SPT16

Overview
NameSPT16 (AFL48193.1)
Smed IDSMED30012293
Length (bp)3361
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SPT16 (SMED30012293) t-SNE clustered cells

Violin plots show distribution of expression levels for SPT16 (SMED30012293) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SPT16 (SMED30012293) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SPT16 (SMED30012293) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012293

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30012293SMESG000033905.1 JX070080smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30012293SMESG000033905.1 JX070080smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymaSMED30012293SMESG000033905.1 JX070080smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30012293SMESG000033905.1 SmedASXL_016968SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012293SMESG000033905.1 SmedASXL_016968SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30012293SMESG000033905.1 dd_Smed_v4_2595_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012293SMESG000033905.1 dd_Smed_v4_2595_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012293SMESG000033905.1 dd_Smed_v4_2595_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012293SMESG000033905.1 dd_Smed_v4_2595_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012293SMESG000033905.1 Contig3934uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012293SMESG000033905.1 Contig3934newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30012293SMESG000033905.1 dd_Smed_v6_2595_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30012293SMESG000033905.1 dd_Smed_v4_2595_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SPT16 vs. Ensembl Human
Match: SUPT16H (SPT16 homolog, facilitates chromatin remodeling subunit [Source:HGNC Symbol;Acc:HGNC:11465])

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 387/938 (41.26%), Postives = 577/938 (61.51%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEK------EVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVEK---FAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTI--IDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            A+ +  D +++R  RL S W   E      DA+++  G D  + Y+K+ ++  WLFGY L ++  +    K+   ASKK   FLK   +++          I++L + K E +K +  K ++ I+   + K +G   KD F G+F +     L    FD +D+SA ++   AVK++ EL  +KKA+  T+++FNK  KE ++  VD  +K++HS L+   +K +E+    A  D  ++++CYPPIIQSGG +NLKFSV SD+N++H G I C+MG+R++ YCSN++RTLM++ + E +E Y +++       L++++ G +  +V  A+       KP+L   +  + GF  G+EF++  LV+   +Q   KK MV    +G  +L NK       K YA++IGDT++V            E G   +LTS+ K+     +F LK+E  E+   +     D  GRG R     + T+ + T E KR+ HQ EL  ++ E+ ++RL   K      K +K+ +SYK+   +PK+  I    ++IDK+  TV++   G  +PFH++ IKN S + EGD +YLR NF   G + LG+    I  N E  ++KE+T + SN+K         L L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN I++ KK+  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S LV  TEWPPFVVT+DEVELI FERV    K+FDM+IV+KDY++K   I ++P   LD IK WL+  D+ ++EG +SLNW KIMK I DDP+ F E+GGW+ L
Sbjct:    2 AVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQENYNFLLQLQEE-LLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVD-----------EDGPATVLTSVKKKVKNVGIF-LKNEDEEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKELAAQLNEEAKRRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPG-SALGRNEGNIFPNPEATFVKEITYRASNIKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFL 925          
BLAST of SPT16 vs. Ensembl Celegans
Match: spt-16 (FACT complex subunit spt-16 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5R9])

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 368/945 (38.94%), Postives = 549/945 (58.10%), Query Frame = 1
Query:    1 MSDKALAISYDTFFKRF-RLLSKWLNN----ERADALLIVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPA----MSSEKEVEISVLEKSKTEDDKENAIKFVKYIENITSIKS-LGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLS------AKTDKFVEKFAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHA--GVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSL-ITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTIIDENTEDIYLKELTIKTSNMKLSNS-AVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            MS K   ++ D FF+R  RL   W       +   +L  V G  +  Y+KT ++  WLFG+ + ++  ++    ++I  S +   F         SS K   +S L + KT+ D  N   F K I++I S    +G+  K+ F  +F       L++   +  DV+ + ++LFAVKD+ E++ I+K+++ T   +    +   +  +D+ K+++HS LS       K  K  +  AK +    D CY PI+ SGG ++ K++ ES E++LH+  G I+ S G R   YC+N+ RT++I  ++E +  YE I+    +  +  ++PG +  +V K      +   P L ++L     GF+TG+EF++  L ++     V K  MV I YIG+ ++ NK   +K  K  AI I DTI+V            E G N ILT  AK R K N+ + K+E     A K   +    GRGQR       T+   TNE  RK  Q EL  ++ E  + RL       D  K KK+ +SYK+    P+D  +    +F+D++  +V++   G   PFH+S+IKN S + EGD +YLR NF   G      +    +    Y+KELT + SN+K  +S +      LS  F+  KE QKR+KT E + +E    V QD ++++  K  PKLKDL IRP + ++RI+G+LE H NG R+++++G+ ID+++NNIKHAF+QPCD EMI+L+HFHLKNP+++ KKK  D+QFYTEVGE+TTDLGK++HM DRDD++SEQ+E+EMR+++N AF  FC KV  ++N++ +FD PF  LGF G P RS   L+P+ SCLV LTEWP F+VT+ EVEL+ FERV+L  K+FDM+ +FKDY  KP  +  +P   +D IK WL   DI++SEG +SLNW K+MK ITDD + F EEGGW+ L
Sbjct:    1 MSGKRAVLNKDLFFQRAERLYEHWEKGADGLDSIKSLAFVYGETDNPYTKTSALFTWLFGHEIADTVLLLLKDHIYILGSNRKVEFFGSVTGDNQSSGKVPTVSTLLRDKTDKDAGN---FEKLIDHIKSAGGDVGNFVKEKFSSEFVSSWNKALEEGGVNKNDVTLAFTHLFAVKDDKEMDLIRKSAQATTASWTA-ARARYVEIIDQEKRVRHSVLSNEFAAFMKDSKVQQALAKYEA---DTCYDPIVMSGGNYSFKWNHESSESHLHSQFGTIITSFGARLSEYCTNLTRTMLIFPSSELETAYEAIL-AAELAVIAALKPGAKLSDVYKIGIDTLTEKSPKLAETLNKKELGFATGIEFRESRLAISAKCDEVVKAGMVFIVYIGVDSIPNKNKGEK-GKPAAIAISDTILVK-----------EEGDNEILTEKAKSRLKSNVIKFKEEQENREAEKDNDQKKMLGRGQRSVVLTDQTRNKTTNEELRKERQKELGVQLNELAKARLSKQGGGTDEKKSKKSNVSYKTEERFPQDADVQKMLIFVDRKYDSVVVPIFGIPVPFHISMIKNCSQSVEGDFTYLRINFATPGSQVGKDSGQFPHPLAHYMKELTFRASNIKDHHSDSTAPSHNLSTAFRLIKEMQKRFKTEEAEEREKEGAVKQDKLILSQNKLNPKLKDLLIRPNIIQKRITGSLEAHTNGFRYTSLRGDRIDVLYNNIKHAFFQPCDNEMIILLHFHLKNPVLWGKKKYKDVQFYTEVGEITTDLGKYHHMQDRDDMQSEQQEREMRRRLNAAFNSFCEKVSRLTNDQFEFDSPFAGLGFFGVPYRSATTLKPTASCLVNLTEWPTFIVTLSEVELVHFERVSLQLKNFDMVFIFKDYKIKPQMVAQIPMSSIDKIKEWLHTCDIWYSEGIQSLNWAKVMKTITDDLEAFFEEGGWSFL 925          
BLAST of SPT16 vs. Ensembl Fly
Match: dre4 (gene:FBgn0002183 transcript:FBtr0072865)

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 390/949 (41.10%), Postives = 577/949 (60.80%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKW----LNNERA----DALL-IVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPA--MSSEKEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFV--EKFAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLF----------QLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETN-EAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKT--IIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            +  +  + F +R  RL ++W    + ++ A    D ++ IV   +++ YSK+M++  WL GY L ++  +     ++   SKK   FLK    ++ E   EI++L + +T+ D+ N  K +K ++N    K LG   KD + G+F E  K  L   KF+ +D+S  I+ L   KDE E+  I+KAS  +  IFNK LK+ I++ +D  +K+KH+ LS   +  +  +K+  G D   LD+ YPPIIQSGG ++LKFS  +D+N LH GVIVCS+G RY+ YCSN+ RT ++N     +E Y ++V  +    L+ + PG +  +V +        +KP +  +L  SFGF+ G+EF++  +V+    Q++ KKNMV   ++G+ NL N   TDK  K YA++IGDT++VG           E     ++T   K+     +F            K    ED  ++ L      GR  +RNA  +    +E N E KRK HQ EL Q++ E  + RL     S +  K +KN +SYKS   +P++  +    +++DK+  TV++   G   PFH+S IKN S + EG+ +YLR NF   G  T+G+    +    E  ++KE+T ++SN+K           L+N F+  KE QKR+KT E + +E  DLV QDT++++  K  PKLKDL+IRP +  +R++G+LE H NG R+ +++G+ +DI++NNIK AF+QPCD EMI+L+HFHLK  I++ KKK +D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+E+R K+  AF  FC KVE ++   V+FD PFR+LGF G P RSTV LQP++  LV LTEWPPFV+T+D+VEL+ FERV    ++FDMI VFK+YN+K   + ++P + LD +K WL+  DI +SEG +SLNW KIMK ITDDP+ F E+GGW  L
Sbjct:    3 SFVLDKEAFVRRVKRLYTEWRAPSIGHDDALRNLDCIMSIVGVEEDVMYSKSMALQLWLLGYELTDTISVFCSDAVYFLTSKKKIEFLKQTQNITEEGFPEINLLVRDRTDKDQGNFEKLIKALQNSKKGKRLGVFAKDAYPGEFSEAWKKSLTASKFEHVDISTIIAYLMCPKDESEINNIRKASLVSMDIFNKYLKDEIMDIIDSDRKVKHNKLSDGCEAAIGEKKYTSGLDPRLLDMAYPPIIQSGGAYSLKFSAVADKNPLHFGVIVCSLGARYKSYCSNISRTFLVNPTEAMQENYTFLVS-VQEEILKLLVPGTKLCDVYEKTLDFVKKEKPSMVDNLPKSFGFAMGLEFRENSIVIGPKCQALLKKNMVFNLHVGISNLTNPEATDKEGKNYALFIGDTVLVG-----------EQSPASVMTPSKKKIKNVGIFIKDDSDEEDVDDKKTAKEDQGTEIL------GRS-KRNAVLESKLRNEINTEEKRKEHQRELAQQLNERAKDRLARQGNSKEVEKVRKNTVSYKSISQMPREPEVKELKLYVDKKYETVIMPVFGIQVPFHISTIKNISQSVEGEYTYLRINFFHPG-ATMGRNEGGLYPQPEATFVKEVTYRSSNVKEHGEVGAPSANLNNAFRLIKEVQKRFKTREAEEREKEDLVKQDTLILSQNKGNPKLKDLYIRPNIVTKRMTGSLEAHSNGFRYISVRGDKVDILYNNIKSAFFQPCDGEMIILLHFHLKYAIMFGKKKHVDVQFYTEVGEITTDLGKHQHMHDRDDLAAEQAERELRHKLKTAFKSFCEKVETMTKSVVEFDTPFRELGFPGAPFRSTVTLQPTSGSLVNLTEWPPFVITLDDVELVHFERVQFHLRNFDMIFVFKEYNKKVAMVNAIPMNMLDHVKEWLNSCDIRYSEGVQSLNWQKIMKTITDDPEGFFEQGGWTFL 931          
BLAST of SPT16 vs. Ensembl Fly
Match: dre4 (gene:FBgn0002183 transcript:FBtr0072864)

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 390/949 (41.10%), Postives = 577/949 (60.80%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKW----LNNERA----DALL-IVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPA--MSSEKEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFV--EKFAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLF----------QLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETN-EAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKT--IIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            +  +  + F +R  RL ++W    + ++ A    D ++ IV   +++ YSK+M++  WL GY L ++  +     ++   SKK   FLK    ++ E   EI++L + +T+ D+ N  K +K ++N    K LG   KD + G+F E  K  L   KF+ +D+S  I+ L   KDE E+  I+KAS  +  IFNK LK+ I++ +D  +K+KH+ LS   +  +  +K+  G D   LD+ YPPIIQSGG ++LKFS  +D+N LH GVIVCS+G RY+ YCSN+ RT ++N     +E Y ++V  +    L+ + PG +  +V +        +KP +  +L  SFGF+ G+EF++  +V+    Q++ KKNMV   ++G+ NL N   TDK  K YA++IGDT++VG           E     ++T   K+     +F            K    ED  ++ L      GR  +RNA  +    +E N E KRK HQ EL Q++ E  + RL     S +  K +KN +SYKS   +P++  +    +++DK+  TV++   G   PFH+S IKN S + EG+ +YLR NF   G  T+G+    +    E  ++KE+T ++SN+K           L+N F+  KE QKR+KT E + +E  DLV QDT++++  K  PKLKDL+IRP +  +R++G+LE H NG R+ +++G+ +DI++NNIK AF+QPCD EMI+L+HFHLK  I++ KKK +D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+E+R K+  AF  FC KVE ++   V+FD PFR+LGF G P RSTV LQP++  LV LTEWPPFV+T+D+VEL+ FERV    ++FDMI VFK+YN+K   + ++P + LD +K WL+  DI +SEG +SLNW KIMK ITDDP+ F E+GGW  L
Sbjct:    3 SFVLDKEAFVRRVKRLYTEWRAPSIGHDDALRNLDCIMSIVGVEEDVMYSKSMALQLWLLGYELTDTISVFCSDAVYFLTSKKKIEFLKQTQNITEEGFPEINLLVRDRTDKDQGNFEKLIKALQNSKKGKRLGVFAKDAYPGEFSEAWKKSLTASKFEHVDISTIIAYLMCPKDESEINNIRKASLVSMDIFNKYLKDEIMDIIDSDRKVKHNKLSDGCEAAIGEKKYTSGLDPRLLDMAYPPIIQSGGAYSLKFSAVADKNPLHFGVIVCSLGARYKSYCSNISRTFLVNPTEAMQENYTFLVS-VQEEILKLLVPGTKLCDVYEKTLDFVKKEKPSMVDNLPKSFGFAMGLEFRENSIVIGPKCQALLKKNMVFNLHVGISNLTNPEATDKEGKNYALFIGDTVLVG-----------EQSPASVMTPSKKKIKNVGIFIKDDSDEEDVDDKKTAKEDQGTEIL------GRS-KRNAVLESKLRNEINTEEKRKEHQRELAQQLNERAKDRLARQGNSKEVEKVRKNTVSYKSISQMPREPEVKELKLYVDKKYETVIMPVFGIQVPFHISTIKNISQSVEGEYTYLRINFFHPG-ATMGRNEGGLYPQPEATFVKEVTYRSSNVKEHGEVGAPSANLNNAFRLIKEVQKRFKTREAEEREKEDLVKQDTLILSQNKGNPKLKDLYIRPNIVTKRMTGSLEAHSNGFRYISVRGDKVDILYNNIKSAFFQPCDGEMIILLHFHLKYAIMFGKKKHVDVQFYTEVGEITTDLGKHQHMHDRDDLAAEQAERELRHKLKTAFKSFCEKVETMTKSVVEFDTPFRELGFPGAPFRSTVTLQPTSGSLVNLTEWPPFVITLDDVELVHFERVQFHLRNFDMIFVFKEYNKKVAMVNAIPMNMLDHVKEWLNSCDIRYSEGVQSLNWQKIMKTITDDPEGFFEQGGWTFL 931          
BLAST of SPT16 vs. Ensembl Zebrafish
Match: supt16h (SPT16 homolog, facilitates chromatin remodeling subunit [Source:ZFIN;Acc:ZDB-GENE-031118-96])

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 381/939 (40.58%), Postives = 580/939 (61.77%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKP-AMSSEKE-----VEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVE--KFAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNAT-AQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGK--TIIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            A+++  D F++R  RL   W   E    + DA+++  G D  + Y+K+ ++  WLFGY L ++  +    K+   ASKK   FLK  A++   E       I++L + K E +K N  K ++ I      K++G   KD F G++ +     +       +D+S  ++   AVK++ EL  +KKA+  T  +F+K  KE ++  VD  +K+KHS L+   +K +E  KF  G D  ++++CYPPIIQSGG ++LKFSV SD+N++H G I C+MG+RY+ YCSN++RTLM++ + E ++ Y +++ ++    L++++ G +  E   A+ +    +KPDL   L  + GF+ G+EF++  LV+   +Q   K+ MV    +G  ++ NK    +  K YA++IGDTI +            E     +LT + K+     +F LK++  ++   +     +  G+G R  A  A  T+ + T E KR+ HQ EL  ++ E+ ++RL   K      K +K+ +SYK+   +PK+  I +  +FIDK++ TV++   G  +PFH++ IKN S + EGD +YLR NF   G ++LG+    I  N E  ++KE+T + SN+K           L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN I++ KK+  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S L  +TEWPPFVVT+DEVEL+ FERV    K+FD++IV+KDYN+K   I ++P + LD IK WL+  DI ++EG +SLNW KIMK I DDP+ F E+GGW+ L
Sbjct:    2 AVSLDKDAFYRRIKRLYGNWKKGEDEFGKVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCESKIIFLASKKKVEFLKQVAVTKGNENANGVPPITLLVREKNESNKVNFDKMIEAIRGSKEGKTVGVFIKDKFPGEYMKSWSDTITAEGLQKVDISTVVAYTMAVKEDGELALMKKAASITTDVFSKFFKERVMEIVDADEKVKHSRLAESVEKAIEDRKFLGGVDPSTVEMCYPPIIQSGGNYSLKFSVVSDKNHMHFGAITCAMGIRYKSYCSNLVRTLMVDPSQEMQDNYNFLL-QVEEELLKEMKHGVKLSEAYNAVMEFVKKEKPDLVSKLTKNLGFAMGIEFREGSLVINQKNQFKLKRGMVFSISLGFADMINKEGKKEEQKKYALFIGDTIQIN-----------EEDQATVLTPVKKKIKNVGIF-LKNDDEDEDEEEGDNAEELLGKGARSAALLADRTRNEMTAEEKRRTHQKELANQVNEEAKRRLTEQKGGQQIQKVRKSNVSYKNVSQMPKEKDIRDMKIFIDKKHETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFFVPG-SSLGRHEGNIFPNPEATFVKEITYRASNLKSPGDHSVPSTNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHTNGFRFTSVRGDKVDILYNNIKHAIFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKSAFKNFIEKVESLTKEELEFEVPFRDLGFQGAPYRSTCLLQPTSSSLCNVTEWPPFVVTLDEVELVHFERVQFHLKNFDVVIVYKDYNKKVTMINAVPVNSLDPIKEWLNSCDIKYTEGIQSLNWTKIMKTIVDDPEGFFEQGGWSFL 926          
BLAST of SPT16 vs. Ensembl Zebrafish
Match: supt16h (SPT16 homolog, facilitates chromatin remodeling subunit [Source:ZFIN;Acc:ZDB-GENE-031118-96])

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 381/939 (40.58%), Postives = 580/939 (61.77%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKP-AMSSEKE-----VEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVE--KFAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNAT-AQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGK--TIIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            A+++  D F++R  RL   W   E    + DA+++  G D  + Y+K+ ++  WLFGY L ++  +    K+   ASKK   FLK  A++   E       I++L + K E +K N  K ++ I      K++G   KD F G++ +     +       +D+S  ++   AVK++ EL  +KKA+  T  +F+K  KE ++  VD  +K+KHS L+   +K +E  KF  G D  ++++CYPPIIQSGG ++LKFSV SD+N++H G I C+MG+RY+ YCSN++RTLM++ + E ++ Y +++ ++    L++++ G +  E   A+ +    +KPDL   L  + GF+ G+EF++  LV+   +Q   K+ MV    +G  ++ NK    +  K YA++IGDTI +            E     +LT + K+     +F LK++  ++   +     +  G+G R  A  A  T+ + T E KR+ HQ EL  ++ E+ ++RL   K      K +K+ +SYK+   +PK+  I +  +FIDK++ TV++   G  +PFH++ IKN S + EGD +YLR NF   G ++LG+    I  N E  ++KE+T + SN+K           L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN I++ KK+  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S L  +TEWPPFVVT+DEVEL+ FERV    K+FD++IV+KDYN+K   I ++P + LD IK WL+  DI ++EG +SLNW KIMK I DDP+ F E+GGW+ L
Sbjct:    2 AVSLDKDAFYRRIKRLYGNWKKGEDEFGKVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCESKIIFLASKKKVEFLKQVAVTKGNENANGVPPITLLVREKNESNKVNFDKMIEAIRGSKEGKTVGVFIKDKFPGEYMKSWSDTITAEGLQKVDISTVVAYTMAVKEDGELALMKKAASITTDVFSKFFKERVMEIVDADEKVKHSRLAESVEKAIEDRKFLGGVDPSTVEMCYPPIIQSGGNYSLKFSVVSDKNHMHFGAITCAMGIRYKSYCSNLVRTLMVDPSQEMQDNYNFLL-QVEEELLKEMKHGVKLSEAYNAVMEFVKKEKPDLVSKLTKNLGFAMGIEFREGSLVINQKNQFKLKRGMVFSISLGFADMINKEGKKEEQKKYALFIGDTIQIN-----------EEDQATVLTPVKKKIKNVGIF-LKNDDEDEDEEEGDNAEELLGKGARSAALLADRTRNEMTAEEKRRTHQKELANQVNEEAKRRLTEQKGGQQIQKVRKSNVSYKNVSQMPKEKDIRDMKIFIDKKHETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFFVPG-SSLGRHEGNIFPNPEATFVKEITYRASNLKSPGDHSVPSTNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHTNGFRFTSVRGDKVDILYNNIKHAIFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKSAFKNFIEKVESLTKEELEFEVPFRDLGFQGAPYRSTCLLQPTSSSLCNVTEWPPFVVTLDEVELVHFERVQFHLKNFDVVIVYKDYNKKVTMINAVPVNSLDPIKEWLNSCDIKYTEGIQSLNWTKIMKTIVDDPEGFFEQGGWSFL 926          
BLAST of SPT16 vs. Ensembl Zebrafish
Match: supt16h (SPT16 homolog, facilitates chromatin remodeling subunit [Source:ZFIN;Acc:ZDB-GENE-031118-96])

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 381/939 (40.58%), Postives = 580/939 (61.77%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKP-AMSSEKE-----VEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVE--KFAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNAT-AQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGK--TIIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            A+++  D F++R  RL   W   E    + DA+++  G D  + Y+K+ ++  WLFGY L ++  +    K+   ASKK   FLK  A++   E       I++L + K E +K N  K ++ I      K++G   KD F G++ +     +       +D+S  ++   AVK++ EL  +KKA+  T  +F+K  KE ++  VD  +K+KHS L+   +K +E  KF  G D  ++++CYPPIIQSGG ++LKFSV SD+N++H G I C+MG+RY+ YCSN++RTLM++ + E ++ Y +++ ++    L++++ G +  E   A+ +    +KPDL   L  + GF+ G+EF++  LV+   +Q   K+ MV    +G  ++ NK    +  K YA++IGDTI +            E     +LT + K+     +F LK++  ++   +     +  G+G R  A  A  T+ + T E KR+ HQ EL  ++ E+ ++RL   K      K +K+ +SYK+   +PK+  I +  +FIDK++ TV++   G  +PFH++ IKN S + EGD +YLR NF   G ++LG+    I  N E  ++KE+T + SN+K           L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN I++ KK+  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S L  +TEWPPFVVT+DEVEL+ FERV    K+FD++IV+KDYN+K   I ++P + LD IK WL+  DI ++EG +SLNW KIMK I DDP+ F E+GGW+ L
Sbjct:    2 AVSLDKDAFYRRIKRLYGNWKKGEDEFGKVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCESKIIFLASKKKVEFLKQVAVTKGNENANGVPPITLLVREKNESNKVNFDKMIEAIRGSKEGKTVGVFIKDKFPGEYMKSWSDTITAEGLQKVDISTVVAYTMAVKEDGELALMKKAASITTDVFSKFFKERVMEIVDADEKVKHSRLAESVEKAIEDRKFLGGVDPSTVEMCYPPIIQSGGNYSLKFSVVSDKNHMHFGAITCAMGIRYKSYCSNLVRTLMVDPSQEMQDNYNFLL-QVEEELLKEMKHGVKLSEAYNAVMEFVKKEKPDLVSKLTKNLGFAMGIEFREGSLVINQKNQFKLKRGMVFSISLGFADMINKEGKKEEQKKYALFIGDTIQIN-----------EEDQATVLTPVKKKIKNVGIF-LKNDDEDEDEEEGDNAEELLGKGARSAALLADRTRNEMTAEEKRRTHQKELANQVNEEAKRRLTEQKGGQQIQKVRKSNVSYKNVSQMPKEKDIRDMKIFIDKKHETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFFVPG-SSLGRHEGNIFPNPEATFVKEITYRASNLKSPGDHSVPSTNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHTNGFRFTSVRGDKVDILYNNIKHAIFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKSAFKNFIEKVESLTKEELEFEVPFRDLGFQGAPYRSTCLLQPTSSSLCNVTEWPPFVVTLDEVELVHFERVQFHLKNFDVVIVYKDYNKKVTMINAVPVNSLDPIKEWLNSCDIKYTEGIQSLNWTKIMKTIVDDPEGFFEQGGWSFL 926          
BLAST of SPT16 vs. Ensembl Xenopus
Match: slc35f4 (solute carrier family 35 member F4 [Source:Xenbase;Acc:XB-GENE-983757])

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 382/941 (40.60%), Postives = 568/941 (60.36%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSE--------KEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVE--KFAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNAT-AQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTI--IDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            A+ +  + +++R  R    W   E      DA+++  G D  + Y+K+ ++  WLFGY L ++  +   +K+   ASKK   FLK   +++          + + V EK + E +K N  K ++ I+     K +G   KD F G + +     L    FD +D+SAS++   AVK++ EL  +KKA+  T+ +F+K  K+ ++  VD  +K++HS L+   +K +E  K+  G D  ++++CYPPIIQSGG +NLKFSV SD+N++H G I C+MG+RY+ YCSN++RTLM++   E ++ Y +++        E    G +  +    I  +    KPDL   +  + GF+ G+EF++  LV+   +Q   KK MV   ++GL  L NK       K YA+++GDT++V            E G   +LT + K+     +F LK E  E+         D  GRG R  A   + T+ + T E KR+ HQ EL  ++ ++ ++RL   K      K +K+ +SYK+   +PK+  I    ++IDK+  TV++   G  +PFH++ IKN S + EGD +YLR NF   G + LG+    I  N E  ++KE+T + SN+K         L L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN I++ KK+  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S LV  TEWPPFVVT+DEVEL+ FERV    K+FDM+IV+K+Y +K   I ++P   LD IK WL+  DI ++EG +SLNW KIMK I DDP+ F E+GGW+ L
Sbjct:    2 AVTLDKEAYYRRIKRFYGNWKKGEDEFANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCEEKIIFMASKKKVEFLKQIANTKGNENANGTPAITLLVREK-QNEANKANFEKVIEAIKGSKKGKYIGVFIKDKFPGDYMKSWYDTLNKEGFDKVDISASLAYTIAVKEDGELNLMKKAATITSDVFSKFFKDRVMEIVDADEKVRHSKLAESVEKAIEDKKYLGGTDPSTIEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRYKSYCSNLVRTLMVDPTQEMQDNYNFLLQLQEELLKELKH-GAKICDAYHIIMDQVKKQKPDLLSKITKNLGFAMGIEFREGSLVINNKNQYKLKKGMVFSVHLGLSELNNKAGKKPEEKTYALFVGDTVLVN-----------EEGAATVLTHVKKKVKNVGIF-LKKEDDEEEEEDKDEAQDILGRGARSAALLTERTRNEMTAEEKRRTHQKELATQLNDEAKRRLTEQKGEQQTLKARKSNVSYKNASQMPKESEIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFFCPG-SALGRNEGNIFPNPEATFVKEITYRASNVKTPGDPSVPSLNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHAIFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQLEREMRHKLKTAFKNFIEKVESLTKEDLEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNTTEWPPFVVTLDEVELVHFERVQFHLKNFDMVIVYKEYGKKVTMINAIPVASLDPIKEWLNSCDIKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFL 927          
BLAST of SPT16 vs. Ensembl Xenopus
Match: slc35f4 (solute carrier family 35 member F4 [Source:Xenbase;Acc:XB-GENE-983757])

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 379/940 (40.32%), Postives = 566/940 (60.21%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKE------VEISVLEKSK-TEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVE--KFAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNAT-AQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTI--IDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            A+ +  + +++R  R    W   E      DA+++  G D  + Y+K+ ++  WLFGY L ++  +   +K+   ASKK   FLK   +++          I++L + K  E +K N  K ++ I+     K +G   KD F G + +     L    FD +D+SAS++   AVK++ EL  +KKA+  T+ +F+K  K+ ++  VD  +K++HS L+   +K +E  K+  G D  ++++CYPPIIQSGG +NLKFSV SD+N++H G I C+MG+RY+ YCSN++RTLM++   E ++ Y +++        E    G +  +    I  +    KPDL   +  + GF+ G+EF++  LV+   +Q   KK MV   ++GL  L NK       K YA+++GDT++V                N ++TSL+           ++E  +D A       D  GRG R  A   + T+ + T E KR+ HQ EL  ++ ++ ++RL   K      K +K+ +SYK+   +PK+  I    ++IDK+  TV++   G  +PFH++ IKN S + EGD +YLR NF   G + LG+    I  N E  ++KE+T + SN+K         L L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN I++ KK+  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S LV  TEWPPFVVT+DEVEL+ FERV    K+FDM+IV+K+Y +K   I ++P   LD IK WL+  DI ++EG +SLNW KIMK I DDP+ F E+GGW+ L
Sbjct:   68 AVTLDKEAYYRRIKRFYGNWKKGEDEFANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCEEKIIFMASKKKVEFLKQIANTKGNENANGTPAITLLVREKQNEANKANFEKVIEAIKGSKKGKYIGVFIKDKFPGDYMKSWYDTLNKEGFDKVDISASLAYTIAVKEDGELNLMKKAATITSDVFSKFFKDRVMEIVDADEKVRHSKLAESVEKAIEDKKYLGGTDPSTIEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRYKSYCSNLVRTLMVDPTQEMQDNYNFLLQLQEELLKELKH-GAKICDAYHIIMDQVKKQKPDLLSKITKNLGFAMGIEFREGSLVINNKNQYKLKKGMVFSVHLGLSELNNKAGKKPEEKTYALFVGDTVLV----------------NEVMTSLSVITGIYKEDDEEEEEDKDEAQ------DILGRGARSAALLTERTRNEMTAEEKRRTHQKELATQLNDEAKRRLTEQKGEQQTLKARKSNVSYKNASQMPKESEIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFFCPG-SALGRNEGNIFPNPEATFVKEITYRASNVKTPGDPSVPSLNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHAIFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQLEREMRHKLKTAFKNFIEKVESLTKEDLEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNTTEWPPFVVTLDEVELVHFERVQFHLKNFDMVIVYKEYGKKVTMINAIPVASLDPIKEWLNSCDIKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFL 983          
BLAST of SPT16 vs. Ensembl Xenopus
Match: slc35f4 (solute carrier family 35 member F4 [Source:Xenbase;Acc:XB-GENE-983757])

HSP 1 Score: 693.73 bits (1789), Expect = 0.000e+0
Identity = 379/940 (40.32%), Postives = 566/940 (60.21%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKE------VEISVLEKSK-TEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVE--KFAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNAT-AQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTI--IDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            A+ +  + +++R  R    W   E      DA+++  G D  + Y+K+ ++  WLFGY L ++  +   +K+   ASKK   FLK   +++          I++L + K  E +K N  K ++ I+     K +G   KD F G + +     L    FD +D+SAS++   AVK++ EL  +KKA+  T+ +F+K  K+ ++  VD  +K++HS L+   +K +E  K+  G D  ++++CYPPIIQSGG +NLKFSV SD+N++H G I C+MG+RY+ YCSN++RTLM++   E ++ Y +++        E    G +  +    I  +    KPDL   +  + GF+ G+EF++  LV+   +Q   KK MV   ++GL  L NK       K YA+++GDT++V                N ++TSL+           ++E  +D A       D  GRG R  A   + T+ + T E KR+ HQ EL  ++ ++ ++RL   K      K +K+ +SYK+   +PK+  I    ++IDK+  TV++   G  +PFH++ IKN S + EGD +YLR NF   G + LG+    I  N E  ++KE+T + SN+K         L L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN I++ KK+  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S LV  TEWPPFVVT+DEVEL+ FERV    K+FDM+IV+K+Y +K   I ++P   LD IK WL+  DI ++EG +SLNW KIMK I DDP+ F E+GGW+ L
Sbjct:    2 AVTLDKEAYYRRIKRFYGNWKKGEDEFANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCEEKIIFMASKKKVEFLKQIANTKGNENANGTPAITLLVREKQNEANKANFEKVIEAIKGSKKGKYIGVFIKDKFPGDYMKSWYDTLNKEGFDKVDISASLAYTIAVKEDGELNLMKKAATITSDVFSKFFKDRVMEIVDADEKVRHSKLAESVEKAIEDKKYLGGTDPSTIEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRYKSYCSNLVRTLMVDPTQEMQDNYNFLLQLQEELLKELKH-GAKICDAYHIIMDQVKKQKPDLLSKITKNLGFAMGIEFREGSLVINNKNQYKLKKGMVFSVHLGLSELNNKAGKKPEEKTYALFVGDTVLV----------------NEVMTSLSVITGIYKEDDEEEEEDKDEAQ------DILGRGARSAALLTERTRNEMTAEEKRRTHQKELATQLNDEAKRRLTEQKGEQQTLKARKSNVSYKNASQMPKESEIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFFCPG-SALGRNEGNIFPNPEATFVKEITYRASNVKTPGDPSVPSLNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHAIFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQLEREMRHKLKTAFKNFIEKVESLTKEDLEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNTTEWPPFVVTLDEVELVHFERVQFHLKNFDMVIVYKEYGKKVTMINAIPVASLDPIKEWLNSCDIKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFL 917          
BLAST of SPT16 vs. Ensembl Xenopus
Match: slc35f4 (solute carrier family 35 member F4 [Source:Xenbase;Acc:XB-GENE-983757])

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 373/912 (40.90%), Postives = 553/912 (60.64%), Query Frame = 1
Query:   85 ADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSE--------KEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVE--KFAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNAT-AQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTI--IDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
             DA+++  G D  + Y+K+ ++  WLFGY L ++  +   +K+   ASKK   FLK   +++          + + V EK + E +K N  K ++ I+     K +G   KD F G + +     L    FD +D+SAS++   AVK++ EL  +KKA+  T+ +F+K  K+ ++  VD  +K++HS L+   +K +E  K+  G D  ++++CYPPIIQSGG +NLKFSV SD+N++H G I C+MG+RY+ YCSN++RTLM++   E ++ Y +++        E    G +  +    I  +    KPDL   +  + GF+ G+EF++  LV+   +Q   KK MV   ++GL  L NK       K YA+++GDT++V                N ++TSL+          +  E  E+         D  GRG R  A   + T+ + T E KR+ HQ EL  ++ ++ ++RL   K      K +K+ +SYK+   +PK+  I    ++IDK+  TV++   G  +PFH++ IKN S + EGD +YLR NF   G + LG+    I  N E  ++KE+T + SN+K         L L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN I++ KK+  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S LV  TEWPPFVVT+DEVEL+ FERV    K+FDM+IV+K+Y +K   I ++P   LD IK WL+  DI ++EG +SLNW KIMK I DDP+ F E+GGW+ L
Sbjct:   31 VDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCEEKIIFMASKKKVEFLKQIANTKGNENANGTPAITLLVREK-QNEANKANFEKVIEAIKGSKKGKYIGVFIKDKFPGDYMKSWYDTLNKEGFDKVDISASLAYTIAVKEDGELNLMKKAATITSDVFSKFFKDRVMEIVDADEKVRHSKLAESVEKAIEDKKYLGGTDPSTIEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRYKSYCSNLVRTLMVDPTQEMQDNYNFLLQLQEELLKELKH-GAKICDAYHIIMDQVKKQKPDLLSKITKNLGFAMGIEFREGSLVINNKNQYKLKKGMVFSVHLGLSELNNKAGKKPEEKTYALFVGDTVLV----------------NEVMTSLS---------YICFEDDEEEEEDKDEAQDILGRGARSAALLTERTRNEMTAEEKRRTHQKELATQLNDEAKRRLTEQKGEQQTLKARKSNVSYKNASQMPKESEIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFFCPG-SALGRNEGNIFPNPEATFVKEITYRASNVKTPGDPSVPSLNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHAIFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQLEREMRHKLKTAFKNFIEKVESLTKEDLEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNTTEWPPFVVTLDEVELVHFERVQFHLKNFDMVIVYKEYGKKVTMINAIPVASLDPIKEWLNSCDIKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFL 914          
BLAST of SPT16 vs. Ensembl Xenopus
Match: slc35f4 (solute carrier family 35 member F4 [Source:Xenbase;Acc:XB-GENE-983757])

HSP 1 Score: 91.6633 bits (226), Expect = 1.126e-19
Identity = 66/226 (29.20%), Postives = 117/226 (51.77%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSE--------KEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFV 648
            A+ +  + +++R  R    W   E      DA+++  G D  + Y+K+ ++  WLFGY L ++  +   +K+   ASKK   FLK   +++          + + V EK + E +K N  K ++ I+     K +G   KD F G + +     L    FD +D+SAS++   AVK++ EL  +KKA+  T+ +F+K  K+ ++  VD  +K++HS L+   +K V
Sbjct:    2 AVTLDKEAYYRRIKRFYGNWKKGEDEFANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCEEKIIFMASKKKVEFLKQIANTKGNENANGTPAITLLVREK-QNEANKANFEKVIEAIKGSKKGKYIGVFIKDKFPGDYMKSWYDTLNKEGFDKVDISASLAYTIAVKEDGELNLMKKAATITSDVFSKFFKDRVMEIVDADEKVRHSKLAESVEKAV 226          
BLAST of SPT16 vs. Ensembl Mouse
Match: Supt16 (SPT16, facilitates chromatin remodeling subunit [Source:MGI Symbol;Acc:MGI:1890948])

HSP 1 Score: 722.235 bits (1863), Expect = 0.000e+0
Identity = 389/938 (41.47%), Postives = 575/938 (61.30%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEK------EVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVEK---FAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTI--IDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            A+ +  D +++R  RL S W   E      DA+++  G D  + Y+K+ ++  WLFGY L ++  +    K+   ASKK   FLK   +++          I++L + K E +K +  K +  I+   S K +G   KD F G+F +     L    FD +D+SA ++   AVK++ EL  +KKA+  T+++FNK  KE ++  VD  +K++HS L+   +K +E+    A  D  ++++CYPPIIQSGG +NLKFSV SD+N++H G I C+MG+R++ YCSN++RTLM++   E +E Y +++       L++++ G +  +V  ++       KP+L   +  + GF  G+EF++  LV+   +Q   KK MV    +G  +L NK       K YA++IGDT++V            E G   ILTS+ K+     +F LK+E  E+   +     D  GRG R     + T+ + T E KR+ HQ EL  ++ E+ ++RL   K      K +K+ +SYK+   +PK+  I    ++IDK+  TV++   G  +PFH++ IKN S + EGD +YLR NF   G + LG+    I  N E  ++KE+T + SNMK         L L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN I++ KK+  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S LV  TEWPPFVVT+DEVELI FERV    K+FDM+IV+KDY++K   I ++P   LD IK WL+  D+ ++EG +SLNW KIMK I DDP+ F E+GGW+ L
Sbjct:    2 AVTLDKDAYYRRVKRLYSNWRKGEDEYASIDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLVREKNESNKSSFDKMIDAIKESKSGKKIGVFSKDKFPGEFMKSWSDCLNKEGFDKVDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPTQEVQENYNFLLQLQEE-LLKELRHGVKICDVYNSVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVD-----------EDGPATILTSVKKKVKNVGIF-LKNEDDEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKELAAQLNEEAKRRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPG-SALGRNEGNIFPNPEATFVKEITYRASNMKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFL 925          
BLAST of SPT16 vs. UniProt/SwissProt
Match: sp|Q920B9|SP16H_MOUSE (FACT complex subunit SPT16 OS=Mus musculus OX=10090 GN=Supt16h PE=1 SV=2)

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 388/938 (41.36%), Postives = 575/938 (61.30%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEK------EVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVEK---FAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTI--IDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            A+ +  D +++R  RL S W   E      DA+++  G D  + Y+K+ ++  WLFGY L ++  +    K+   ASKK   FLK   +++          I++L + K E +K +  K +  I+   S K +G   KD F G+F +     L    FD +D+SA ++   AVK++ EL  +KKA+  T+++FNK  KE ++  VD  +K++HS L+   +K +E+    A  D  ++++CYPPIIQSGG +NLKFSV SD+N++H G I C+MG+R++ YCSN++RTLM++   E +E Y +++       L++++ G +  +V  ++       KP+L   +  + GF  G+EF++  LV+   +Q   KK MV    +G  +L NK       K YA++IGDT++V            E G   ILTS+ K+     +F LK+E  E+   +     D  GRG R     + T+ + T E KR+ HQ EL  ++ E+ ++RL   K      K +K+ +SYK+   +PK+  I    ++IDK+  TV++   G  +PFH++ IKN S + EGD +YLR NF   G + LG+    I  N E  ++KE+T + SNMK         L L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN +++ KK+  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S LV  TEWPPFVVT+DEVELI FERV    K+FDM+IV+KDY++K   I ++P   LD IK WL+  D+ ++EG +SLNW KIMK I DDP+ F E+GGW+ L
Sbjct:    2 AVTLDKDAYYRRVKRLYSNWRKGEDEYASIDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLVREKNESNKSSFDKMIDAIKESKSGKKIGVFSKDKFPGEFMKSWSDCLNKEGFDKVDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPTQEVQENYNFLLQLQEE-LLKELRHGVKICDVYNSVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVD-----------EDGPATILTSVKKKVKNVGIF-LKNEDDEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKELAAQLNEEAKRRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPG-SALGRNEGNIFPNPEATFVKEITYRASNMKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGEMIIVLHFHLKNAVMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFL 925          
BLAST of SPT16 vs. UniProt/SwissProt
Match: sp|Q9Y5B9|SP16H_HUMAN (FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1)

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 387/938 (41.26%), Postives = 577/938 (61.51%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEK------EVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVEK---FAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTI--IDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            A+ +  D +++R  RL S W   E      DA+++  G D  + Y+K+ ++  WLFGY L ++  +    K+   ASKK   FLK   +++          I++L + K E +K +  K ++ I+   + K +G   KD F G+F +     L    FD +D+SA ++   AVK++ EL  +KKA+  T+++FNK  KE ++  VD  +K++HS L+   +K +E+    A  D  ++++CYPPIIQSGG +NLKFSV SD+N++H G I C+MG+R++ YCSN++RTLM++ + E +E Y +++       L++++ G +  +V  A+       KP+L   +  + GF  G+EF++  LV+   +Q   KK MV    +G  +L NK       K YA++IGDT++V            E G   +LTS+ K+     +F LK+E  E+   +     D  GRG R     + T+ + T E KR+ HQ EL  ++ E+ ++RL   K      K +K+ +SYK+   +PK+  I    ++IDK+  TV++   G  +PFH++ IKN S + EGD +YLR NF   G + LG+    I  N E  ++KE+T + SN+K         L L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN I++ KK+  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S LV  TEWPPFVVT+DEVELI FERV    K+FDM+IV+KDY++K   I ++P   LD IK WL+  D+ ++EG +SLNW KIMK I DDP+ F E+GGW+ L
Sbjct:    2 AVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQENYNFLLQLQEE-LLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVD-----------EDGPATVLTSVKKKVKNVGIF-LKNEDEEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKELAAQLNEEAKRRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPG-SALGRNEGNIFPNPEATFVKEITYRASNIKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFL 925          
BLAST of SPT16 vs. UniProt/SwissProt
Match: sp|Q8IRG6|SPT16_DROME (FACT complex subunit spt16 OS=Drosophila melanogaster OX=7227 GN=dre4 PE=1 SV=2)

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 390/949 (41.10%), Postives = 577/949 (60.80%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKW----LNNERA----DALL-IVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPA--MSSEKEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFV--EKFAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLF----------QLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETN-EAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKT--IIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            +  +  + F +R  RL ++W    + ++ A    D ++ IV   +++ YSK+M++  WL GY L ++  +     ++   SKK   FLK    ++ E   EI++L + +T+ D+ N  K +K ++N    K LG   KD + G+F E  K  L   KF+ +D+S  I+ L   KDE E+  I+KAS  +  IFNK LK+ I++ +D  +K+KH+ LS   +  +  +K+  G D   LD+ YPPIIQSGG ++LKFS  +D+N LH GVIVCS+G RY+ YCSN+ RT ++N     +E Y ++V  +    L+ + PG +  +V +        +KP +  +L  SFGF+ G+EF++  +V+    Q++ KKNMV   ++G+ NL N   TDK  K YA++IGDT++VG           E     ++T   K+     +F            K    ED  ++ L      GR  +RNA  +    +E N E KRK HQ EL Q++ E  + RL     S +  K +KN +SYKS   +P++  +    +++DK+  TV++   G   PFH+S IKN S + EG+ +YLR NF   G  T+G+    +    E  ++KE+T ++SN+K           L+N F+  KE QKR+KT E + +E  DLV QDT++++  K  PKLKDL+IRP +  +R++G+LE H NG R+ +++G+ +DI++NNIK AF+QPCD EMI+L+HFHLK  I++ KKK +D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+E+R K+  AF  FC KVE ++   V+FD PFR+LGF G P RSTV LQP++  LV LTEWPPFV+T+D+VEL+ FERV    ++FDMI VFK+YN+K   + ++P + LD +K WL+  DI +SEG +SLNW KIMK ITDDP+ F E+GGW  L
Sbjct:    3 SFVLDKEAFVRRVKRLYTEWRAPSIGHDDALRNLDCIMSIVGVEEDVMYSKSMALQLWLLGYELTDTISVFCSDAVYFLTSKKKIEFLKQTQNITEEGFPEINLLVRDRTDKDQGNFEKLIKALQNSKKGKRLGVFAKDAYPGEFSEAWKKSLTASKFEHVDISTIIAYLMCPKDESEINNIRKASLVSMDIFNKYLKDEIMDIIDSDRKVKHNKLSDGCEAAIGEKKYTSGLDPRLLDMAYPPIIQSGGAYSLKFSAVADKNPLHFGVIVCSLGARYKSYCSNISRTFLVNPTEAMQENYTFLVS-VQEEILKLLVPGTKLCDVYEKTLDFVKKEKPSMVDNLPKSFGFAMGLEFRENSIVIGPKCQALLKKNMVFNLHVGISNLTNPEATDKEGKNYALFIGDTVLVG-----------EQSPASVMTPSKKKIKNVGIFIKDDSDEEDVDDKKTAKEDQGTEIL------GRS-KRNAVLESKLRNEINTEEKRKEHQRELAQQLNERAKDRLARQGNSKEVEKVRKNTVSYKSISQMPREPEVKELKLYVDKKYETVIMPVFGIQVPFHISTIKNISQSVEGEYTYLRINFFHPG-ATMGRNEGGLYPQPEATFVKEVTYRSSNVKEHGEVGAPSANLNNAFRLIKEVQKRFKTREAEEREKEDLVKQDTLILSQNKGNPKLKDLYIRPNIVTKRMTGSLEAHSNGFRYISVRGDKVDILYNNIKSAFFQPCDGEMIILLHFHLKYAIMFGKKKHVDVQFYTEVGEITTDLGKHQHMHDRDDLAAEQAERELRHKLKTAFKSFCEKVETMTKSVVEFDTPFRELGFPGAPFRSTVTLQPTSGSLVNLTEWPPFVITLDDVELVHFERVQFHLRNFDMIFVFKEYNKKVAMVNAIPMNMLDHVKEWLNSCDIRYSEGVQSLNWQKIMKTITDDPEGFFEQGGWTFL 931          
BLAST of SPT16 vs. UniProt/SwissProt
Match: sp|Q9W603|SP16H_XENLA (FACT complex subunit SPT16 OS=Xenopus laevis OX=8355 GN=supt16h PE=1 SV=2)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 380/940 (40.43%), Postives = 571/940 (60.74%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKE------VEISVLEKSK-TEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVE--KFAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNAT-AQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTI--IDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            A+ +  + +++R  R    W   +      DA+++  G D  + Y+K+ ++  WLFGY L ++  +   +K+   ASKK   FLK   +++          I++L + K  E +K N  K ++ I+     K +G   KD F G F +    +L    F+ +D+SAS++   AVK+E EL  +KKA+  T+ +F+K  K+ ++  VD  +K++H  L+   +K +E  K+  G D  ++++CYPPIIQSGG +NLKFSV SD+N++H G I C++G+RY+ YCSN++RTLM++   E +E Y +++        E    G +  +  + I  +    KPDL   +  + GF+ G+EF++  LV+   +Q   KK MV   ++GL  L NK       K YA+++GDT++V            E G   +LT++ K+     +F LK E  E+   +     D  GRG R  A   + T+ + T E KR+ HQ EL  ++ ++ ++RL   K      K +K+ +SYK+   +PK+  +    ++IDK+  TV++   G  +PFH++ IKN S + EGD +YLR NF   G + LG+    I  N E  ++KE+T + SN+K         L L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN I++ KK+  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S LV  TEWPPFVVT+DEVEL+ FERV    K+FDM+IV+K+Y +K   I ++P   LD IK WL+  DI ++EG +SLNW KIMK I DDP+ F E+GGW+ L
Sbjct:    2 AVTLDKEAYYRRIKRFFGSWKKGDDEFANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCEEKILFMASKKKVEFLKQIANTKGNENANGTPAITLLVREKQNESNKGNFDKMIEAIKVSKKGKRIGVFIKDKFPGDFMKSWYDILNKESFEKVDISASVAYTIAVKEEGELNLMKKAASITSDVFSKFFKDRVMEIVDADEKVRHGKLAESVEKAIEDKKYLGGTDPSTIEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCALGIRYKSYCSNLVRTLMVDPTQEMQENYNFLLQLQEELLKELKH-GAKICDAYQVIMDQVKKQKPDLMSKITKTLGFAMGIEFREGSLVINNKNQYKLKKGMVFSVHLGLAELNNKMGKKPEEKTYALFVGDTVLVN-----------EEGAATVLTNVKKKVKNVGIF-LKKEDEEEEEEEKDEAEDLLGRGSRAAALLTERTRNEMTAEEKRRTHQKELATQLNDEAKRRLTEQKGGQQTMKARKSNVSYKNASQVPKEPELREMKLYIDKKYETVIMPVFGISTPFHIATIKNISMSVEGDYTYLRINFFCPG-SALGRNEGNIFPNPEATFVKEITYRASNVKTPGDPSVPSLNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQLEREMRHKLKTAFKNFIEKVESLTKEDLEFEIPFRDLGFNGAPYRSTCLLQPTSSSLVNTTEWPPFVVTLDEVELVHFERVQFHLKNFDMVIVYKEYGKKVTMINAIPMASLDPIKEWLNSCDIKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFL 927          
BLAST of SPT16 vs. UniProt/SwissProt
Match: sp|Q9N5R9|SPT16_CAEEL (FACT complex subunit spt-16 OS=Caenorhabditis elegans OX=6239 GN=spt-16 PE=1 SV=1)

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 368/945 (38.94%), Postives = 549/945 (58.10%), Query Frame = 1
Query:    1 MSDKALAISYDTFFKRF-RLLSKWLNN----ERADALLIVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPA----MSSEKEVEISVLEKSKTEDDKENAIKFVKYIENITSIKS-LGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLS------AKTDKFVEKFAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHA--GVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSL-ITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTIIDENTEDIYLKELTIKTSNMKLSNS-AVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            MS K   ++ D FF+R  RL   W       +   +L  V G  +  Y+KT ++  WLFG+ + ++  ++    ++I  S +   F         SS K   +S L + KT+ D  N   F K I++I S    +G+  K+ F  +F       L++   +  DV+ + ++LFAVKD+ E++ I+K+++ T   +    +   +  +D+ K+++HS LS       K  K  +  AK +    D CY PI+ SGG ++ K++ ES E++LH+  G I+ S G R   YC+N+ RT++I  ++E +  YE I+    +  +  ++PG +  +V K      +   P L ++L     GF+TG+EF++  L ++     V K  MV I YIG+ ++ NK   +K  K  AI I DTI+V            E G N ILT  AK R K N+ + K+E     A K   +    GRGQR       T+   TNE  RK  Q EL  ++ E  + RL       D  K KK+ +SYK+    P+D  +    +F+D++  +V++   G   PFH+S+IKN S + EGD +YLR NF   G      +    +    Y+KELT + SN+K  +S +      LS  F+  KE QKR+KT E + +E    V QD ++++  K  PKLKDL IRP + ++RI+G+LE H NG R+++++G+ ID+++NNIKHAF+QPCD EMI+L+HFHLKNP+++ KKK  D+QFYTEVGE+TTDLGK++HM DRDD++SEQ+E+EMR+++N AF  FC KV  ++N++ +FD PF  LGF G P RS   L+P+ SCLV LTEWP F+VT+ EVEL+ FERV+L  K+FDM+ +FKDY  KP  +  +P   +D IK WL   DI++SEG +SLNW K+MK ITDD + F EEGGW+ L
Sbjct:    1 MSGKRAVLNKDLFFQRAERLYEHWEKGADGLDSIKSLAFVYGETDNPYTKTSALFTWLFGHEIADTVLLLLKDHIYILGSNRKVEFFGSVTGDNQSSGKVPTVSTLLRDKTDKDAGN---FEKLIDHIKSAGGDVGNFVKEKFSSEFVSSWNKALEEGGVNKNDVTLAFTHLFAVKDDKEMDLIRKSAQATTASWTA-ARARYVEIIDQEKRVRHSVLSNEFAAFMKDSKVQQALAKYEA---DTCYDPIVMSGGNYSFKWNHESSESHLHSQFGTIITSFGARLSEYCTNLTRTMLIFPSSELETAYEAIL-AAELAVIAALKPGAKLSDVYKIGIDTLTEKSPKLAETLNKKELGFATGIEFRESRLAISAKCDEVVKAGMVFIVYIGVDSIPNKNKGEK-GKPAAIAISDTILVK-----------EEGDNEILTEKAKSRLKSNVIKFKEEQENREAEKDNDQKKMLGRGQRSVVLTDQTRNKTTNEELRKERQKELGVQLNELAKARLSKQGGGTDEKKSKKSNVSYKTEERFPQDADVQKMLIFVDRKYDSVVVPIFGIPVPFHISMIKNCSQSVEGDFTYLRINFATPGSQVGKDSGQFPHPLAHYMKELTFRASNIKDHHSDSTAPSHNLSTAFRLIKEMQKRFKTEEAEEREKEGAVKQDKLILSQNKLNPKLKDLLIRPNIIQKRITGSLEAHTNGFRYTSLRGDRIDVLYNNIKHAFFQPCDNEMIILLHFHLKNPVLWGKKKYKDVQFYTEVGEITTDLGKYHHMQDRDDMQSEQQEREMRRRLNAAFNSFCEKVSRLTNDQFEFDSPFAGLGFFGVPYRSATTLKPTASCLVNLTEWPTFIVTLSEVELVHFERVSLQLKNFDMVFIFKDYKIKPQMVAQIPMSSIDKIKEWLHTCDIWYSEGIQSLNWAKVMKTITDDLEAFFEEGGWSFL 925          
BLAST of SPT16 vs. TrEMBL
Match: M9NN13 (SPT16 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1942.55 bits (5031), Expect = 0.000e+0
Identity = 1018/1021 (99.71%), Postives = 1018/1021 (99.71%), Query Frame = 1
Query:    1 MSDKALAISYDTFFKRFRLLSKWLNNERADALLIVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVEKFAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTIIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPLCGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGMDWDELEEEARKADMETEPEDPPRKKRKH 3063
            MSDKALAISYDTFFKRFRLLSKWLNNERADALLIVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGK IKHSDLSAKTDKFVEKFAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVL GNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILT LAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTIIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPLCGESDEESENEDMEEDEVYEPSDDGDEDGSDESADSEDAADSEFDEGDEEEESDSGEQGLDSDESKGMDWDELEEEARKADMETEPEDPPRKKRKH
Sbjct:    1 MSDKALAISYDTFFKRFRLLSKWLNNERADALLIVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGK-IKHSDLSAKTDKFVEKFAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLAGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTCLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTIIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPLCGESDEESENEDMEEDEVYEPSDDGDEDGSDESADSEDAADSEFDEGDEEEESDSGEQGLDSDESKGMDWDELEEEARKADMETEPEDPPRKKRKH 1020          
BLAST of SPT16 vs. TrEMBL
Match: A0A4S2LX70 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004388 PE=4 SV=1)

HSP 1 Score: 758.829 bits (1958), Expect = 0.000e+0
Identity = 406/948 (42.83%), Postives = 581/948 (61.29%), Query Frame = 1
Query:   52 RLLSKWLNNERA-----DALLIVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKE-VEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVEK--FAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEV-GGNLILTSLAKRRNKQNLFQL----------------------KDEPTEDIA-------SKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTIID-ENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGK-FNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNE-RVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWA 2769
            RL   W +N  +     DAL++  G  +  Y KT+S+H WLFGY L ++  +   K + I   KK  +FL+P      E  E+ ++ +++ ++DK    K +  I      + +GHL KD F  +  +  +  L    F+  DVS SIS+LFAVKDE+EL  +KKAS  T  IF+K LKE I+  +D  KK+KH  LS+     ++K     G D +SL++CY PIIQSGG FNLKFS+ESD  NLH G I+C++G+RY+ YCSNVIR+LM+N   +Q  +Y Y+ D L+ +A+  I+PG +  E  ++I+ K   ++P+L   L+ SFGF TG+EF+D   +LT  S  VF++ M + F IGLQN++N    + + K YA+W+GD  VVG A        +E  G N + T  AKRR K     +                      K     D A       S P  + +  GRG RR   AQ T+ ++T E KR   + ELF +++     RL G+KT      + K+ ++YK    +PK+D I    +F+DK+  TV+L   G  +PFH+S IKN S + E D +YLR NF+  G     K     +  E IY+KE+T + SN++    A      L+N  +  KE  KR+++ E + +E ADLV QD ++++  K   +LKDL+IRP ++ +RI+G L+ H NG RF++++G+ IDI++NNIKHAFYQPCD EMI+L+HFHLKN I+Y KKKQ DIQFYTEVGE+TTDL K  + M DRDDLE+EQ+E+EMR++I  AF  F +K E ++    ++F+ PFR LGF GCP+RSTV L P++S L+ +TE PPFVVT+DEVE I  ERV LS ++FDM+ VFKDY +KP  I S+P   L+ +K WL   D++++EG KSLNW K+MK+I D+P+ F+E+GGW+
Sbjct:   17 RLYKDWKSNPSSQLYEVDALVVPAGKFDSVYGKTLSLHTWLFGYELQDTVIVFCEKSVLILCGKKKLDFLQPLQKRNDENREVILIPRNQADNDKAGIEKLISAISTSRKGRVIGHLSKDKFSSELTKAFQSALISGSFELRDVSGSISDLFAVKDENELNILKKASAVTCNIFSKHLKEEIMEIIDYDKKVKHDKLSSGCHSALKKTNLLNGLDPDSLEMCYDPIIQSGGNFNLKFSIESDTQNLHFGTIICALGVRYQSYCSNVIRSLMVNPTEDQASVYAYLHD-LFDWAIAAIKPGVKIAEFCQSIQDKVQSERPELADCLVRSFGFVTGIEFRDSHQLLTSKSTGVFREGMTLNFNIGLQNVKNPKAENSKDKQYALWLGD--VVGVA--------VEADGSNTVFTLAAKRRPKSVSLYIRDEEDDEEDEHGEDNAAPEGSKKSSGKRDSALNGLEKRSIPNGDAELLGRGHRRTIIAQKTRSEQTAEEKRMSRRRELFDQLVTSSTNRLSGMKTDTGPDTKAKSTVAYKGAGQMPKEDDIRLLRLFVDKKYETVILPIFGLPTPFHISTIKNVSTSIEADYTYLRINFHHPGAIVGAKDASGFQTPEAIYVKEMTYRASNLRRHGEATIPATNLNNTCRIIKEVLKRFRSREAEERERADLVEQDQLIVDHAKGAFRLKDLYIRPNIATKRITGTLQTHTNGFRFTSIRGDQIDILYNNIKHAFYQPCDGEMIILLHFHLKNAIMYGKKKQQDIQFYTEVGELTTDLSKAHSRMQDRDDLEAEQREREMREQIKTAFRSFVDKAEALARRYNLEFETPFRDLGFYGCPHRSTVFLMPTSSALISVTELPPFVVTLDEVEFIMLERVTLSIRTFDMVFVFKDYTKKPAMINSIPSTALELVKEWLLSCDLYYAEGTKSLNWPKLMKSILDNPEGFIEDGGWS 953          
BLAST of SPT16 vs. TrEMBL
Match: A0A4S2M2X8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004388 PE=4 SV=1)

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 407/948 (42.93%), Postives = 581/948 (61.29%), Query Frame = 1
Query:   52 RLLSKWLNNERA-----DALLIVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKE-VEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVEK--FAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEV-GGNLILTSLAKRRNKQNLFQL----------------------KDEPTEDIA-------SKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTIIDENT-EDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGK-FNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNE-RVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWA 2769
            RL   W +N  +     DAL++  G  +  Y KT+S+H WLFGY L ++  +   K + I   KK  +FL+P      E  E+ ++ +++ ++DK    K +  I      + +GHL KD F  +  +  +  L    F+  DVS SIS+LFAVKDE+EL  +KKAS  T  IF+K LKE I+  +D  KK+KH  LS+     ++K     G D +SL++CY PIIQSGG FNLKFS+ESD  NLH G I+C++G+RY+ YCSNVIR+LM+N   +Q  +Y Y+ D L+ +A+  I+PG +  E  ++I+ K   ++P+L   L+ SFGF TG+EF+D   +LT  S  VF++ M + F IGLQN++N    + + K YA+W+GD  VVG A        +E  G N + T  AKRR K     +                      K     D A       S P  + +  GRG RR   AQ T+ ++T E KR   + ELF +++     RL G+KT      + K+ ++YK    +PK+D I    +F+DK+  TV+L   G  +PFH+S IKN S + E D +YLR NF+  G     K      T E IY+KE+T + SN++    A      L+N  +  KE  KR+++ E + +E ADLV QD ++++  K   +LKDL+IRP ++ +RI+G L+ H NG RF++++G+ IDI++NNIKHAFYQPCD EMI+L+HFHLKN I+Y KKKQ DIQFYTEVGE+TTDL K  + M DRDDLE+EQ+E+EMR++I  AF  F +K E ++    ++F+ PFR LGF GCP+RSTV L P++S L+ +TE PPFVVT+DEVE I  ERV LS ++FDM+ VFKDY +KP  I S+P   L+ +K WL   D++++EG KSLNW K+MK+I D+P+ F+E+GGW+
Sbjct:   17 RLYKDWKSNPSSQLYEVDALVVPAGKFDSVYGKTLSLHTWLFGYELQDTVIVFCEKSVLILCGKKKLDFLQPLQKRNDENREVILIPRNQADNDKAGIEKLISAISTSRKGRVIGHLSKDKFSSELTKAFQSALISGSFELRDVSGSISDLFAVKDENELNILKKASAVTCNIFSKHLKEEIMEIIDYDKKVKHDKLSSGCHSALKKTNLLNGLDPDSLEMCYDPIIQSGGNFNLKFSIESDTQNLHFGTIICALGVRYQSYCSNVIRSLMVNPTEDQASVYAYLHD-LFDWAIAAIKPGVKIAEFCQSIQDKVQSERPELADCLVRSFGFVTGIEFRDSHQLLTSKSTGVFREGMTLNFNIGLQNVKNPKAENSKDKQYALWLGD--VVGVA--------VEADGSNTVFTLAAKRRPKSVSLYIRDEEDDEEDEHGEDNAAPEGSKKSSGKRDSALNGLEKRSIPNGDAELLGRGHRRTIIAQKTRSEQTAEEKRMSRRRELFDQLVTSSTNRLSGMKTDTGPDTKAKSTVAYKGAGQMPKEDDIRLLRLFVDKKYETVILPIFGLPTPFHISTIKNVSTSIEADYTYLRINFHHPGAIVGAKDASGFQTPEAIYVKEMTYRASNLRRHGEATIPATNLNNTCRIIKEVLKRFRSREAEERERADLVEQDQLIVDHAKGAFRLKDLYIRPNIATKRITGTLQTHTNGFRFTSIRGDQIDILYNNIKHAFYQPCDGEMIILLHFHLKNAIMYGKKKQQDIQFYTEVGELTTDLSKAHSRMQDRDDLEAEQREREMREQIKTAFRSFVDKAEALARRYNLEFETPFRDLGFYGCPHRSTVFLMPTSSALISVTELPPFVVTLDEVEFIMLERVTLSIRTFDMVFVFKDYTKKPAMINSIPSTALELVKEWLLSCDLYYAEGTKSLNWPKLMKSILDNPEGFIEDGGWS 953          
BLAST of SPT16 vs. TrEMBL
Match: A0A0X3QEW9 (FACT complex subunit spt16 OS=Schistocephalus solidus OX=70667 GN=SPT16 PE=4 SV=1)

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 396/940 (42.13%), Postives = 582/940 (61.91%), Query Frame = 1
Query:   88 DALLIVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPA-MSSEKEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVEK--FAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLF---------------------------QLKDEPTEDIASKPLMEFDN----------YGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGK-TIIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGK-FNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNE-RVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            DA L+VNG  ++ YSKT+S+  WLFGY + ++A +     ++I +SKK   FLK    +S K++ +++L ++   +DK N  K ++   +    + LGH  K+ FE  F +     +K    + +D S   S +FAVKDE E++ ++KASE T  +F K LKE I++ +DE +K+ H  LS      ++     KG +M +L++CY PIIQSGG + LKFSVESD+  +H G I+CS+G+RY  YCSNV+RTL++N   +Q   YEY+ D L  +A+ Q+ PG  F ++  +I  K   D  +L   L  SFGF+TG+EF+D   ++   S SVF+K M +   IG Q+L+N+   D ++K+Y++WIGD ++VG  +          G NLILT  AKRR K N+F                           ++    +   A+K  +   N           GRG RR    Q T+ +++ E KR   + ELFQ++  +   RL G+K   +  ++ K+ ++YK    +PK+D +    +F+DK+  TV+L   G  +PFH+S +KN S + E D +YLR NF+  G     K   +  N +  +LKE+T + SN +      +    L+N ++  KE  KR+++ E + +E A+LV QD +V++P K   +L+DL+IRP +  +RI+G LE H NG RF++++G+ +DI++NNIKH+FYQPCD EMI+L+HFHLKN I+Y KKKQ DIQFYTEVGE+TTDLGK  + MHDRDDLE+EQ+E+EMR++I  AF  F ++ E ++    ++F+ PFR LGF GCP RSTVLL P++SCLV L EWPPFVVT+DEVEL+ FERV+LS ++FDM+ VFKDY  KP  + S+P   LD +K W+   DIF+SEG KSLNW K+MK I D+P+ FLE+ GW+ L
Sbjct:   32 DAFLVVNGKSDVLYSKTVSLQTWLFGYEMQDTAILFTRSGLYILSSKKKTEFLKGTKTASLKDLTVTLLTRTPENNDKGNIAKLIEAFASSGKGQVLGHFIKEKFESDFAKACGEAVKAKAKECVDASNIFSEVFAVKDEQEIDLLQKASEITCNVFTKHLKEKIMDVIDEDRKVSHQSLSDGCQDALKNKDIIKGFEMSNLEMCYDPIIQSGGNYALKFSVESDKKPMHFGTIICSLGVRYRSYCSNVVRTLIVNPTQQQSTYYEYLHD-LLNWAISQVTPGMHFSKLYSSIVNKVQSDHSELVDKLPRSFGFATGIEFRDGCQLIGPKSTSVFRKGMSVNVNIGFQDLKNEETEDAKNKVYSLWIGDVVLVGHGDD---------GSNLILTMAAKRRQK-NVFLYVEEEEEEETGGGEDGNTGLTNASKTKVSAANSTSEATKSSVGLQNGGAGSNAEEILGRGHRRAIIEQKTRNEQSAEEKRLQQRRELFQQLQINARNRLTGIKNDGELGQKAKSNVAYKGAGQMPKEDDVRKLRIFVDKKYETVILPIFGHPTPFHISTLKNVSTSIEADYTYLRINFHHPGAVIGPKDASMFPNPQSTFLKEMTYRASNQRHHGDVASPSTNLNNAYRIIKEVLKRFRSREAEERERANLVEQDVLVVDPVKSPFRLRDLYIRPNIVTKRITGTLEAHSNGFRFTSIRGDKVDILYNNIKHSFYQPCDGEMIILLHFHLKNAIMYGKKKQTDIQFYTEVGELTTDLGKTHSRMHDRDDLEAEQREREMREQIKNAFKSFVDRAEALAKRYNLEFEIPFRDLGFFGCPLRSTVLLMPTSSCLVSLVEWPPFVVTLDEVELVHFERVSLSIRTFDMVFVFKDYRAKPAMVNSIPSSALDHVKEWVMSCDIFYSEGAKSLNWPKLMKTIVDNPEDFLEQNGWSFL 960          
BLAST of SPT16 vs. TrEMBL
Match: A0A0R3U8R4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS3286 PE=4 SV=1)

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 400/959 (41.71%), Postives = 595/959 (62.04%), Query Frame = 1
Query:   13 ALAISYDTFFKRFR-LLSKWLNNE-RA---DALLIVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSE-KEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVE--KFAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQL---------------KDEPTE---DIASKPLMEFDN----------YGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTIID-ENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGK-FNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNE-RVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWA 2769
            ++++  D F  R R     W ++E RA   DA L++NG  +  YSKT+S   WLFGY L ++A ++  K + + +SKK   FLKP  S+    +E  +L +S+ + DK N  K V    +  + + LG+  K+  E +F   +   +K    + +D S   S++FAVKD+ E++ +K+AS+ T  IF+K LKE I++ +D+ KK+ H  LS    + ++  +  +G + ++L++CY PI+QSGG +NLKFS  +D+  +H G I+CS+G+RY+ YCSNVIRTL++N N+ Q   YEY+ + L  +A+EQI+PG  F      +  K   D P+L   LI SFGF TG+EF+D   V+   S +VF++ M +   IG Q+L N+    ++ K YA+W+GD ++VG  E +          N +LT  AKRR +     +                DE  +   D    P +  +            GRG RR   +Q T+ ++T E KR V + ELFQ++      RL G+KT  +  ++ K+ ++YK    +PK+D +    ++IDK+  TV+L   G  +PFH+S IKN S + EGD +YLR NF+  G     K   + +N +  +LKE+T + SN +    A +    L+N  +  KE  KR+++ EL+ +E A+LV QD +VI P K   +L+DL+IRP +  +RI+G LE H NG RF++++G+ +DI++NNIKHAFYQPCD EMI+L+HF+LKN I+Y KKKQ +IQFYTEVGE+TTDLGK    MHDRDDLE+EQ+E+EMR++I  AF  F ++VE ++    ++F+ PFR LGF GCP R+TV + P++SCL+ L+EWPPFV++++EVE + FERV+LS K+FDMI VFKDY  KP  ITS+P   LD +K W+   DIF++EG +SLNW K+MK I DDP+ FLE+ GWA
Sbjct:    2 SVSLDVDLFSSRIRRFYDYWESSESRASDVDAFLVLNGKSDELYSKTVSTQTWLFGYELQDTAIVVAKKVIAVLSSKKKIEFLKPIKSASIHGLEFKLLTRSQEDGDKANISKLVSEFTSSGNGEKLGYFNKEKSESEFSNAVASAIKSSAKELVDSSPIFSHVFAVKDQHEVQLLKRASDITCTIFSKHLKEKIMDVIDDDKKVAHQILSDGCQEALKNKELTRGFEQDNLEICYDPILQSGGNYNLKFSSGNDKKPMHFGTIICSLGVRYKSYCSNVIRTLIVNPNSRQSTNYEYLHN-LLDWAIEQIKPGLAFSSFYNLVVDKVKSDHPELANKLIRSFGFVTGIEFRDSCHVIGPKSSAVFREGMSLNINIGFQDLVNEEAESEKDKNYALWLGDVVLVGLGENK---------TNQVLTIAAKRRPRAVSLYIEEEDEDEEGNEASGRADEALKNGGDRGGAPRVHENGRTIDDDAEGALGRGHRRTILSQKTRNEQTAEEKRLVQRRELFQQLQISARNRLSGLKTDGETGQKAKSNVAYKGAGQMPKEDDVRKLRIYIDKKYETVILPIFGQPTPFHISTIKNVSSSIEGDYTYLRINFHHPGALVGPKDASNFQNPQATFLKEMTYRASNQRRHGEASSPSTNLNNAHRIIKEVLKRFRSRELEEKERANLVEQDNLVIEPGKTAFRLRDLYIRPNIVTKRITGTLEAHSNGFRFTSIRGDKVDILYNNIKHAFYQPCDGEMIILLHFNLKNAIMYGKKKQENIQFYTEVGELTTDLGKSHGRMHDRDDLEAEQREREMREQIKHAFKTFVDRVESLAKRYNLEFEMPFRDLGFYGCPIRTTVFMMPTSSCLISLSEWPPFVISLEEVEFVMFERVSLSIKTFDMIFVFKDYRIKPAMITSIPSTSLDHVKEWILSCDIFYAEGARSLNWPKLMKTIIDDPEDFLEQNGWA 950          
BLAST of SPT16 vs. Ensembl Cavefish
Match: supt16h (SPT16 homolog, facilitates chromatin remodeling subunit [Source:NCBI gene;Acc:103045056])

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 377/938 (40.19%), Postives = 577/938 (61.51%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKE------VEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVE--KFAKG-DMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGK--TIIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            A+ +  + +++R  RL   W   E    + DA+++  G D  + Y+K+ ++  WLFGY L ++  +    K+   ASKK   FLK   S++          I++L + K E +K N  K ++ I    + KS+G   KD F G++ +    ++     + +D+SA ++   AVK++ EL  +KKA+  T+ +F K  KE ++  VD  +K+KHS L+   +K +E  K+  G D  ++++CYPPIIQSGG ++LKFSV SD+N++H G I C+MG+RY+ YCSN++RTLM++   E ++ Y +++ ++    L++++ G +  +   A+ +    +K DL   L  + GF+ G+EF++  LVL   +Q   KK MV+   +G  ++ N        K YA++IGD++++       E+P        +LT + K+     +F LK +  ED         D  G+G R       T+ + T E KR+ HQ EL  +M E+ ++RL   K      K +K+ +SYK+   +P++  I +  +FIDK+  TV++   G  +PFH++ IKN S + EGD +YLR NF   G ++LG+    I  N E  ++KE+T + SN+K           L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN I++ KK+  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S L  +TEWPPFVVT+DEVEL+ FERV    K+FD++IV+KDY++K   I ++P + LD IK WL+  DI ++EG +SLNW KIMK I DDP+ F E+GGW+ L
Sbjct:    2 AVNLDKEAYYRRIKRLYGNWKKGEDEFGKVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCESKIIFLASKKKVEFLKQVASTKGNENANGIPPITLLVREKNESNKANFEKMMEAIRGSKAGKSVGVFIKDKFPGEYMKSWNDMITAEGLEKVDISAVVAYTMAVKEDGELNLMKKAAAITSDVFTKFFKERVMEIVDAEEKVKHSRLAESVEKAIEDRKYLSGADPSTVEMCYPPIIQSGGNYSLKFSVVSDKNHMHFGAITCAMGIRYKSYCSNLVRTLMVDPPQEMQDNYNFLL-QVEEELLKELKHGVKICDAYNAVLEYVKKEKSDLVSKLTKNLGFAMGIEFREGSLVLNAKNQYKLKKGMVLSISLGFADMTNSEGKKDEQKKYALFIGDSVLINE-----EDPAT------VLTPVKKKIKNVGIF-LKKDDEEDEDEDEDNAEDLLGKGARAALLVDRTRNELTAEEKRRAHQKELANQMNEEAKRRLTEQKGEQQIQKARKSNVSYKNVSQMPREKDIRDMKIFIDKKYETVVMPVFGIATPFHIATIKNISMSVEGDYTYLRINFFVPG-SSLGRHEGNIFPNPEATFVKEITYRASNLKSPGDPSVPSTNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHTNGFRFTSVRGDKVDILYNNIKHAVFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKSAFKNFIEKVETLTKEELEFEVPFRDLGFQGAPYRSTCLLQPTSSSLCNVTEWPPFVVTLDEVELVHFERVQFHLKNFDIVIVYKDYSKKVTMINAVPVNSLDPIKEWLNSCDIKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFL 925          
BLAST of SPT16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003277.1 (pep scaffold:Pmarinus_7.0:GL484404:979:12735:1 gene:ENSPMAG00000002993.1 transcript:ENSPMAT00000003277.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 244.202 bits (622), Expect = 1.298e-70
Identity = 139/413 (33.66%), Postives = 236/413 (57.14%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMS------SEKEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVEK---FAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYI--VDKLYVYALEQI--QPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVV 1194
            A+ +  + +++R  RL + W   E    + DA+++  G D    YSK+ ++  WLFGY L ++  ++  +K+ + ASKK  +FL+   S      S     +++L + K+E+ KEN  K ++ I +    K++G   KD + G F       L    FD +DVS+ ++ + AVK+E EL  IKKA+  T+++++K LKE ++  VD  +K++HS L+   +K +E     A  D  S+++CYPPIIQSG   N K+S  SD+N++H G IVC++G+RY+ YC+NV+RTLM++     ++ Y ++  V +  +  L+Q+    G    EV +A       ++ DLT +   + GF  G+EF++  LV+ G +Q+  +K MV    +GL N+ NK     R K Y+++I DT+ +
Sbjct:    2 AVQLDKEAYYRRVKRLYNTWRKGEDEFGKVDAIVVSVGVDEETVYSKSTALQTWLFGYELTDTVMVLCDEKIVLMASKKKVDFLRQLASGKGSENSSGAPPVTLLVRDKSEN-KENFDKLLEEIRSSKEGKTIGVFSKDGYPGSFMTSWHDSLSKGGFDKVDVSSVVALMIAVKEEGELALIKKAALITSEVYSKYLKEKVMEVVDMDQKVRHSKLAEGVEKAIEDKKYLAGADPSSVEMCYPPIIQSGASCNFKYSAVSDKNHMHFGAIVCALGVRYKSYCANVVRTLMVDPTQTMQDTYTFLLGVQEHMLAQLKQVCAGAGAALCEVYQATLDFVKKERSDLTNAFSKNLGFGMGIEFREGSLVINGKNQTKLRKGMVFNINLGLCNVPNKESKSDRDKAYSLFIADTVQI 413          
BLAST of SPT16 vs. Ensembl Yeast
Match: SPT16 (Subunit of the heterodimeric FACT complex (Spt16p-Pob3p); FACT associates with chromatin via interaction with Nhp6Ap and Nhp6Bp, and reorganizes nucleosomes to facilitate access to DNA by RNA and DNA polymerases; specifically required for diauxic shift-induced H2B deposition onto rDNA genes; mutations cause reduced nucleosome occupancy over highly transcribed regions; coregulates transcription with Mot1p through preinitiation complex assembly and nucleosome organization [Source:SGD;Acc:S000003175])

HSP 1 Score: 395.971 bits (1016), Expect = 8.382e-121
Identity = 300/979 (30.64%), Postives = 498/979 (50.87%), Query Frame = 1
Query:   16 LAISYDTFFKRFRLL-SKWLNNERA-DALLIVNGNDNM--AYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKEVEISVLEKSKTEDDKE---NAIKFVKYIENITSI-KSLGHLPKDNFEGKFF----EIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTD------KFVEKFA-----------KGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHA-GVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKD-RFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLF---------QLKDEPTEDIASKPLME---FDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRK---KNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNT-LGKTI----IDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRF-STMKGEN-IDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTD--------LGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVT-ITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGW 2766
            L I +D F KR  LL SK+   E + ++LL V G+ N    Y KT  +H WL  Y  P +   +   K+ I  S      L+ A+   K+ E  +  +    ++KE   N   F   I  I S  K++G   KD+++GKF      + +  +K+ +F+ +D+S  +S ++ VKD +E   +  +S+ + K F   L   ++ +VDE  KI ++ LS K +      KF+++ +           K + + LD  Y PIIQSG KF+L+ S  S  + L+  G I+ S G+RY  YCSN+ RT +I+ + E    Y++++          ++PG+   EV +++ +     KP+L  +   + G   G+EF+D  F++   N     ++        G  NL++    +     YA+ + DT+ +   ET  E P         LT+  K +++ + +         + K  P   + SKP           RG+ R         D   E  RK +Q +L +K+ ++   R      +  +++ +   K Y SY     LP +  I +  + +D ++ T++L   G   PFH++  KN S  EEG+ +YLR NFN+ G +  + K +     +E+ ++ +++ +T+++ +          G  +S  F+   + +K     E + +  AD+V QD ++ N      +L  +F+RP    +R+   +  H+NG+RF S ++ ++ IDI+F+NIK+  +Q C  E+IV+IH HLKNPI+  KKK  D+QFY E  +M+ D          +F    D D+LE EQ+E+  R  +++ F  F + + E SN  +  +  FR LGF G PNRS V   P+T CLVQL E P  V+ ++EVE+   ERV    K+FDM+ V+KD+N KPVT I ++P + LD +K WL  +DI ++    +LNW  IMK++ DDP +F  +GGW
Sbjct:    4 LNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDK-FMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANN----YALQLADTVQIPLDET--EPPRF-------LTNYTKAKSQISFYFNNEEEDNNKKKSSPATKVPSKPDRNSKILRTKLRGEARGGAE-----DAQKEQIRKENQKKLHEKLEKNGLLRFSAADANGPDSEPRQYFKKYESYVRDSQLPTN--IRDLRIHVDWKSQTIILPIYGRPVPFHINSYKNGSKNEEGEYTYLRLNFNSPGSSGGISKKVEELPYEESADNQFVRSITLRSKD----------GDRMSETFKQIADLKKEATKREQERKALADVVQQDKLIENKTGRTKRLDQIFVRPNPDTKRVPSTVFIHENGIRFQSPLRTDSRIDILFSNIKNLIFQSCKGELIVVIHIHLKNPILMGKKKIQDVQFYREASDMSVDETGGGRRGQSRFRRYGDEDELEQEQEERRKRAALDKEFKYFADAIAEASNGLLTVENTFRDLGFQGVPNRSAVFCMPTTDCLVQLIEPPFLVINLEEVEICILERVQFGLKNFDMVFVYKDFN-KPVTHINTVPIESLDFLKQWLTDMDIPYTVSTINLNWATIMKSLQDDPYQFFLDGGW 950          
BLAST of SPT16 vs. Ensembl Nematostella
Match: EDO32459 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV15])

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 374/950 (39.37%), Postives = 588/950 (61.89%), Query Frame = 1
Query:    1 MSDKALAISYDTFFKRF-RLLSKWLNN-------------ERADALLIVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKEVE----ISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVE--KFAKGDMES--LDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKT-SDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGK--TIIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            M+   +++  D FF+R  R+ + W                E    ++ V  ++++ YSK+ ++ QWLFGY L ++  I+    +H+ ASKK  +FLKP   ++K+VE    I +  + K+++DK N  K V+ +      K +G   KD F+G+F +  K   ++  F+ +DVS +++ + AV+++ EL  +KKA++ ++ IF+K  K  I+  VDE K++KHS ++   +  +E  K+ +  M++  +++CY PI+QSGGKF LKFS  S++  L+ GVI+CS+G+RY+YYCSN++RT+M+    EQ+E+Y ++V  ++   +++++   +  +V  A  +  S +KPDL    + + GF TG+EF++  L++T  +  + KK MV     G   L N    D  +K YA++IGDT++V            E     ILT   K+ +   +F LKDE  E+   +   E +      R       T+ + T E KR+ HQ EL +++ E+  +RLL  K  S    K K + ++YK   ++P++  +    +F+DK++  ++L   G  +PFH+S IKN S ++EG  +YLR N    G +++G+    +    E  ++KE+T ++SN K   SA      L+  F+  KE QK++KT E + +E    V Q T++++  K  PKLKDL+IRP++++++  G LE H NG RFST +GE++DI++ N+KHA++QPCD EMI+LIHFHLK+PI+  KKK  DIQFYTEVGE+TTDLGK  HMHDRDDL++EQ E+E+R+++   F  F +KVE I++ +V+FD PFR+LGF G P RSTVLLQP+T CLV LTE P F++T+DEVEL+ FERV    K+FDM+ +FKDY+ K   I ++P   LD +K WL+  DI ++EG +SLNW KIMK I ++P++FLE GGW+ L
Sbjct:    1 MAAAKISLDKDAFFRRIKRIYAAWQKPDGTVKEENGVAFPEVGSVVIAVGQDEDVIYSKSTALQQWLFGYELADTVTILCKSTLHVLASKKKVDFLKPLQDAQKKVEGTPTIKLHLRDKSDEDKANFAKLVEEMNASGKGKQVGVFIKDTFQGQFMDGWKTAFENESFEKVDVSNAMAFIMAVREDSELVNVKKAAQVSSDIFSKFFKNQIMEIVDEEKRVKHSKIADSIEGALETKKYLQPGMDADQVEMCYSPIVQSGGKFALKFSTVSNDEKLNFGVIICSLGVRYKYYCSNIVRTMMVQPTEEQQEIYTFLV-AVFDVIVDKLRHDTKLCDVYNAAMQHVSKNKPDLQSKFVKNIGFGTGIEFREGSLLITPKNTHLAKKGMVFNISAGFSGLVNSQAGDDVNKNYALFIGDTLLVN-----------EGSPATILTPAKKKISNIGIF-LKDEEDEEEEKEENGEAEEDYLKTRGAVLESRTRTEMTAEDKRRAHQLELKEQLHEEARRRLLESKGDSVKPIKMKASNVAYKHATSIPREHDVRELRLFVDKKHEAIILPLFGIATPFHISTIKNISSSDEGGYTYLRINLYCPG-SSVGRLEGNLFAQPEATFVKEITFRSSNTKTPGSAFPPAQNLNTAFRLIKEVQKKFKTREAEEREKQGAVQQGTLLLSNTKGNPKLKDLYIRPSITQRKTPGMLEAHTNGFRFSTFRGEHVDIIYGNVKHAYFQPCDGEMIILIHFHLKHPIIIGKKKYRDIQFYTEVGEITTDLGKHQHMHDRDDLQAEQAERELRQRLKAVFKNFIDKVEGITHGQVEFDVPFRELGFSGVPFRSTVLLQPTTHCLVNLTEQPSFIITLDEVELVHFERVQFHLKNFDMVFIFKDYHRKVEHINAVPMTSLDSVKEWLNSCDIKYTEGIQSLNWAKIMKTINENPEEFLENGGWSFL 936          
BLAST of SPT16 vs. Ensembl Medaka
Match: supt16h (SPT16 homolog, facilitates chromatin remodeling subunit [Source:NCBI gene;Acc:101160268])

HSP 1 Score: 708.368 bits (1827), Expect = 0.000e+0
Identity = 377/939 (40.15%), Postives = 578/939 (61.55%), Query Frame = 1
Query:   13 ALAISYDTFFKRF-RLLSKWLNNE----RADALLIVNGNDN-MAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAM------SSEKEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVEK---FAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNAT-AQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTI--IDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPL 2775
            A+ +  + +++R  RL S W   E    + DA+++  G D  + Y+K+ +I  WLFGY L ++  +    K+   ASKK  +FLK         ++     I++L + K E +K N  K ++ I+     K++G   KD F G + +     L     + +D+SA ++   AVK++ EL  +KKA+  T+++++K  KE ++  VD  +K++HS L+   +K +E+       D  ++++CYPPIIQSGG ++LKFSV SD+N++H G I C+MG+RY+ YCSN++RTLM++ + E ++ Y ++V ++    L++++ G +  +   A+ +    +KPDL   L  + GF+ G+EF++  LVL   +Q   KK MV    +G  +L NK       K YA++IGDT+ +          E EV    +LT   K+     +F LK++  +D         +  G+G R  A  A  T+ + T E KR+ HQ EL   + E+ ++RL   K      K +K+ +SYK+   +P++  I +  ++IDK+  TV++   G  +PFH++ IKN S + EGD +YLR NF   G ++LG+    I  N +  ++KE+T + SN+K           L N F+  KE QKRYKT E + +E   +V QD++VIN  +  PKLKDL+IRP ++++R+ G+LE H NG RF++++G+ +DI++NNIKHA +QPCD EMI+++HFHLKN I++ K++  D+QFYTEVGE+TTDLGK  HMHDRDDL +EQ E+EMR K+  AF  F  KVE ++ E ++F+ PFR LGF G P RST LLQP++S LV +TEWPPFVVT+DEVEL+ FERV    K+FD++IV+KDYN+K   I ++P + LD IK WL+  DI ++EG +SLNW KIMK I DDP+ F  +GGW+ L
Sbjct:    2 AVNLDKEAYYRRIKRLYSNWKKGEDEFGKIDAIVVSVGVDEEIVYAKSTAIQTWLFGYELTDTIMVFCDTKIIFLASKKKVDFLKQVAVTKGNENANGAPPITLLTREKNESNKANFDKMIEAIKGSREGKTVGIFSKDKFPGDYMKSWGDALNAEGLEKVDISAVVAYTMAVKEDGELGLMKKAAAITSEVYSKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLGGADPSTVEMCYPPIIQSGGNYSLKFSVVSDKNHMHFGAITCAMGIRYKSYCSNLVRTLMVDPSQEMQDNYNFLV-QVEEELLKELKHGVKICDAYNAVLEFVKKEKPDLVSKLTKNLGFAMGIEFREGSLVLNAKNQYKLKKGMVFSISLGFADLVNKDAKKDELKKYALFIGDTVQIN---------EEEVAA--VLTPAKKKIKNVGIF-LKNDDEDDEDEDGDDAEELLGKGARSAALLADRTRNEMTAEEKRRAHQKELANHLNEEAKRRLTEQKGEQHIQKARKSNVSYKNVSQMPREKEIRDMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYVPG-SSLGRQEGNIFPNPDATFVKEITYRASNLKAPGDTSVPSTNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHTNGFRFTSVRGDKVDILYNNIKHAIFQPCDGEMIIVLHFHLKNAIMFGKRRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMEREMRHKLKSAFKNFIEKVETLTKEELEFEVPFRDLGFQGAPYRSTCLLQPTSSSLVNVTEWPPFVVTLDEVELVHFERVQFHLKNFDVVIVYKDYNKKVTMINAVPVNSLDPIKEWLNSCDIKYTEGVQSLNWTKIMKTIVDDPEGFFAQGGWSFL 926          
BLAST of SPT16 vs. Planmine SMEST
Match: SMESG000033905.1 (SMESG000033905.1)

HSP 1 Score: 1949.48 bits (5049), Expect = 0.000e+0
Identity = 1019/1021 (99.80%), Postives = 1019/1021 (99.80%), Query Frame = 1
Query:    1 MSDKALAISYDTFFKRFRLLSKWLNNERADALLIVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKEVEISVLEKSKTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVEKFAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTIIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPLCGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGMDWDELEEEARKADMETEPEDPPRKKRKH 3063
            MSDKALAISYDTFFKRFRLLSKWLNNERADALLIVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKEVEISVLEKSKTEDDKENAIKFVKYIENIT IKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVEKFAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVL GNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTIIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPLCGESDEESENEDMEEDEVYEPSDDGDEDGSDESADSEDAADSEFDEGDEEEESDSGEQGLDSDESKGMDWDELEEEARKADMETEPEDPPRKKRKH
Sbjct:    1 MSDKALAISYDTFFKRFRLLSKWLNNERADALLIVNGNDNMAYSKTMSIHQWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKEVEISVLEKSKTEDDKENAIKFVKYIENITIIKSLGHLPKDNFEGKFFEIMKLVLKDIKFDFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEGKKIKHSDLSAKTDKFVEKFAKGDMESLDLCYPPIIQSGGKFNLKFSVESDENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVYALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFLVLAGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGGAETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFDNYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTSDDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPFHMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTIIDENTEDIYLKELTIKTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDTIVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIMFNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTDLGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQPFRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNLSNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSLNWVKIMKNITDDPKKFLEEGGWAPLCGESDEESENEDMEEDEVYEPSDDGDEDGSDESADSEDAADSEFDEGDEEEESDSGEQGLDSDESKGMDWDELEEEARKADMETEPEDPPRKKRKH 1021          
The following BLAST results are available for this feature:
BLAST of SPT16 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SUPT16H0.000e+041.26SPT16 homolog, facilitates chromatin remodeling su... [more]
back to top
BLAST of SPT16 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spt-160.000e+038.94FACT complex subunit spt-16 [Source:UniProtKB/Swi... [more]
back to top
BLAST of SPT16 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dre40.000e+041.10gene:FBgn0002183 transcript:FBtr0072865[more]
dre40.000e+041.10gene:FBgn0002183 transcript:FBtr0072864[more]
back to top
BLAST of SPT16 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
supt16h0.000e+040.58SPT16 homolog, facilitates chromatin remodeling su... [more]
supt16h0.000e+040.58SPT16 homolog, facilitates chromatin remodeling su... [more]
supt16h0.000e+040.58SPT16 homolog, facilitates chromatin remodeling su... [more]
back to top
BLAST of SPT16 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc35f40.000e+040.60solute carrier family 35 member F4 [Source:Xenbase... [more]
slc35f40.000e+040.32solute carrier family 35 member F4 [Source:Xenbase... [more]
slc35f40.000e+040.32solute carrier family 35 member F4 [Source:Xenbase... [more]
slc35f40.000e+040.90solute carrier family 35 member F4 [Source:Xenbase... [more]
slc35f41.126e-1929.20solute carrier family 35 member F4 [Source:Xenbase... [more]
back to top
BLAST of SPT16 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Supt160.000e+041.47SPT16, facilitates chromatin remodeling subunit [S... [more]
back to top
BLAST of SPT16 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q920B9|SP16H_MOUSE0.000e+041.36FACT complex subunit SPT16 OS=Mus musculus OX=1009... [more]
sp|Q9Y5B9|SP16H_HUMAN0.000e+041.26FACT complex subunit SPT16 OS=Homo sapiens OX=9606... [more]
sp|Q8IRG6|SPT16_DROME0.000e+041.10FACT complex subunit spt16 OS=Drosophila melanogas... [more]
sp|Q9W603|SP16H_XENLA0.000e+040.43FACT complex subunit SPT16 OS=Xenopus laevis OX=83... [more]
sp|Q9N5R9|SPT16_CAEEL0.000e+038.94FACT complex subunit spt-16 OS=Caenorhabditis eleg... [more]
back to top
BLAST of SPT16 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
M9NN130.000e+099.71SPT16 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A4S2LX700.000e+042.83Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M2X80.000e+042.93Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0X3QEW90.000e+042.13FACT complex subunit spt16 OS=Schistocephalus soli... [more]
A0A0R3U8R40.000e+041.71Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of SPT16 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
supt16h0.000e+040.19SPT16 homolog, facilitates chromatin remodeling su... [more]
back to top
BLAST of SPT16 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003277.11.298e-7033.66pep scaffold:Pmarinus_7.0:GL484404:979:12735:1 gen... [more]
back to top
BLAST of SPT16 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SPT168.382e-12130.64Subunit of the heterodimeric FACT complex (Spt16p-... [more]
back to top
BLAST of SPT16 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO324590.000e+039.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SPT16 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
supt16h0.000e+040.15SPT16 homolog, facilitates chromatin remodeling su... [more]
back to top
BLAST of SPT16 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000033905.10.000e+099.80SMESG000033905.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012293
GenBankAFL48193.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012293 ID=SMED30012293|Name=SPT16|organism=Schmidtea mediterranea sexual|type=transcript|length=3361bp
ATGTCTGATAAGGCTTTGGCAATAAGTTATGATACCTTTTTCAAAAGGTT
TAGATTGCTTTCAAAATGGCTAAATAACGAAAGAGCTGATGCACTTTTAA
TAGTTAATGGAAATGACAACATGGCTTACTCTAAAACGATGTCAATTCAT
CAATGGCTTTTTGGTTATTCTCTACCTAATAGTGCATTCATCATTTACGG
AAAGAAAATGCACATTTTTGCAAGTAAAAAGGTTTGCAACTTTTTAAAGC
CAGCAATGTCCTCTGAAAAAGAAGTTGAAATTTCTGTTTTGGAAAAAAGC
AAAACTGAAGATGACAAAGAAAATGCAATAAAATTTGTTAAATACATTGA
AAACATAACTAGCATTAAATCTTTAGGGCATTTACCTAAAGATAATTTTG
AAGGAAAATTCTTTGAAATTATGAAATTAGTTTTGAAAGATATCAAATTT
GACTTTTTAGATGTGTCTGCGAGTATTTCTAATTTATTTGCAGTTAAAGA
TGAAGATGAATTAGAAAAAATAAAAAAAGCTAGTGAAACAACTGCTAAGA
TATTTAATAAGGAATTAAAAGAAACTATCTTGAATTCAGTTGATGAAGGA
AAAAAAATCAAACATTCAGATTTGTCTGCAAAAACAGATAAGTTTGTCGA
GAAATTTGCGAAAGGAGACATGGAAAGCTTAGATTTATGCTACCCGCCAA
TTATTCAGAGTGGAGGAAAATTTAATTTAAAATTTAGTGTTGAAAGCGAT
GAGAACAATCTACACGCAGGGGTGATTGTATGCTCTATGGGATTGCGATA
TGAATATTATTGTTCCAATGTTATTCGAACCCTCATGATCAATGCCAATG
CGGAACAAAAGGAATTATACGAATACATTGTCGACAAATTGTATGTCTAT
GCCTTAGAACAAATTCAACCAGGTAAACAGTTCGGAGAAGTCAGTAAAGC
TATCGAAAAGAAATTCTCTATCGATAAACCGGATTTGACCAAAAGCCTAA
TCACGTCATTCGGGTTTTCTACCGGGGTTGAATTTAAAGATCGATTTCTT
GTCCTGACCGGTAATTCACAGAGTGTTTTCAAGAAAAACATGGTGATAAT
ATTCTATATCGGACTGCAAAACCTGGAAAACAAAACTCCAACTGATAAGC
GATCAAAACTCTACGCTATTTGGATTGGTGATACAATCGTTGTCGGTGGA
GCGGAAACCAGGGGTGAAAATCCCGAATTGGAAGTCGGTGGAAATCTCAT
ATTGACCTCTCTTGCGAAAAGAAGAAATAAACAAAATCTATTCCAGTTGA
AAGATGAGCCGACAGAAGATATTGCCTCAAAACCCTTGATGGAATTTGAC
AATTACGGACGGGGACAACGGCGTAACGCAACTGCTCAAGTCACTCAGGT
TGATGAAACAAACGAAGCGAAAAGAAAGGTCCATCAGCACGAATTGTTTC
AGAAAATGCTGGAAGACTGTGAAAAGAGGCTGTTGGGAGTTAAAACATCT
GATGATAACACGAAACGGAAAAAGAATTACATATCCTATAAATCACGAAT
AGCATTGCCGAAAGATGATGCGATTTACAATTCCCACGTGTTTATCGATA
AACGAAATCACACGGTGCTGTTGTACCCAAACGGAGCGATTTCACCGTTC
CACATGAGTATCATTAAAAATGCTTCATTCACAGAGGAAGGCGACAAATC
ATATTTGCGATTCAATTTCAATGCTCAAGGATTCAACACGTTGGGAAAAA
CGATAATCGATGAGAACACGGAAGATATCTACCTGAAAGAGTTAACCATC
AAAACCTCCAACATGAAACTGTCGAATTCCGCTGTCAATAAAGGACTGGC
GTTATCAAATGTGTTCCAGACGTTTAAGGAGGAACAAAAGCGCTATAAAA
CGTCAGAATTGCAGGCACAAGAGAATGCCGATCTTGTTGTCCAGGATACC
ATCGTAATCAATCCTCGAAAGGAGGTGCCGAAATTAAAGGATCTGTTTAT
TCGGCCGACAATGTCCAAGCAGCGGATTTCCGGTAATCTCGAATGCCATC
AGAACGGGCTGAGGTTTTCCACAATGAAAGGCGAGAATATCGACATTATG
TTCAACAATATCAAGCATGCATTCTATCAACCATGCGACAAAGAAATGAT
TGTTTTGATTCATTTCCACTTGAAGAATCCGATTGTGTACAGCAAGAAGA
AACAAATCGATATCCAGTTCTACACGGAAGTCGGTGAAATGACAACGGAT
TTAGGAAAGTTCAACCATATGCACGACAGAGACGATTTAGAATCGGAACA
GAAAGAAAAGGAAATGAGGAAAAAAATCAATGAAGCTTTTCTTCGATTCT
GTAACAAAGTCGAAGAGATTTCCAATGAACGGGTGGATTTCGACCAACCT
TTCAGAAAACTGGGTTTCATGGGTTGCCCGAATCGATCGACAGTGTTACT
GCAACCGTCGACATCGTGTCTGGTCCAGTTGACCGAGTGGCCCCCATTTG
TCGTTACCATGGACGAGGTGGAGTTGATATTTTTCGAACGAGTCAATCTG
TCGAATAAAAGTTTCGACATGATTATCGTGTTCAAAGATTACAACGAGAA
ACCCGTTACCATAACATCGTTACCCCAGGACAAATTGGACGATATCAAAA
GCTGGCTGGATCACATCGATATTTTCTTTTCCGAAGGGGGAAAAAGCTTG
AATTGGGTGAAAATTATGAAGAATATCACAGATGATCCGAAGAAATTTCT
TGAAGAAGGCGGATGGGCTCCACTTTGCGGGGAAAGTGATGAGGAATCAG
AGAATGAGGATATGGAAGAGGATGAAGTCTACGAGCCGTCGGATGATGGC
GACGAGGACGGTTCCGATGAATCCGCTGATTCGGAAGACGCAGCAGATAG
CGAATTCGATGAAGGCGATGAAGAGGAGGAGTCAGATTCCGGTGAGCAGG
GATTGGATTCCGACGAATCGAAAGGAATGGATTGGGATGAGTTGGAAGAG
GAAGCGCGCAAGGCTGACATGGAAACGGAACCGGAGGATCCCCCGAGAAA
GAAAAGAAAACACTGATAATAGAACCTTGAGCAGTATTTTACAGAGCATT
TTATAAAAAAGAAAACCGATGTTGTGTGTTAATATTATTATAATTAGATT
ATTCTCAAATATCGCTGAATGTGTATTATATTAGCATTTTATGGGGCTGA
ATTTTATTACTTAAATGTGTGTGTGTGTAAATCATTATAGATAACTCTCC
ATCAAATCCATATGTGTGTGAGTGTCCTAGAATCTATTTGTTATTACATT
TGTTTATAGTTCGATTTCATGTTGGTTATAATCGTTATTTATATTTGACT
CTATTGAAAAA
back to top

protein sequence of SMED30012293-orf-1

>SMED30012293-orf-1 ID=SMED30012293-orf-1|Name=SMED30012293-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1022bp
MSDKALAISYDTFFKRFRLLSKWLNNERADALLIVNGNDNMAYSKTMSIH
QWLFGYSLPNSAFIIYGKKMHIFASKKVCNFLKPAMSSEKEVEISVLEKS
KTEDDKENAIKFVKYIENITSIKSLGHLPKDNFEGKFFEIMKLVLKDIKF
DFLDVSASISNLFAVKDEDELEKIKKASETTAKIFNKELKETILNSVDEG
KKIKHSDLSAKTDKFVEKFAKGDMESLDLCYPPIIQSGGKFNLKFSVESD
ENNLHAGVIVCSMGLRYEYYCSNVIRTLMINANAEQKELYEYIVDKLYVY
ALEQIQPGKQFGEVSKAIEKKFSIDKPDLTKSLITSFGFSTGVEFKDRFL
VLTGNSQSVFKKNMVIIFYIGLQNLENKTPTDKRSKLYAIWIGDTIVVGG
AETRGENPELEVGGNLILTSLAKRRNKQNLFQLKDEPTEDIASKPLMEFD
NYGRGQRRNATAQVTQVDETNEAKRKVHQHELFQKMLEDCEKRLLGVKTS
DDNTKRKKNYISYKSRIALPKDDAIYNSHVFIDKRNHTVLLYPNGAISPF
HMSIIKNASFTEEGDKSYLRFNFNAQGFNTLGKTIIDENTEDIYLKELTI
KTSNMKLSNSAVNKGLALSNVFQTFKEEQKRYKTSELQAQENADLVVQDT
IVINPRKEVPKLKDLFIRPTMSKQRISGNLECHQNGLRFSTMKGENIDIM
FNNIKHAFYQPCDKEMIVLIHFHLKNPIVYSKKKQIDIQFYTEVGEMTTD
LGKFNHMHDRDDLESEQKEKEMRKKINEAFLRFCNKVEEISNERVDFDQP
FRKLGFMGCPNRSTVLLQPSTSCLVQLTEWPPFVVTMDEVELIFFERVNL
SNKSFDMIIVFKDYNEKPVTITSLPQDKLDDIKSWLDHIDIFFSEGGKSL
NWVKIMKNITDDPKKFLEEGGWAPLCGESDEESENEDMEEDEVYEPSDDG
DEDGSDESADSEDAADSEFDEGDEEEESDSGEQGLDSDESKGMDWDELEE
EARKADMETEPEDPPRKKRKH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036005Creatinase/aminopeptidase-like
IPR011993PH-like_dom_sf
IPR040258Spt16
IPR029148FACT-Spt16_Nlobe
IPR013953FACT_Spt16
IPR013719DUF1747
IPR029149Creatin/AminoP/Spt16_NTD
IPR000994Pept_M24
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005515protein binding
GO:0031491nucleosome binding
GO:0042393histone binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005694chromosome
GO:0035101FACT complex
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006281DNA repair
GO:0006337nucleosome disassembly
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
GO:0006368transcription elongation from RNA polymerase II promoter
GO:0006974cellular response to DNA damage stimulus
GO:0032786positive regulation of DNA-templated transcription, elongation
GO:0032968positive regulation of transcription elongation from RNA polymerase II promoter
GO:0034724DNA replication-independent nucleosome organization
GO:1901796regulation of signal transduction by p53 class mediator
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029148FACT complex subunit Spt16, N-terminal lobe domainSMARTSM01285FACT_Spt16_Nlob_2coord: 8..159
e-value: 1.4E-27
score: 107.7
IPR029148FACT complex subunit Spt16, N-terminal lobe domainPFAMPF14826FACT-Spt16_Nlobcoord: 10..157
e-value: 2.5E-29
score: 102.2
IPR013719Domain of unknown function DUF1747SMARTSM01287Rtt106_2coord: 806..896
e-value: 1.9E-27
score: 107.2
IPR013719Domain of unknown function DUF1747PFAMPF08512Rtt106coord: 813..891
e-value: 4.3E-14
score: 52.7
IPR013953FACT complex subunit Spt16 domainSMARTSM01286SPT16_2coord: 530..689
e-value: 9.3E-45
score: 164.7
IPR013953FACT complex subunit Spt16 domainPFAMPF08644SPT16coord: 530..689
e-value: 2.1E-36
score: 125.4
NoneNo IPR availableGENE3DG3DSA:2.30.29.210coord: 502..633
e-value: 6.4E-23
score: 82.8
NoneNo IPR availableGENE3DG3DSA:2.30.29.150coord: 644..798
e-value: 4.3E-62
score: 210.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 984..1021
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 929..983
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 927..1021
NoneNo IPR availablePANTHERPTHR13980:SF15FACT COMPLEX SUBUNIT SPT16coord: 5..1018
IPR000994Peptidase M24PFAMPF00557Peptidase_M24coord: 172..398
e-value: 2.0E-19
score: 70.1
IPR029149Creatinase/Aminopeptidase P/Spt16, N-terminalGENE3DG3DSA:3.40.350.10coord: 2..163
e-value: 5.8E-33
score: 115.9
IPR036005Creatinase/aminopeptidase-likeGENE3DG3DSA:3.90.230.10coord: 164..411
e-value: 1.7E-44
score: 154.0
IPR036005Creatinase/aminopeptidase-likeSUPERFAMILYSSF55920Creatinase/aminopeptidasecoord: 166..400
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 799..930
e-value: 2.3E-51
score: 174.9
IPR040258FACT complex subunit Spt16PANTHERPTHR13980CDC68 RELATEDcoord: 5..1018