +LD+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ +  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF    H  ++      PS+ LP    F   + ++   LE + IS                     ++ + +   +  G P   +Y +      E +AR LF ++ W KS      L L  ++  +LLE  W +LF+L   +  +P +  +L+        +  + K   +I++   L + +S+   L L ++E   LK I+            +L+S  N     A+QD     ++       PT   +      LL  +  I+P+ I ++FF+KTIG +P+  L+SDM
Sbjct:   22 ILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRSYVCKSGNQGG------CLVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFR--GHKEINGSTPHFPSAALPAPTFFTTVSQLEPHNLELTAISTTPERQTLVGL----------AQPTPKYPHEVNGAPL-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQL--MLLEDAWRELFVLGIAQWAIPVDASTLLAVSGMNSDNTESQKLNKIISEIQALQEVVSRFRQLRLDATEFACLKCIVTFKAGVPPHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSINPSTIEEVFFKKTIGNVPITRLLSDM 391          
BLAST of nuclear receptor TLX-1 vs. Ensembl Xenopus
Match: nr2e3 (nuclear receptor subfamily 2 group E member 3 [Source:NCBI gene;Acc:100036597])

HSP 1 Score: 158.688 bits (400), Expect = 6.743e-43
Identity = 120/390 (30.77%), Postives = 184/390 (47.18%), Query Frame = 1
Query:  370 CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHN-----ILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCD--NSENSIETFDDCIGTPKSTIYFLQESYFS--------ELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLM--YRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFLDLKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNF-------IHKLFFQKTIGQIPVLNLISDMI 1446
            C+VC D SSGKHYGI+AC+GC+GFFKRS+R   +Y C+       +  G+C +DK HRNQC+ACRL+KC+ +GMNK+AVQ+ER PRS+   +  ++  +  S +       DP    P        NN++  +      + +  +N     S   +  C     E + E  D     P+ T    Q S F         E SAR LF  V W K+L     LP     +LLE  WS+LFLL A +  +P +   L+    +  QV   S    +D+     +L + +S+   L++  +E   LK ++    K   + L+   Q   +   S++       N+   +      ++ + P+        I  LFF +TIG  P+  L+ DM 
Sbjct:   37 CRVCGDSSSGKHYGIFACNGCSGFFKRSVRRKLIYRCQ-------AGTGLCPVDKAHRNQCQACRLKKCLQTGMNKDAVQNERQPRSTAQIRLDSIDLDTDSRSEHLATTRDPPPSCP------QGNNLRTPIPSAISGTLSPPHNHRFMASLMTAETCAKLEPEEADENIDVTSNEPERTPTDFQISGFPTSSPEGVYETSARLLFMAVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLCAIQWSMPLDSCPLLSVPDLSSQVHGKSVSSTIDV----RILQETISRFKSLNVDPTEFACLKAVLL--FKPETRGLKDPEQIENLQDQSQMMLAQHTRNQYPAQPVRFGKLLLLSPSLRFISSERIELLFFHRTIGNTPMEKLLCDMF 407          
BLAST of nuclear receptor TLX-1 vs. Ensembl Xenopus
Match: nr2e3 (nuclear receptor subfamily 2 group E member 3 [Source:NCBI gene;Acc:100036597])

HSP 1 Score: 157.918 bits (398), Expect = 1.242e-42
Identity = 120/390 (30.77%), Postives = 184/390 (47.18%), Query Frame = 1
Query:  370 CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHN-----ILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCD--NSENSIETFDDCIGTPKSTIYFLQESYFS--------ELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLM--YRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFLDLKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNF-------IHKLFFQKTIGQIPVLNLISDMI 1446
            C+VC D SSGKHYGI+AC+GC+GFFKRS+R   +Y C+       +  G+C +DK HRNQC+ACRL+KC+ +GMNK+AVQ+ER PRS+   +  ++  +  S +       DP    P        NN++  +      + +  +N     S   +  C     E + E  D     P+ T    Q S F         E SAR LF  V W K+L     LP     +LLE  WS+LFLL A +  +P +   L+    +  QV   S    +D+     +L + +S+   L++  +E   LK ++    K   + L+   Q   +   S++       N+   +      ++ + P+        I  LFF +TIG  P+  L+ DM 
Sbjct:   31 CRVCGDSSSGKHYGIFACNGCSGFFKRSVRRKLIYRCQ-------AGTGLCPVDKAHRNQCQACRLKKCLQTGMNKDAVQNERQPRSTAQIRLDSIDLDTDSRSEHLATTRDPPPSCP------QGNNLRTPIPSAISGTLSPPHNHRFMASLMTAETCAKLEPEEADENIDVTSNEPERTPTDFQISGFPTSSPEGVYETSARLLFMAVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLCAIQWSMPLDSCPLLSVPDLSSQVHGKSVSSTIDV----RILQETISRFKSLNVDPTEFACLKAVLL--FKPETRGLKDPEQIENLQDQSQMMLAQHTRNQYPAQPVRFGKLLLLSPSLRFISSERIELLFFHRTIGNTPMEKLLCDMF 401          
BLAST of nuclear receptor TLX-1 vs. Ensembl Mouse
Match: Nr2e1 (nuclear receptor subfamily 2, group E, member 1 [Source:MGI Symbol;Acc:MGI:1100526])

HSP 1 Score: 213.001 bits (541), Expect = 1.029e-63
Identity = 139/400 (34.75%), Postives = 210/400 (52.50%), Query Frame = 1
Query:  325 MSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYF------NELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL---------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            MS    S+  +LD+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ +  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF      N  + +   PS+ LP    F     ++   LE + +SA                    ++ + +   +  GTP   +Y +      E +AR LF ++ W KS      L L  ++  +LLE  W +LF+L   +  +P +  +L+        +  + K   +I++   L + +++   L L ++E   LK I+           +L+S  N     A+QD     ++       PT   +      LL  +  I P+ I ++FF+KTIG +P+  L+SDM
Sbjct:    1 MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGG------CPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEDNGAAAHF--PSTALPAPAFFTAVTQLEPHGLELAAVSATPERQTLVSL----------AQPTPKYPHEVNGTPM-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQL--MLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNTDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIGNVPITRLLSDM 379          
BLAST of nuclear receptor TLX-1 vs. Ensembl Mouse
Match: Nr2e3 (nuclear receptor subfamily 2, group E, member 3 [Source:MGI Symbol;Acc:MGI:1346317])

HSP 1 Score: 152.14 bits (383), Expect = 9.401e-41
Identity = 119/377 (31.56%), Postives = 181/377 (48.01%), Query Frame = 1
Query:  370 CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHN---ILDPSSMLPFTKSFNNANNVKEELLEF--SLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLIN-QCAVLHQHLSK---LSLGSSEINILKQIIFL--DLKSLNKKLEV-AVQDACMDHVSRLCQLFDPTNKI--AIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            C+VC D SSGKHYGIYAC+GC+GFFKRS+R   +Y C+  +       G+C +DK HRNQC+ACRL+KC+ +GMN++AVQ+ER PRS       AM       +   +  P+   P  +   + +  +     F  SLI+A                     E++ E  D     P+            E SAR LF  V W K+L     LP     +LLE  W++LFLL A +  +P +   L   +    +S S+  +L L + +   L + +S+   L++  +E   LK ++    + + L     V A+QD     +S+  +   P+  +       LL ++  +    I  LFF+KTIG  P+  L+ DM 
Sbjct:   40 CRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGA-------GMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSMAQVHLDAMETGSDPRSEPVVASPALAGPSPRGPTSVSATRAMGHHFMASLITAETCAKL-------------EPEDAEENIDVTSNDPEFPASPCSLDGIHETSARLLFMAVKWAKNLPVFSNLPFRDQVILLEEAWNELFLLGAIQWSLPLDSCPL---LAPPEASGSSQGRLALASAETRFLQETISRFRALAVDPTEFACLKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFLTAERIELLFFRKTIGNTPMEKLLCDMF 393          
BLAST of nuclear receptor TLX-1 vs. Ensembl Mouse
Match: Nr2f6 (nuclear receptor subfamily 2, group F, member 6 [Source:MGI Symbol;Acc:MGI:1352453])

HSP 1 Score: 122.479 bits (306), Expect = 3.844e-30
Identity = 98/391 (25.06%), Postives = 164/391 (41.94%), Query Frame = 1
Query:  328 SNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSL----QLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQH---LSKLSLGSSEINILKQIIFLD-----------LKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            +  G+  R  L V C VC D SSGKHYG++ C+GC  FFKRSIR +  Y C++           C+ID+ HRNQC+ CRL+KC   GM                 +K A+    + H +  P++  P       A  V+     F+    ++L     +     ++       ++   D+                  EL+AR LF+TV W +      +LP      LL  +WS+LF+L A +  +P +   L+       + ++  + +  ++Q     +    L +L + ++E   LK I               ++SL +K +VA+ +          Q F            L  +  +  + I +LFF + +G+ P+  LI DM+
Sbjct:   43 AEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRD--------CQIDQHHRNQCQYCRLKKCFRVGM-----------------RKEAVQRGRIPHALPGPAACSP-----PGATGVEP----FTGPPVSELIAQLLRAEPYPAAGRFGGGGAVLGIDNVC----------------ELAARLLFSTVEWARHAPFFPELPAADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDAAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRF------GRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDML 377          
BLAST of nuclear receptor TLX-1 vs. Ensembl Mouse
Match: Nr2f1 (nuclear receptor subfamily 2, group F, member 1 [Source:MGI Symbol;Acc:MGI:1352451])

HSP 1 Score: 110.153 bits (274), Expect = 1.311e-25
Identity = 94/380 (24.74%), Postives = 160/380 (42.11%), Query Frame = 1
Query:  370 CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICK-NKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSKLS---LGSSEINILKQIIFLD-----------LKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            C VC D SSGKHYG + C+GC  FFKRS+R +  Y C+ N++         C ID+ HRNQC+ CRL+KC+  GM           R +  R +            + P+   P   +  N + +         IS          + +    +  N+   IE                      EL+AR LF+ V W ++      LQ+  ++   LL   WS+LF+L A +  +P +   L+       S +S  + +  ++   +  + + KL    + S+E + LK I+              ++SL +K + A+++            F    K+ +    L ++  +  + I +LFF + +G+ P+  LI DM+
Sbjct:   83 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRN---------CPIDQHHRNQCQYCRLKKCLKVGMR----------REAVQRGR------------MPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENI-------------------CELAARLLFSAVEWARNIPFFPDLQITDQVS--LLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRF---GKLLLR---LPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDML 404          
BLAST of nuclear receptor TLX-1 vs. Ensembl Mouse
Match: Hnf4a (hepatic nuclear factor 4, alpha [Source:MGI Symbol;Acc:MGI:109128])

HSP 1 Score: 98.9821 bits (245), Expect = 1.698e-23
Identity = 48/105 (45.71%), Postives = 67/105 (63.81%), Query Frame = 1
Query:  328 SNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVR 642
            +N  +S+ + +   C +C D ++GKHYG  +CDGC GFF+RS+R + +Y C+        +   C +DK  RNQCR CRL+KC  +GM KEAVQ+ER  R ST R
Sbjct:   22 ANLNSSNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCR--------FSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNER-DRISTRR 117          
BLAST of nuclear receptor TLX-1 vs. UniProt/SwissProt
Match: sp|Q91379|NR2E1_CHICK (Nuclear receptor subfamily 2 group E member 1 OS=Gallus gallus OX=9031 GN=NR2E1 PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 4.200e-63
Identity = 137/398 (34.42%), Postives = 209/398 (52.51%), Query Frame = 1
Query:  325 MSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFN----ELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL---------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            MS    S+  +LD+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ +  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF     E S     P++ LP    F   + ++   LE + ++                     ++ + +   +  GTP   +Y +      E +AR LF ++ W KS      L L  ++  +LLE  W +LF+L   +  +P +  +L+        +  + K   +I++   L + +++   L L ++E   LK I+           +L+S  N     A+QD     ++       PT   +      LL  +  I P+ I ++FF+KTIG +P+  L+SDM
Sbjct:    1 MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGG------CPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEESSGAPHFPATALPAPAFFTAVSQLEPHGLELAAVAGTPERQALVGL----------AQPTPKYPHEVNGTPM-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQL--MLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIGNVPITRLLSDM 379          
BLAST of nuclear receptor TLX-1 vs. UniProt/SwissProt
Match: sp|Q9Y466|NR2E1_HUMAN (Nuclear receptor subfamily 2 group E member 1 OS=Homo sapiens OX=9606 GN=NR2E1 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 5.827e-63
Identity = 138/398 (34.67%), Postives = 207/398 (52.01%), Query Frame = 1
Query:  325 MSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFN----ELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL---------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            MS    S+  +LD+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ +  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF     E       PS+ LP    F     ++   LE + +S                     ++ + +   +  GTP   +Y +      E +AR LF ++ W KS      L L  ++  +LLE  W +LF+L   +  +P +  +L+        +  + K   +I++   L + +++   L L ++E   LK I+           +L+S  N     A+QD     ++       PT   +      LL  +  I P+ I ++FF+KTIG +P+  L+SDM
Sbjct:    1 MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGG------CPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSL----------AQPTPKYPHEVNGTPM-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQL--MLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIGNVPITRLLSDM 379          
BLAST of nuclear receptor TLX-1 vs. UniProt/SwissProt
Match: sp|Q64104|NR2E1_MOUSE (Nuclear receptor subfamily 2 group E member 1 OS=Mus musculus OX=10090 GN=Nr2e1 PE=1 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 7.198e-63
Identity = 139/400 (34.75%), Postives = 210/400 (52.50%), Query Frame = 1
Query:  325 MSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYF------NELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL---------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            MS    S+  +LD+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ +  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF      N  + +   PS+ LP    F     ++   LE + +SA                    ++ + +   +  GTP   +Y +      E +AR LF ++ W KS      L L  ++  +LLE  W +LF+L   +  +P +  +L+        +  + K   +I++   L + +++   L L ++E   LK I+           +L+S  N     A+QD     ++       PT   +      LL  +  I P+ I ++FF+KTIG +P+  L+SDM
Sbjct:    1 MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGG------CPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEDNGAAAHF--PSTALPAPAFFTAVTQLEPHGLELAAVSATPERQTLVSL----------AQPTPKYPHEVNGTPM-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQL--MLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNTDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIGNVPITRLLSDM 379          
BLAST of nuclear receptor TLX-1 vs. UniProt/SwissProt
Match: sp|Q9YGL3|NR2E1_ORYLA (Nuclear receptor subfamily 2 group E member 1 OS=Oryzias latipes OX=8090 GN=nr2e1 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.461e-62
Identity = 134/392 (34.18%), Postives = 205/392 (52.30%), Query Frame = 1
Query:  343 SSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILD------PSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL---------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            SSRIL D+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R+Y+CK+ S  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF    H  ++      P S LP    F     ++   LE S ++                     ++ + +   +  GTP   +Y +      E +AR LF ++ W KS+     LP     +LLE  W +LF+L   +  +P +  +L+        ++   +   ++ +   L + +++   + L ++E   LK I+           +L++  N     A+QD     ++       PT   +      LL  +  + P+ I ++FF+K IG +P+  L+SDM
Sbjct:   19 SSRIL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRIYLCKSGSQGG------CPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFR--GHKEVNGSSTHFPGSSLPGPPFFTTVTQLEPHNLEMSSVATTPERQAIVGL----------AQPTPKYPHEVSGTPM-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLPLSDQLILLEDAWRELFVLGIAQWAIPVDSTTLLAVSGLNSENMEAQRMNKIMAEIQALQEVVTRFRQMRLDATEFACLKCIVTFKAVPTQGSAELRAFRNASAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSVSPSTIEEVFFKKNIGNVPITRLLSDM 390          
BLAST of nuclear receptor TLX-1 vs. UniProt/SwissProt
Match: sp|P70052|NR2E1_XENLA (Nuclear receptor subfamily 2 group E member 1 OS=Xenopus laevis OX=8355 GN=nr2e1 PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.474e-60
Identity = 142/402 (35.32%), Postives = 212/402 (52.74%), Query Frame = 1
Query:  325 MSN-TGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILD------PSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL----------DLKSLNKKLEV-AVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            MSN TG++SRIL D+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ +  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF    H  ++       S+ LP    F     ++   LE + IS                     ++ + +   +  G P     F  ES   E +AR LF ++ W KS      L L  ++  +LLE  W +LF+L   +  +P +  +L+        +  + K   +I++   L   +S+   L L ++E   LK I+            +L++      + A+QD     ++       PT   +      LL  +  I+P+ I ++FF+KTIG +P+  ++SDM
Sbjct:    1 MSNPTGSTSRIL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRSYVCKSGNQGG------CPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFR--GHKEVNGSTQHFSSTALPTPTFFTTVRQLEAHNLELAAISTVPERQTLVGL----------AQPTPKYPHEVNGAPLYLYEFATES-VCESAARLLFMSIKWAKSVPAFSTLSLQDQL--MLLEDAWRELFVLGIAQWAIPVDASTLLAVSGMNNENTESPKLNKIISEIQALQDVVSRFRQLRLDATEFACLKCIVTFKAGVSTHSGSELRNFRNAAAISALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSINPSTIEEVFFKKTIGNVPITRVLSDM 380          
BLAST of nuclear receptor TLX-1 vs. TrEMBL
Match: H6WCS9 (Nuclear receptor TLX-1 OS=Schmidtea mediterranea OX=79327 GN=tlx-1 PE=2 SV=1)

HSP 1 Score: 712.22 bits (1837), Expect = 0.000e+0
Identity = 366/370 (98.92%), Postives = 368/370 (99.46%), Query Frame = 1
Query:  340 NSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSKLSLGSSEINILKQIIFLDLKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMIA 1449
            ++ RILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLISAAKLNNFSNKNSFSISSLCDNSENSIETFDDCIGTPKSTIYF QESYFSELSARSLFNTVHWIKSLQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSKLSLGSSEINILKQIIFLDLKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMIA
Sbjct:    4 STGRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLISAAKLNNFSNKNSFSISSLCDNSENSIETFDDCIGTPKSTIYFFQESYFSELSARSLFNTVHWIKSLQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSKLSLGSSEINILKQIIFLDLKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMIA 373          
BLAST of nuclear receptor TLX-1 vs. TrEMBL
Match: A0A1S3K559 (nuclear receptor subfamily 2 group E member 1 OS=Lingula unguis OX=7574 GN=LOC106178932 PE=3 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.785e-69
Identity = 156/397 (39.29%), Postives = 210/397 (52.90%), Query Frame = 1
Query:  334 TGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPK-----STIYFLQESYFSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYR--ICDQVSS----LSTMKQLDLINQCAVLHQHLSKLSLGSSEINILKQIIFL---------DLKSLNKKLEVA-VQDACMDHVSRLCQLFDPTNKIAIEACLLM--NIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
             G SSRIL+D+PCKVCQDHSSGKHYGIYACDGCAGFFKRSIR +R YICK++   G      C +DKTHRNQCRACRL+KC+D+GMNK+AVQHERGPR+ST+R++VAMY  E S   +  S+  PF   + NA      ++  S           +  S    +       S+ +   C   PK     +  YF       E +AR LF +V W+KS+     L      +LLE +W +LF+L A + ++P    SLM    I  + S     +S M  + L+ +  V       + +  +E   LK I+           D+KSL     VA +QD     +S+  Q   PT        LL+   +  I    I +LFF+KTIG IP+  L+ DM
Sbjct:    5 AGASSRILMDIPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRRNRQYICKSRGQTGG-----CPVDKTHRNQCRACRLKKCMDAGMNKDAVQHERGPRNSTIRRQVAMYLKEQSELGMLASN--PFRPPYINA------VMGLSPSEMPVEGISISTGSSPFEASHPGLLPSLTSRMICHPIPKYPHEIAQAYFNSPEAVCEAAARLLFMSVKWVKSVPAFNSLSYRDQILLLEESWRELFVLGACQFQIPIEPASLMAAAGITSETSPPEKVVSFMADIRLLQELVV---KFKAMQIDPTEYACLKGIVLFKTVFQNANSDMKSLRDFHAVASLQDQAQLTLSKYIQTAYPTQPFRFGKLLLVLPQLRGISTKTIEELFFRKTIGSIPMERLLIDM 385          
BLAST of nuclear receptor TLX-1 vs. TrEMBL
Match: K1RMW8 (Nuclear receptor subfamily 2 group E member 1 OS=Crassostrea gigas OX=29159 GN=CGI_10028920 PE=3 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 1.184e-65
Identity = 152/407 (37.35%), Postives = 203/407 (49.88%), Query Frame = 1
Query:  334 TGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSF--------NNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFS------ELSARSLFNTVHWIKS----LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL----------DLKSLNKKLEVA-VQDACMDHVSRLCQLFDPTNKIAIEACLL----MNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
             G SSRIL D+PCKVCQDHSSGKHYGIYACDGCAGFFKRSIR +R YICK++        G C +DKTHRNQCRACRL+KC+++GMNK+AVQHERGPR+ST+R++VAMY  E + +     +  PF   +          AN V    +                             + +     C  TPK     +Q +Y S      E++AR LF +V W K+    L LP     +LLE  W +LF+L A + ++P     L+             K +  + +   L + +SK   L +  +E   LK I+            D KSL     VA +QD     +S+  Q   PT        LL    +  +C   N I +LFF+KTIG IP+  L+ DM 
Sbjct:    5 AGTSSRILTDIPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRRNRQYICKSRG------QGTCPVDKTHRNQCRACRLKKCLEAGMNKDAVQHERGPRNSTIRRQVAMYLKE-TRDYGAFVAQTPFRPPYLPSCYGLDPMANGVDLGTV--------------------------TPPSPVSPGILCQPTPKYPHEIMQ-AYSSNPEAMCEVAARLLFMSVKWAKNVPAFLGLPFRDQVMLLEEGWRELFVLGAAQFQMPVEAGPLLAVAGLNTEDAPAEKVVSFMTEIRALQEIISKFKSLQVDPTEFACLKGIVLFKTAFGNSQNSDEKSLQDIHTVAGLQDQAQLTLSKYIQATYPTQPFRFGKLLLSIPTLKTVCG--NTIAELFFRKTIGNIPIERLLIDMF 375          
BLAST of nuclear receptor TLX-1 vs. TrEMBL
Match: E9FSF9 (Tailless-like protein (Fragment) OS=Daphnia pulex OX=6669 GN=TLL PE=3 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 2.848e-65
Identity = 140/378 (37.04%), Postives = 197/378 (52.12%), Query Frame = 1
Query:  343 SSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFLDLKSLNKKLEVAV--QDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            S RIL D+PC+VCQDHSSGKHYGI+ACDGCAGFFKRSIR +R Y+CK KS       G C +DKTHRNQCRACRL+KCV+ GMNK+AVQHERGPR+ST+R++++M+++        P +        NN +    +    S                           S          P  TI         E +AR LF  V W KS+     LP     +LLE +W +LF+L A +  +P    +LM  +   +SS  T +QL L+++     + ++K   +++ ++E   L+ +I     +  + +  AV  QD     +SR      P    +      LL  +  I P+ I +LFF+KTIG IP+  +ISDM
Sbjct:    1 SGRILYDIPCRVCQDHSSGKHYGIFACDGCAGFFKRSIRRNRQYVCKAKS------EGACLVDKTHRNQCRACRLRKCVEVGMNKDAVQHERGPRNSTLRRQMSMFYSMKGSTSSSPEN--------NNGSTADADSPPPS-----------------------TGRASPLMPSGMTTPPPETI--------CESAARLLFMNVRWAKSVPAFTTLPSRDQIILLEESWRELFVLGAAQFTLPIEAGTLMTAL--GLSSSPTERQLGLLSEIKAFQETVAKFKQMNVDATEYACLRAVILFKTSAGLRDIPSAVNLQDQAQLTLSRYVSTAYPNQPLRFGRLLLLLPALRTIAPSTIEELFFRKTIGNIPIERIISDM 331          
BLAST of nuclear receptor TLX-1 vs. TrEMBL
Match: A0A3Q3AI94 (Nuclear receptor subfamily 2, group E, member 1 OS=Kryptolebias marmoratus OX=37003 PE=3 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 4.725e-65
Identity = 143/400 (35.75%), Postives = 214/400 (53.50%), Query Frame = 1
Query:  325 MSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILD------PSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL---------DLKSL-NKKLEVAVQDACMDHVSRLC--QLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            MS  G++SRIL D+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ S  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF    H  ++      P S LP    F     ++   LE S ++                     ++ + +   +  GTP   +Y +      E +AR LF ++ W KS+     LP     +LLE  W +LF+L   +  +P +  +L+        +  + +   ++++   L + +++   + L ++E   LK I+           +L+S  N     A+QD    H SR C  +L  PT   +      LL  +  + P+ I ++FF+KTIG +P+  L+SDM
Sbjct:    1 MSKPGSTSRIL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGSQGG------CPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFR--GHKEVNGSSTHFPGSSLPGPPFFTTVTQLEPHNLEMSSVATTPERQAIVGL----------AQPTPKYPHEVTGTPM-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLPLSDQLILLEDAWRELFVLGIAQWAIPVDSTTLLAVSGMNTENTESQRMNKIMSEIQALQEVVTRFRQMRLDATEFACLKCIVTFKAVPTQGSTELRSFRNASAIAALQDEA--HPSRSCVWRLAYPTQPCRFGKLLLLLPALRSVGPSTIEEVFFKKTIGNVPITRLLSDM 378          
BLAST of nuclear receptor TLX-1 vs. Ensembl Cavefish
Match: nr2e1 (nuclear receptor subfamily 2 group E member 1 [Source:NCBI gene;Acc:103026242])

HSP 1 Score: 211.46 bits (537), Expect = 5.184e-63
Identity = 134/394 (34.01%), Postives = 208/394 (52.79%), Query Frame = 1
Query:  343 SSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILD------PSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQ---HLSKLSLGSSEINILKQIIFL---------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            SSRIL D+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ +  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF    H  ++      P++ +P    F   + +    L+ + +++      +             ++ + +   +  G P   +Y +      E +AR LF ++ W KS      L LP ++  +LLE  W +LF+L   +  +P +  +L+        +  + +   L+ +   L +   H  +L L ++E   LK I+           +L+S  N     A+QD     ++       PT   +      LL  +  + P+ I ++FF+KTIG +P+  L+SDM
Sbjct:   19 SSRIL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGTQGG------CPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFR--GHKDVNGSSAPFPTASIPGPPFFTTVSQLDTHSLDLNTVASTPERQQAVVGL---------AQPTPKYPHEVSGAPL-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLPLPDQL--ILLEEAWRELFVLGIAQWAIPVDSNTLLAVSGMTAENTESQRLNKLMEEIQALQEVVTHFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNASAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSVGPSTIEEVFFKKTIGNVPITRLLSDM 391          
BLAST of nuclear receptor TLX-1 vs. Ensembl Cavefish
Match: nr2f6b (nuclear receptor subfamily 2 group F member 6 [Source:NCBI gene;Acc:103046533])

HSP 1 Score: 136.346 bits (342), Expect = 5.277e-35
Identity = 106/378 (28.04%), Postives = 166/378 (43.92%), Query Frame = 1
Query:  364 VPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQH---LSKLSLGSSEINILKQIIFLD-----------LKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            V C VC D SSGKHYG++ C+GC  FFKRSIR +  Y C++           C+ID+ HRNQC+ CRL+KC   GM KEAVQ  R P                SH+ + P+SM+           +  E                       +    NS    +     +G   S +  +      EL+AR LF+T+ W +++     LP      LL  +WS+LF+L A ++ +P +   L+       S +S  + +  ++Q  V       L++L + S+E + LK I               ++SL +K +VA+ +       R+     P  +       L ++  +  N I +LFF + +G+ P+  LI DM
Sbjct:   51 VDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRE--------CQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPP---------------SHSGISPTSMVGAGGGGVGGQGMGGEYFN-------GQPAPELITQLLRAEPYPNSRYGAQCGQQ-LGGGNSAVMGIDN--ICELAARLLFSTIEWARNIPYFPDLPVSEQVALLRLSWSELFILNAAQSALPLHMAPLLAAAGFHASPMSAERVVSFMDQVRVFQDQVDKLTRLQVDSAEYSCLKAIALFSPDACGLTDPAHVESLQEKAQVALTE-----YERMQYPTQP-QRFGRLLLRLPSLRAVPANLISQLFFMRLVGKTPIETLIRDM 389          
BLAST of nuclear receptor TLX-1 vs. Ensembl Cavefish
Match: nr2f5 (nuclear receptor subfamily 2 group F member 5 [Source:NCBI gene;Acc:103038004])

HSP 1 Score: 132.494 bits (332), Expect = 1.057e-33
Identity = 113/421 (26.84%), Postives = 184/421 (43.71%), Query Frame = 1
Query:  256 VMVDNNSSLDL-SEDHWDSHDTSFMSNTGN---SSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFLD-----------LKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            +  D  S L L  ++   +  T   S  GN   S+  + +V C VC D SSGKHYG + C+GC  FFKRS+R +  Y C+            C ID+ HRNQC+ CRL+KC+  GM +EAVQ  RG R S+ +     Y      N  DP +  P+   F             SL+            +    + C  S N +   + C                 EL+AR LF+ V W K+      LQL  ++   LL  +WS+LF+L A +  +P +   L+       S +S  + +  ++   V  + + K   L + ++E + LK I+              ++S+ +K + A+++   +      Q  +  N+       L ++  +    I +LFF + +G+ P+  L+ DM+
Sbjct:   12 ISADPGSQLQLCGQEPGGTPGTPSGSTPGNDALSADKIPNVDCMVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRGNR--------DCPIDQHHRNQCQYCRLKKCLKVGMRREAVQ--RG-RMSSSQSSPGQYLT----NGNDPYNGQPYLSGF------------ISLL-----LRAEPYPTSRYGAQCMQSNNLMGIENIC-----------------ELAARLLFSAVEWAKNIPFFPDLQLMDQV--ALLRMSWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSAERVVAFMDHIRVFQEQVEKLKALQVDTAEYSCLKSIVLFTSDAMGLSDVAHVESIQEKSQCALEEYVRN------QYPNQPNRFGRLLLRLPSLRIVSSPVIEQLFFVRLVGKTPIETLLRDML 375          
BLAST of nuclear receptor TLX-1 vs. Ensembl Cavefish
Match: nr2e3 (nuclear receptor subfamily 2 group E member 3 [Source:NCBI gene;Acc:103047484])

HSP 1 Score: 129.028 bits (323), Expect = 2.448e-32
Identity = 62/130 (47.69%), Postives = 84/130 (64.62%), Query Frame = 1
Query:  247 LIIVMVDNNSSLDLSEDHWDSHDTSFMSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSST 636
            L I MV ++S  D S     + D+    +      +   + CKVC D SSGKHYGIYAC+GC+GFFKRS+R   +Y C+       +  G+C +DK HRNQC+ACRL+KC+ +GMNK+AVQ+ER PRS+ 
Sbjct:    6 LNISMVPSSSPTD-SPRSNSTEDSQGGKSPAPGKTLSTGMLCKVCADTSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQ-------AGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQPRSTA 127          
BLAST of nuclear receptor TLX-1 vs. Ensembl Cavefish
Match: nr2f1a (nuclear receptor subfamily 2 group F member 1 [Source:NCBI gene;Acc:103026790])

HSP 1 Score: 110.153 bits (274), Expect = 8.271e-26
Identity = 94/390 (24.10%), Postives = 163/390 (41.79%), Query Frame = 1
Query:  340 NSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICK-NKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS------LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSKLS---LGSSEINILKQIIFLD-----------LKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            NS++    + C VC D SSGKHYG + C+GC  FFKRS+R +  Y C+ N++         C ID+ HRNQC+ CRL+KC+                      KV M    +    + P+   P   +  N + +         IS          + +    +  N+   IE                      EL+AR LF+ V W ++      LQ+  ++   LL   WS+LF+L A +  +P +   L+       S +S  + +  ++   +  + + KL    + S+E + +K I+              ++SL +K + A+++            F    K+ +    L ++  +  + I +LFF + +G+ P+  LI DM+
Sbjct:   66 NSAQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRN---------CPIDQHHRNQCQYCRLKKCL----------------------KVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENI-------------------CELAARLLFSAVEWARNIPFFPDLQITDQVS--LLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCIKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRF---GKLLLR---LPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDML 397          
BLAST of nuclear receptor TLX-1 vs. Ensembl Sea Lamprey
Match: nr2e3 (nuclear receptor subfamily 2, group E, member 3 [Source:ZFIN;Acc:ZDB-GENE-041114-63])

HSP 1 Score: 131.724 bits (330), Expect = 7.060e-34
Identity = 84/248 (33.87%), Postives = 120/248 (48.39%), Query Frame = 1
Query:  304 DSHDTSFMSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLL 1035
            D+    F       +   L + C VC D SSGKHYGIYAC+GC+GFFKRS+R   +Y C+  +       G+C +DK HRNQC+ACRL+KC+ +GMNK+AVQ+ER PRS+    +V     EL  N   P+++ P   +           +   L       +    +  S  S  D + +  E+              +  +  S+     LF  + W K+L     LP     +LLE  WS+LFLL
Sbjct:   29 DAGARHFPEGLARKTAASLLLTCLVCGDVSSGKHYGIYACNGCSGFFKRSVRRKLIYRCQAST-------GLCTVDKAHRNQCQACRLRKCLHAGMNKDAVQNERQPRSTA---QVRPGDPELGANTWAPAAVTPTALASAAPTPPPPSHVTRCLSRHLADLSDRRHSRASGVSFADEAVDVTESRSPIRVRASPKCLPVASAEVSDTPMSLLFMAIKWAKNLPAFSALPFRDQVILLEEAWSELFLL 266          
BLAST of nuclear receptor TLX-1 vs. Ensembl Sea Lamprey
Match: hnf4g (hepatocyte nuclear factor 4, gamma [Source:ZFIN;Acc:ZDB-GENE-060929-100])

HSP 1 Score: 92.0485 bits (227), Expect = 2.687e-20
Identity = 46/91 (50.55%), Postives = 59/91 (64.84%), Query Frame = 1
Query:  370 CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVR 642
            C +C D ++GKHYG  +CDGC GFF+RSIR + +Y C+        +   C +DK  RNQCR  RL+KC  +GM KEAVQ+ER  R ST R
Sbjct:   63 CAICGDRATGKHYGASSCDGCKGFFRRSIRKNHMYSCR--------YSRQCVVDKDKRNQCRY-RLKKCFRAGMKKEAVQNERD-RISTRR 143          
BLAST of nuclear receptor TLX-1 vs. Ensembl Sea Lamprey
Match: rorb (RAR-related orphan receptor B [Source:ZFIN;Acc:ZDB-GENE-061204-2])

HSP 1 Score: 87.4261 bits (215), Expect = 1.123e-18
Identity = 39/85 (45.88%), Postives = 57/85 (67.06%), Query Frame = 1
Query:  364 VPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHER 618
            +PCK+C D SSG HYG+  C+GC GFF+RS +++  Y C  +          C ID+T+RN+C+ CRLQKC+  GM+++AV+  R
Sbjct:   19 IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQR--------NCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGR 95          
BLAST of nuclear receptor TLX-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006803.1 (pep scaffold:Pmarinus_7.0:GL479639:153667:156574:-1 gene:ENSPMAG00000006138.1 transcript:ENSPMAT00000006803.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 2.139e-18
Identity = 40/85 (47.06%), Postives = 52/85 (61.18%), Query Frame = 1
Query:  355 LLDVP---CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKE 600
            LL +P   C VC D +SG+HYG  +C+GC GFFKRS+R +  Y C+            C I+K HRN+C+ CRLQKC + GM  E
Sbjct:  119 LLKLPVEFCVVCGDRASGRHYGAVSCEGCKGFFKRSVRKNLKYTCRGSQ--------DCVINKHHRNRCQYCRLQKCFNVGMKTE 195          
BLAST of nuclear receptor TLX-1 vs. Ensembl Sea Lamprey
Match: ESR2 (estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3468])

HSP 1 Score: 83.1889 bits (204), Expect = 2.812e-18
Identity = 42/106 (39.62%), Postives = 62/106 (58.49%), Query Frame = 1
Query:  316 TSFMSNTGNSS---RILLDVP--------CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKE 600
            ++FM + G+SS   R +L  P        C VC D SSG HYG++ C+GC  FFKRS++    ++C   +         C IDKT R +C+ACRL+KC ++GM ++
Sbjct:    3 STFMLSAGSSSITERPVLASPVDGPATQLCSVCGDFSSGYHYGVWTCEGCKAFFKRSVQGKNNFVCPATN--------HCTIDKTRRRRCQACRLRKCYEAGMIRD 100          
BLAST of nuclear receptor TLX-1 vs. Ensembl Nematostella
Match: EDO38323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD90])

HSP 1 Score: 182.956 bits (463), Expect = 3.942e-53
Identity = 124/376 (32.98%), Postives = 182/376 (48.40%), Query Frame = 1
Query:  355 LLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS----LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFLDLKSLNKKLEVAV---QDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            LLD+PCKVC D SSGKHYGIYACDGC+GFFKRSIR +R Y C+  + KG+     C +DK HRNQCR+CRL+KC D  MNK+AVQHERGPRSST+RK+  +   +    ++  +        F N     E  ++   ++                   D     I    D +  P   +Y+       E +A+ LF +V W ++    + LP     +LLE  W +LFLL A +  +P     ++      V +    K +D++     L + ++K     + S+E   LK I+     +   K    +   QD     +    +   PT   +      LL  +  +    I +LFF+KTIG +P+  L+SDM 
Sbjct:    3 LLDIPCKVCGDRSSGKHYGIYACDGCSGFFKRSIRRNRSYTCRATNGKGN-----CPVDKIHRNQCRSCRLKKCFDVSMNKDAVQHERGPRSSTLRKQKMLKEAQERLELVSVAHAPQGPSGFINTLLAAEPRMDGCGMAVNDF---------------DLEYKPIRLQSD-MSVP---MYYSSPESVCEAAAKLLFMSVKWARNIPSFMSLPFRDQVILLEEGWRELFLLGASQWSMPLEIAPILAASGMHVDNTPPEKIVDVMATVRTLQEAVNKFKAFGVDSTEFACLKAIVLFKPAACGLKDPEQIETTQDQAQLMLGEYIRSTYPTQVARFGRLLLLLPALRRVSALAIEELFFKKTIGTVPIERLLSDMF 354          
BLAST of nuclear receptor TLX-1 vs. Ensembl Nematostella
Match: EDO32715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUB6])

HSP 1 Score: 144.436 bits (363), Expect = 4.258e-39
Identity = 107/378 (28.31%), Postives = 168/378 (44.44%), Query Frame = 1
Query:  373 KVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGT-PKSTIYFLQESYFSELSARSLFNTVHWIKS----LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQ---HLSKLSLGSSEINILKQIIF---------LDLKSLN-KKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLM--NIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            +VC D SSGKHYG++ CDGC GFFKRSIR +  Y CK         +G C +D   RNQC+ACRL+KC +  MNK+AVQHER PRS+ +  + A     +  N  D    +P  +S +                                           TF     T P+ +IY        E + + L+ +V W ++    L LP    ++LLE  WS+LF+L++ +  +P +   L+     QV    T + +  +    +L        +L + S+E   LK I+          ++L+ L   +L   +QD     +   C+   P  ++     LLM  ++  + P  I  LFF+ T+  +P+  ++ DM 
Sbjct:    2 RVCGDRSSGKHYGVFTCDGCRGFFKRSIRRNLTYHCKE--------LGKCVVDVARRNQCQACRLKKCFEVQMNKDAVQHERAPRSAQILPR-ATSTTTIDLNKEDRPDGVPTQRSTDMCPGW--------------------------------------TFPTGYQTAPQDSIY--------ESAVQLLYMSVTWARNIPTFLDLPFRDQAILLEEGWSELFVLSSAQFSLPLDMGPLLSAAGLQVDKAPTDRIVAGMADIRLLQNIVTRFKRLQIDSTEYACLKAIVLFKPVLPFFPVNLRGLRAPQLVERLQDQAQSMLGEYCRSQYPDQQVRFGKLLLMLPSLKTVSPKMIEDLFFRGTLDNVPIERMLCDMF 324          
BLAST of nuclear receptor TLX-1 vs. Ensembl Nematostella
Match: EDO42936 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S012])

HSP 1 Score: 142.51 bits (358), Expect = 4.293e-38
Identity = 114/396 (28.79%), Postives = 178/396 (44.95%), Query Frame = 1
Query:  364 VPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRK--------------------KVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKS----LQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLS-------TMKQLDLINQCAVLHQHLSKLSLGSSEINILKQIIFL--DLKSL---NKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            V C+VC D +SGKHYG+  CDGC GFFKRS+R +  Y CK K+         C ID   RNQC+ACRL+KC +  MN++AVQHER PR+S +R+                    ++    ++ ++  +D  S   F K  ++  NVK  L   S+                       S  +I      +G P   + ++   Y  E + R L+ TV W+++    L LP    ++L+E +WS+LF+L+  +  +  +  SL+     Q   LS       T   +  I     +   L   S+  +E   LK I+    D++ L   +   ++  Q  CM     L    D  ++       L ++  I P  I +LFF  T+  IP+  L++DM
Sbjct:    2 VQCRVCGDRASGKHYGVMTCDGCRGFFKRSVRRNLAYQCKEKN--------DCPIDVARRNQCQACRLRKCFEMNMNRDAVQHERAPRTSQIRQNSQSKPLKRKHISIENMSADQIKTKSDKRAYQQVDSRSS-GFEKPIDDMENVK-CLPPVSIA----------------------SNLTISPTPHSVGIP---VVYMDMMY--ESAIRVLYMTVKWVRNIPTFLDLPFRDQAILIEESWSELFILSLSQWDMAVDLSSLVSAAYPQQMGLSPGHKSDRTPGSMSDIRNLQTVVSRLRTASVDQTEYACLKAIVLFKPDIRGLRLWSHVEQLQDQAQCMLGEYELQHYPDQVSRFGKLLLSLPSLKSIPPKAIERLFFSGTLDNIPMERLLADM 360          
BLAST of nuclear receptor TLX-1 vs. Ensembl Nematostella
Match: EDO38322 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD88])

HSP 1 Score: 121.709 bits (304), Expect = 7.785e-31
Identity = 110/387 (28.42%), Postives = 167/387 (43.15%), Query Frame = 1
Query:  361 DVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSEL---SARSLFN--------TVHWIKSL----QLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRI---CDQVSSLSTMKQLDLINQCAVLHQHLSKLSLGSSEINILKQIIFL--DLKSLNKKLEVA-VQDACM----DHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            ++ CKVC D SSG+HYG+Y CDGC+GFF RS+R   +Y CK          G C +DK  RNQC+ACR +KC++  MN+ AVQ ER P S+ V K          H  LD   +    K  NN      E L  SLI A                  +   +++      +  P     +LQ+   S L   S  +LF         +V W +++     LP     VLLE  W +LF++ A +  +P     L+       D   +   +  +  I +   +      L +  +E   LK I+    DL+ L    +V   QD       D++ R  Q      +      +L ++  +    I +LFF++TIG + + +L+ DM 
Sbjct:    6 EILCKVCGDISSGRHYGVYTCDGCSGFFMRSVRRDMVYTCKGN--------GGCTVDKKRRNQCQACRFKKCLEVKMNRFAVQQERQPNSTRVMK---------PH--LDEYGL----KGLNN------EFLA-SLIVA------------------EPCRDAVYRTSQGLNLP-----YLQQDVASPLFCSSPDALFESAARLLFMSVKWARNIPSFVNLPFRDQVVLLEEGWRELFIMGAIQWNLPLEVAPLLAAAGMHVDNTPAEKIVATMADIRKLQEIGSRFRALQVCEAEFACLKAIVLFKPDLRDLRDPQQVECYQDQAQIMLGDYIKR--QFAGQQVRFGKLLLMLPSLRLVRNKTIEELFFRQTIGSVAIESLLCDMF 337          
BLAST of nuclear receptor TLX-1 vs. Ensembl Nematostella
Match: EDO38995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBF2])

HSP 1 Score: 103.99 bits (258), Expect = 2.294e-24
Identity = 44/89 (49.44%), Postives = 61/89 (68.54%), Query Frame = 1
Query:  370 CKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSST 636
            CKVC D+ +GKHYG+ AC+GC GFFKR++R + +Y C+  +         C IDK HRN+C+ CR  KC+ +GM KEAVQ ER P +++
Sbjct:   13 CKVCGDNGTGKHYGVVACEGCKGFFKRTVRKNLIYTCRGSN--------DCFIDKVHRNRCQKCRFVKCLTAGMKKEAVQCERKPLAAS 93          
BLAST of nuclear receptor TLX-1 vs. Ensembl Medaka
Match: nr2e1 (nuclear receptor subfamily 2 group E member 1 [Source:NCBI gene;Acc:100049530])

HSP 1 Score: 212.616 bits (540), Expect = 1.658e-63
Identity = 135/392 (34.44%), Postives = 205/392 (52.30%), Query Frame = 1
Query:  343 SSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILD------PSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL---------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            SSRIL D+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ S  G      C +DKTHRNQCRACRL+KC++  MNK+AVQHERGPR+ST+RK+VA+YF    H  ++      P S LP    F     ++   LE S ++                     ++ + +   +  GTP   +Y +      E +AR LF ++ W KS+     LP     +LLE  W +LF+L   +  +P +  +L+        ++   +   ++ +   L + +++   + L ++E   LK I+           +L++  N     A+QD     ++       PT   +      LL  +  + P+ I ++FF+KTIG +P+  L+SDM
Sbjct:   19 SSRIL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYLCKSGSQGG------CPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFR--GHKEVNGSSTHFPGSSLPGPPFFTTVTQLEPHNLEMSSVATTPERQAIVGL----------AQPTPKYPHEVSGTPM-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLPLSDQLILLEDAWRELFVLGIAQWAIPVDSTTLLAVSGLNSENMEAQRMNKIMTEIQALQEVVTRFRQMRLDATEFACLKCIVTFKAVPTQGSAELRAFRNASAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSVSPSTIEEVFFKKTIGNVPITRLLSDM 390          
BLAST of nuclear receptor TLX-1 vs. Ensembl Medaka
Match: nr2e1 (nuclear receptor subfamily 2 group E member 1 [Source:NCBI gene;Acc:100049530])

HSP 1 Score: 156.762 bits (395), Expect = 9.921e-43
Identity = 118/393 (30.03%), Postives = 183/393 (46.56%), Query Frame = 1
Query:  340 NSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILD------PSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQ----LPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSK---LSLGSSEINILKQIIFL---------DLKSL-NKKLEVAVQDACMDHVSRLCQLFDPTN--KIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
             SSRIL D+PCKVC D SSGKHYG+YACDGC+GFFKRSIR +R Y+CK+ S                           C DS     AVQHERGPR+ST+RK+VA+YF    H  ++      P S LP    F     ++   LE S ++                     ++ + +   +  GTP   +Y +      E +AR LF ++ W KS+     LP     +LLE  W +LF+L   +  +P +  +L+        ++   +   ++ +   L + +++   + L ++E   LK I+           +L++  N     A+QD     ++       PT   +      LL  +  + P+ I ++FF+KTIG +P+  L+SDM
Sbjct:   18 KSSRIL-DIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYLCKSVS-------------------------SVCPDS----TAVQHERGPRTSTIRKQVALYFR--GHKEVNGSSTHFPGSSLPGPPFFTTVTQLEPHNLEMSSVATTPERQAIVGL----------AQPTPKYPHEVSGTPM-YLYEVATESVCESAARLLFMSIKWAKSVPAFSTLPLSDQLILLEDAWRELFVLGIAQWAIPVDSTTLLAVSGLNSENMEAQRMNKIMTEIQALQEVVTRFRQMRLDATEFACLKCIVTFKAVPTQGSAELRAFRNASAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSVSPSTIEEVFFKKTIGNVPITRLLSDM 367          
BLAST of nuclear receptor TLX-1 vs. Ensembl Medaka
Match: nr2e3 (photoreceptor-specific nuclear receptor [Source:NCBI gene;Acc:101164305])

HSP 1 Score: 154.066 bits (388), Expect = 8.289e-42
Identity = 121/377 (32.10%), Postives = 182/377 (48.28%), Query Frame = 1
Query:  361 DVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSL----QLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLH------QHLSKLSLGSSEINILKQIIFL--DLKSLNKKLEVA-VQDACMDHVSRLCQLFDPTNKIAIEACLLM--NIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            DV CKVC D SSGKHYGIYAC+GC+GFFKRS+R   +Y C+       +  G C +DK HRNQC+ACRL+KC+ SGMNK+AVQ+ER PRS+        + +  S N+      L  T+   + ++       F +++       +      +    D + N  E  D   G   ++I    ES + E SAR LF +V W K+L     LP     +LLE +WS++FLL   +  +P +   L+      +  LS  +Q  +    + L            L++  +E   LK I+    + +SL    +V  +QD     + +      P         LL+  ++  +    I +LFFQ+TIG  P+  L+ DM 
Sbjct:   25 DVLCKVCSDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQ-------AGTGRCPVDKAHRNQCQACRLKKCLQSGMNKDAVQNERQPRSTA-------HVSLESLNVEAKKEHLATTRDNPSISH------RF-MVNLLTAETCAKLEPEDVEENIDVTSNDPERHDALEGHAFNSI----ESVY-ETSARLLFMSVKWTKNLPIFAHLPFRDQVILLEESWSEMFLLCVIQWSLPMDSCPLL-----SLPELSPKQQAKVSPPTSDLQILEEVFNRFKALTVDPTEFACLKAIVLFKPEARSLKDPEQVENLQDQSQVLLGQHIYSAYPNQSTRFGRMLLLLPSLHFVSSAKIGQLFFQRTIGNTPMEKLLCDMF 370          
BLAST of nuclear receptor TLX-1 vs. Ensembl Medaka
Match: nr2e3 (photoreceptor-specific nuclear receptor [Source:NCBI gene;Acc:101164305])

HSP 1 Score: 152.14 bits (383), Expect = 9.540e-41
Identity = 124/393 (31.55%), Postives = 183/393 (46.56%), Query Frame = 1
Query:  361 DVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSST--------VRKKVAMYFNELSHNILDPSSML---PFTKSFNNANNVKEELLEFS-----LIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSL----QLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLH------QHLSKLSLGSSEINILKQIIFL--DLKSLNKKLEVA-VQDACMDHVSRLCQLFDPTNKIAIEACLLM--NIICIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            DV CKVC D SSGKHYGIYAC+GC+GFFKRS+R   +Y C+       +  G C +DK HRNQC+ACRL+KC+ SGMNK+AVQ+ER PRS+         V  K          +  DP S     P   S  + ++  +     S     +++       +      +    D + N  E  D   G   ++I    ES + E SAR LF +V W K+L     LP     +LLE +WS++FLL   +  +P +   L+      +  LS  +Q  +    + L            L++  +E   LK I+    + +SL    +V  +QD     + +      P         LL+  ++  +    I +LFFQ+TIG  P+  L+ DM 
Sbjct:   38 DVLCKVCSDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQ-------AGTGRCPVDKAHRNQCQACRLKKCLQSGMNKDAVQNERQPRSTAHVSLESLNVEAKKEHLATTREFSTSDPYSSAICRPLVTSSASNSSTTQPCSNPSISHRFMVNLLTAETCAKLEPEDVEENIDVTSNDPERHDALEGHAFNSI----ESVY-ETSARLLFMSVKWTKNLPIFAHLPFRDQVILLEESWSEMFLLCVIQWSLPMDSCPLL-----SLPELSPKQQAKVSPPTSDLQILEEVFNRFKALTVDPTEFACLKAIVLFKPEARSLKDPEQVENLQDQSQVLLGQHIYSAYPNQSTRFGRMLLLLPSLHFVSSAKIGQLFFQRTIGNTPMEKLLCDMF 413          
BLAST of nuclear receptor TLX-1 vs. Ensembl Medaka
Match: NR2F6 (nuclear receptor subfamily 2 group F member 6 [Source:NCBI gene;Acc:101171737])

HSP 1 Score: 141.739 bits (356), Expect = 5.157e-37
Identity = 111/380 (29.21%), Postives = 170/380 (44.74%), Query Frame = 1
Query:  364 VPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNI--LDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSL----QLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQH---LSKLSLGSSEINILKQIIFLD-----------LKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDM 1443
            V C VC D SSGKHYG++ C+GC  FFKRSIR +  Y C++           C+ID+ HRNQC+ CRL+KC   GM KEAVQ  R P S +      +  N LS  +    PS M      + N   V  EL+   L +    ++               S  S+   D                   EL+AR LF+T+ W +++    +LP      LL  +WS+LF+L A ++ +P +   L+       S +S  + +  ++Q  V       L++L + S+E + LK I               ++SL +K +VA+ +       RL Q      +       L  +  +  + I +LFF + +G+ P+  LI DM
Sbjct:   51 VDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYSCRSNR--------DCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPPSHS-----GISPNSLSGGVGGTGPSHM---GADYFNGQQVS-ELISQLLRAEPYPSSRYGAPYAQAQMQASASGTSVMGIDS----------------ICELAARLLFSTIEWARNIPYFPELPVSEQVALLRLSWSELFILNAAQSALPLHMAPLLAAAGFHSSPMSAERVVSFMDQVRVFQDQVDKLNRLQVDSAEYSCLKAIALFSPDACGLTDPAHVESLQEKAQVALTE-----YERL-QYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDM 391          
BLAST of nuclear receptor TLX-1 vs. Planmine SMEST
Match: SMESG000027543.1 (SMESG000027543.1)

HSP 1 Score: 776.933 bits (2005), Expect = 0.000e+0
Identity = 398/400 (99.50%), Postives = 399/400 (99.75%), Query Frame = 1
Query:  250 IIVMVDNNSSLDLSEDHWDSHDTSFMSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQLPKEIVSVLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSKLSLGSSEINILKQIIFLDLKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMIA 1449
            IIVMVDNNSSLDLSEDHWDSHDTSFMSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILD SSMLPFTKSFNNANNVKEELLEFSLISAAKLNNFSNKNSFSISSLCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQLPKEIVSVLLEGNWSQLF+LTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSKLSLGSSEINILKQIIFLDLKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMIA
Sbjct:   11 IIVMVDNNSSLDLSEDHWDSHDTSFMSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDSSSMLPFTKSFNNANNVKEELLEFSLISAAKLNNFSNKNSFSISSLCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQLPKEIVSVLLEGNWSQLFILTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSKLSLGSSEINILKQIIFLDLKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAIEACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMIA 410          
BLAST of nuclear receptor TLX-1 vs. Planmine SMEST
Match: SMESG000056421.1 (SMESG000056421.1)

HSP 1 Score: 132.494 bits (332), Expect = 3.289e-33
Identity = 112/381 (29.40%), Postives = 178/381 (46.72%), Query Frame = 1
Query:  361 DVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPR-SSTVRKKVA-----MYFNELSHNILDPSSMLPFTKSFNNANNVKEELLEFSLIXXXXXXXXXXXXXXXXXXXCDNSENSIETFDDCIGTPKSTIYFLQESYFSELSARSLFNTVHWIKSLQ-LPKEIVS---VLLEGNWSQLFLLTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLH---QHLSKLSLGSSEINILKQIIFL--DLKSLNKKLEVA-VQDACMDHVSRLCQLFDPTNKIAIEACLLMNII---CIDPNFIHKLFFQKTIGQIPVLNLISDMI 1446
            ++ C VC D SSGKHYG Y C+GC  FFKRS+R +  Y C+            C ID  HRNQC+ CR QKC+  GM KEAVQ  R P+ SS   + +A      YFN     ++   SML            K+E + F            N    + S++CD              T     YF  +S + +++++ L   + W KS+   P   ++    LL+ +WS+LFLLT+  +  P +   L+  +  QV+ +   K + L++   ++    + L K  + S+E + LK ++    D++ L+  + V  +Q+   + +    +   P N+I     LL+ I     I+ + I +L F + IG   V NLI + I
Sbjct:  109 NIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNH--------NCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQQGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSML-----------SKQEKIGF-----------MNHLFSNHSNICD--------------TTSEEKYFGIDSIY-DIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAPLLASVGLQVNPVGAEKVVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEYEKFHYP-NQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKEYI 443          
BLAST of nuclear receptor TLX-1 vs. Planmine SMEST
Match: SMESG000078919.1 (SMESG000078919.1)

HSP 1 Score: 118.627 bits (296), Expect = 3.053e-28
Identity = 55/97 (56.70%), Postives = 70/97 (72.16%), Query Frame = 1
Query:  346 SRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSST 636
            S +L  + C VC D SSGKHYGI AC+GC+GFFKRS+R   +Y C+       +  G C IDK HRNQC+ACRL+KC+  GMNK+AVQ+ER PR+S+
Sbjct:  110 SSMLHGLCCVVCGDVSSGKHYGILACNGCSGFFKRSVRRKLIYRCQ-------AGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 199          
BLAST of nuclear receptor TLX-1 vs. Planmine SMEST
Match: SMESG000078919.1 (SMESG000078919.1)

HSP 1 Score: 118.627 bits (296), Expect = 3.121e-28
Identity = 55/97 (56.70%), Postives = 70/97 (72.16%), Query Frame = 1
Query:  346 SRILLDVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRSST 636
            S +L  + C VC D SSGKHYGI AC+GC+GFFKRS+R   +Y C+       +  G C IDK HRNQC+ACRL+KC+  GMNK+AVQ+ER PR+S+
Sbjct:  109 SSMLHGLCCVVCGDVSSGKHYGILACNGCSGFFKRSVRRKLIYRCQ-------AGTGRCTIDKAHRNQCQACRLKKCLLMGMNKDAVQNERQPRNSS 198          
BLAST of nuclear receptor TLX-1 vs. Planmine SMEST
Match: SMESG000076268.1 (SMESG000076268.1)

HSP 1 Score: 114.39 bits (285), Expect = 4.799e-27
Identity = 47/90 (52.22%), Postives = 62/90 (68.89%), Query Frame = 1
Query:  361 DVPCKVCQDHSSGKHYGIYACDGCAGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVDSGMNKEAVQHERGPRS 630
            D  C+VC D +SGKHYG+ +CDGC GFFKRS+R +  Y+CK  +        +C +D   RNQC+ACR +KC+   MN++AVQHER PRS
Sbjct:   31 DAVCRVCGDRASGKHYGVLSCDGCRGFFKRSVRRNLEYVCKESN--------VCPVDVARRNQCQACRFKKCLSVKMNRDAVQHERAPRS 112          
The following BLAST results are available for this feature:
BLAST of nuclear receptor TLX-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NR2E11.213e-6334.67nuclear receptor subfamily 2 group E member 1 [Sou... [more]
NR2E11.909e-6134.79nuclear receptor subfamily 2 group E member 1 [Sou... [more]
NR2E32.303e-4031.59nuclear receptor subfamily 2 group E member 3 [Sou... [more]
NR2E38.173e-3632.57nuclear receptor subfamily 2 group E member 3 [Sou... [more]
NR2F18.030e-2624.20nuclear receptor subfamily 2 group F member 1 [Sou... [more]
back to top
BLAST of nuclear receptor TLX-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhr-671.108e-4769.81Nuclear hormone receptor family member nhr-67 [So... [more]
fax-11.247e-3041.62Nuclear hormone receptor FAX-1 [Source:UniProtKB/... [more]
fax-16.220e-3046.67Nuclear hormone receptor FAX-1 [Source:UniProtKB/... [more]
nhr-2365.563e-2556.63Nuclear Hormone Receptor family [Source:UniProtKB... [more]
nhr-621.116e-2344.86Nuclear hormone receptor family member nhr-62 [So... [more]
back to top
BLAST of nuclear receptor TLX-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tll2.326e-5437.80gene:FBgn0003720 transcript:FBtr0085709[more]
dsf8.232e-3862.86gene:FBgn0015381 transcript:FBtr0333245[more]
dsf8.232e-3862.86gene:FBgn0015381 transcript:FBtr0079145[more]
svp2.137e-3026.05gene:FBgn0003651 transcript:FBtr0082564[more]
svp2.174e-3026.05gene:FBgn0003651 transcript:FBtr0331183[more]
back to top
BLAST of nuclear receptor TLX-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr2e16.571e-6434.52nuclear receptor subfamily 2, group E, member 1 [S... [more]
nr2e31.833e-3729.49nuclear receptor subfamily 2, group E, member 3 [S... [more]
nr2e31.981e-3729.49nuclear receptor subfamily 2, group E, member 3 [S... [more]
nr2f6b2.524e-3427.78nuclear receptor subfamily 2, group F, member 6b [... [more]
nr2f6b2.524e-3427.78nuclear receptor subfamily 2, group F, member 6b [... [more]
back to top
BLAST of nuclear receptor TLX-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NR2E13.424e-6335.43nuclear receptor subfamily 2 group E member 1 [Sou... [more]
NR2E15.195e-6134.79nuclear receptor subfamily 2 group E member 1 [Sou... [more]
NR2E11.039e-6034.78nuclear receptor subfamily 2 group E member 1 [Sou... [more]
nr2e36.743e-4330.77nuclear receptor subfamily 2 group E member 3 [Sou... [more]
nr2e31.242e-4230.77nuclear receptor subfamily 2 group E member 3 [Sou... [more]
back to top
BLAST of nuclear receptor TLX-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nr2e11.029e-6334.75nuclear receptor subfamily 2, group E, member 1 [S... [more]
Nr2e39.401e-4131.56nuclear receptor subfamily 2, group E, member 3 [S... [more]
Nr2f63.844e-3025.06nuclear receptor subfamily 2, group F, member 6 [S... [more]
Nr2f11.311e-2524.74nuclear receptor subfamily 2, group F, member 1 [S... [more]
Hnf4a1.698e-2345.71hepatic nuclear factor 4, alpha [Source:MGI Symbol... [more]
back to top
BLAST of nuclear receptor TLX-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91379|NR2E1_CHICK4.200e-6334.42Nuclear receptor subfamily 2 group E member 1 OS=G... [more]
sp|Q9Y466|NR2E1_HUMAN5.827e-6334.67Nuclear receptor subfamily 2 group E member 1 OS=H... [more]
sp|Q64104|NR2E1_MOUSE7.198e-6334.75Nuclear receptor subfamily 2 group E member 1 OS=M... [more]
sp|Q9YGL3|NR2E1_ORYLA7.461e-6234.18Nuclear receptor subfamily 2 group E member 1 OS=O... [more]
sp|P70052|NR2E1_XENLA1.474e-6035.32Nuclear receptor subfamily 2 group E member 1 OS=X... [more]
back to top
BLAST of nuclear receptor TLX-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H6WCS90.000e+098.92Nuclear receptor TLX-1 OS=Schmidtea mediterranea O... [more]
A0A1S3K5591.785e-6939.29nuclear receptor subfamily 2 group E member 1 OS=L... [more]
K1RMW81.184e-6537.35Nuclear receptor subfamily 2 group E member 1 OS=C... [more]
E9FSF92.848e-6537.04Tailless-like protein (Fragment) OS=Daphnia pulex ... [more]
A0A3Q3AI944.725e-6535.75Nuclear receptor subfamily 2, group E, member 1 OS... [more]
back to top
BLAST of nuclear receptor TLX-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr2e15.184e-6334.01nuclear receptor subfamily 2 group E member 1 [Sou... [more]
nr2f6b5.277e-3528.04nuclear receptor subfamily 2 group F member 6 [Sou... [more]
nr2f51.057e-3326.84nuclear receptor subfamily 2 group F member 5 [Sou... [more]
nr2e32.448e-3247.69nuclear receptor subfamily 2 group E member 3 [Sou... [more]
nr2f1a8.271e-2624.10nuclear receptor subfamily 2 group F member 1 [Sou... [more]
back to top
BLAST of nuclear receptor TLX-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr2e37.060e-3433.87nuclear receptor subfamily 2, group E, member 3 [S... [more]
hnf4g2.687e-2050.55hepatocyte nuclear factor 4, gamma [Source:ZFIN;Ac... [more]
rorb1.123e-1845.88RAR-related orphan receptor B [Source:ZFIN;Acc:ZDB... [more]
ENSPMAT00000006803.12.139e-1847.06pep scaffold:Pmarinus_7.0:GL479639:153667:156574:-... [more]
ESR22.812e-1839.62estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3... [more]
back to top
BLAST of nuclear receptor TLX-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear receptor TLX-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO383233.942e-5332.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327154.258e-3928.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429364.293e-3828.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383227.785e-3128.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389952.294e-2449.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of nuclear receptor TLX-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr2e11.658e-6334.44nuclear receptor subfamily 2 group E member 1 [Sou... [more]
nr2e19.921e-4330.03nuclear receptor subfamily 2 group E member 1 [Sou... [more]
nr2e38.289e-4232.10photoreceptor-specific nuclear receptor [Source:NC... [more]
nr2e39.540e-4131.55photoreceptor-specific nuclear receptor [Source:NC... [more]
NR2F65.157e-3729.21nuclear receptor subfamily 2 group F member 6 [Sou... [more]
back to top
BLAST of nuclear receptor TLX-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027543.10.000e+099.50SMESG000027543.1[more]
SMESG000056421.13.289e-3329.40SMESG000056421.1[more]
SMESG000078919.13.053e-2856.70SMESG000078919.1[more]
SMESG000078919.13.121e-2856.70SMESG000078919.1[more]
SMESG000076268.14.799e-2752.22SMESG000076268.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012299
GenBankAEZ56119.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012299 ID=SMED30012299|Name=nuclear receptor TLX-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1518bp
ATTAACATCAACACATTTGGAGTCGTGCGAATGTCTCGTGGTGTGCTGGA
GGTGTCAGGAGTACATTGAAAAATCGGCAAAGTAAACATCGGTCATCAAT
TACGATCTCAGACATAACCCAATAGGATCCAGATGTGCCAGTTCATCAAG
CAGCACCTACACATTGACACCGGACGGTTGCTAGCTGAACTTTTCTCTCA
ATGCCATTGGCCGGTTGACACTAAAAGCGAGATTAACAGCATCCAATTAA
TCATTGTGATGGTTGACAATAACAGTTCTCTTGATTTGTCAGAAGATCAT
TGGGATTCACATGATACCAGTTTCATGAGCAATACCGGAAATTCAAGCCG
AATCCTTTTGGACGTACCTTGCAAGGTGTGTCAAGACCATTCATCGGGGA
AACATTACGGAATTTACGCCTGTGATGGATGCGCCGGATTTTTCAAGAGA
TCTATCCGACACAGCCGACTGTATATTTGCAAGAACAAATCCATCAAAGG
AGATAGTTGGATAGGAATCTGCAAAATTGACAAAACCCATAGAAACCAGT
GCCGTGCCTGCCGTCTTCAGAAATGTGTTGACTCAGGAATGAACAAGGAA
GCTGTACAGCATGAAAGAGGTCCTAGAAGTTCAACAGTACGAAAGAAGGT
TGCAATGTATTTCAACGAGTTATCTCACAACATTCTTGATCCGAGTTCAA
TGCTGCCTTTTACGAAATCATTCAACAACGCCAATAACGTCAAAGAGGAG
CTTCTGGAGTTTTCGTTGATTTCAGCTGCTAAACTAAATAATTTTTCAAA
CAAGAATTCATTTTCTATATCATCACTCTGTGATAACAGTGAGAATTCAA
TCGAAACCTTTGACGATTGCATTGGGACACCCAAATCAACAATTTACTTT
CTTCAAGAGTCGTATTTCTCAGAATTGTCTGCTCGATCTCTGTTTAACAC
TGTACACTGGATCAAGTCACTCCAACTTCCTAAAGAGATCGTGTCGGTGC
TGCTGGAAGGTAATTGGTCCCAGCTATTTCTTCTAACTGCATTTGAAACT
AAAGTTCCATTTAACGATAGGTCCTTGATGTACAGGATATGTGATCAAGT
TAGTTCATTGTCTACAATGAAACAACTTGACCTCATCAACCAATGTGCTG
TTTTACATCAGCATCTTTCCAAACTTTCCCTTGGATCAAGTGAAATAAAT
ATTCTCAAACAAATCATTTTTCTCGACCTGAAATCATTAAATAAAAAATT
AGAAGTTGCGGTCCAGGACGCGTGCATGGATCATGTCAGCAGACTTTGTC
AGTTGTTCGACCCGACCAACAAAATAGCGATTGAAGCCTGTTTACTGATG
AATATCATTTGCATTGATCCAAACTTCATTCATAAATTGTTCTTTCAGAA
AACGATCGGCCAGATCCCGGTGCTCAACCTAATATCGGATATGATTGCCT
AAAATGAGAGAGATGTGTGAAAATTTATGTAAAATTTATAATGATATTGA
TGAGAATATTATTGAGTG
back to top

protein sequence of SMED30012299-orf-1

>SMED30012299-orf-1 ID=SMED30012299-orf-1|Name=SMED30012299-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=440bp
MCQFIKQHLHIDTGRLLAELFSQCHWPVDTKSEINSIQLIIVMVDNNSSL
DLSEDHWDSHDTSFMSNTGNSSRILLDVPCKVCQDHSSGKHYGIYACDGC
AGFFKRSIRHSRLYICKNKSIKGDSWIGICKIDKTHRNQCRACRLQKCVD
SGMNKEAVQHERGPRSSTVRKKVAMYFNELSHNILDPSSMLPFTKSFNNA
NNVKEELLEFSLISAAKLNNFSNKNSFSISSLCDNSENSIETFDDCIGTP
KSTIYFLQESYFSELSARSLFNTVHWIKSLQLPKEIVSVLLEGNWSQLFL
LTAFETKVPFNDRSLMYRICDQVSSLSTMKQLDLINQCAVLHQHLSKLSL
GSSEINILKQIIFLDLKSLNKKLEVAVQDACMDHVSRLCQLFDPTNKIAI
EACLLMNIICIDPNFIHKLFFQKTIGQIPVLNLISDMIA*
back to top
Aliases
The feature 'nuclear receptor TLX-1' has the following synonyms
Synonym
TLX-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003707steroid hormone receptor activity
GO:0008270zinc ion binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0005515protein binding
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035500NHR-like_dom_sf
IPR001628Znf_hrmn_rcpt
IPR000536Nucl_hrmn_rcpt_lig-bd
IPR013088Znf_NHR/GATA
IPR000253FHA_dom
Vocabulary: biological process
TermDefinition
GO:0043401steroid hormone mediated signaling pathway
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001628Zinc finger, nuclear hormone receptor-typePRINTSPR00047STROIDFINGERcoord: 80..96
score: 48.8
coord: 96..111
score: 50.13
coord: 145..153
score: 54.72
coord: 137..145
score: 60.8
IPR001628Zinc finger, nuclear hormone receptor-typeSMARTSM00399c4goldcoord: 77..156
e-value: 2.5E-31
score: 120.1
IPR001628Zinc finger, nuclear hormone receptor-typePFAMPF00105zf-C4coord: 79..155
e-value: 1.6E-25
score: 89.4
IPR001628Zinc finger, nuclear hormone receptor-typePROSITEPS00031NUCLEAR_REC_DBD_1coord: 80..106
IPR001628Zinc finger, nuclear hormone receptor-typePROSITEPS51030NUCLEAR_REC_DBD_2coord: 77..160
score: 18.889
IPR035500Nuclear hormone receptor-like domain superfamilyGENE3DG3DSA:1.10.565.10coord: 221..439
e-value: 1.0E-19
score: 72.6
IPR035500Nuclear hormone receptor-like domain superfamilySUPERFAMILYSSF48508Nuclear receptor ligand-binding domaincoord: 257..438
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 71..184
e-value: 1.5E-32
score: 113.8
NoneNo IPR availablePANTHERPTHR24083NUCLEAR HORMONE RECEPTORcoord: 79..438
NoneNo IPR availablePANTHERPTHR24083:SF98NUCLEAR RECEPTOR SUBFAMILY 2 GROUP E MEMBER 1coord: 79..438
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 77..169