Integrase catalytic domain-containing protein

Overview
NameIntegrase catalytic domain-containing protein
Smed IDSMED30012288
Length (bp)2992
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Integrase catalytic domain-containing protein (SMED30012288) t-SNE clustered cells

Violin plots show distribution of expression levels for Integrase catalytic domain-containing protein (SMED30012288) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Integrase catalytic domain-containing protein (SMED30012288) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Integrase catalytic domain-containing protein (SMED30012288) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012288

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30012288SMESG000030621.1 dd_Smed_v4_4052_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Zebrafish
Match: CR749164.1 (pep chromosome:GRCz11:21:30355767:30361679:1 gene:ENSDARG00000116832.1 transcript:ENSDART00000189948.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR749164.1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.476e-19
Identity = 39/125 (31.20%), Postives = 62/125 (49.60%), Query Frame = 2
Query: 2138 IHIDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKF-GIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLL 2509
            I ID +  L   Q K  +L ++ R +     IPI+ + T      LL E   ++ G+P +IV DRG QFTS  +   +K L I  + T+ YHP +N + ER ++ +   +     + +  W K L
Sbjct: 1068 IAIDFITDLPISQGKTTILTVVDRFSKSCRLIPISKLPTAMETAELLCECVFRYYGLPEDIVSDRGPQFTSRLWSAFFKNLQINVSLTSGYHPQSNGQTERLNQEIGQFLRTYCHSNQNEWAKFL 1192          

HSP 2 Score: 47.7506 bits (112), Expect = 2.476e-19
Identity = 49/167 (29.34%), Postives = 74/167 (44.31%), Query Frame = 1
Query: 1681 IYTDYKPLSHSHA-KDPSPRQWRQLQFR*ALQCSI*YCPGKTNIVADKLSR------STIQD--------VENCFTWSVEEIIQLQRKEMNLTVETVLMDINKLVVSPSLRKSMFKTVYELAYTG-------VKI--TKYVWH*VTKDIQK*YRECNECARTKIYRH 2109
            + TD+K L +  + K  +PRQ R   F       + Y PG  NI AD LSR      S I D        +     W +E+ I LQ  E N + +      NK+ V PSLR+ +   V++   +G       V++  ++Y W  + KD+      C+ C  +K  RH
Sbjct:  886 VITDHKNLEYIRSCKRLNPRQARWALFFTRFDFQVTYIPGSKNIKADALSRLSDDETSEIPDEPIIKDPLIVAPIQWDIEQEI-LQAAENNPSQQPC--PENKIFVPPSLRERLISEVHDHPSSGHPGSTATVQMIQSRYWWSSIHKDVINFINRCSPCQMSKHSRH 1049          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01030006.1 (pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene:ENSDARG00000114113.1 transcript:ENSDART00000182402.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01030006.1)

HSP 1 Score: 83.9593 bits (206), Expect = 7.140e-17
Identity = 47/137 (34.31%), Postives = 76/137 (55.47%), Query Frame = 2
Query: 2144 IDIVELLKQVQSKN-YLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDES 2551
            +DI+  + +   +N YLL+ +   + W+E  P+ + T +++A  L  E  +++G+P+ I+ DRG QF SS F EL    +I    TTAYHP  N   ER +RTLK+ I    +   + W   LP++  +L +   ES
Sbjct:   43 VDIMGPMPKSGKQNEYLLVFVDYFSKWVELFPMRHATAQTIATILRQEMLTRWGVPDFILSDRGAQFVSSLFTELCGKWNITPKLTTAYHPQTN-MTERVNRTLKSMIAGFVEDNHKTWDTYLPELRFALNSAIQES 178          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01070852.2 (pep scaffold:GRCz11:KN150605.1:59641:62078:1 gene:ENSDARG00000114999.1 transcript:ENSDART00000193193.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01070852.2)

HSP 1 Score: 69.3218 bits (168), Expect = 2.682e-15
Identity = 39/125 (31.20%), Postives = 63/125 (50.40%), Query Frame = 2
Query: 2138 IHIDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKF-GIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLL 2509
            I ID V  L   Q    +L ++ R +     IPIA + T      LL E+  ++ G+P +IV DRG+QFTS  +   +K L +  + T+ YHP +N + ER ++ +   +     + +  W K L
Sbjct:  144 IAIDFVTDLPLSQGNTTILTVVDRFSKSCRLIPIAKLPTAMETAELLCEFVFRYYGLPEDIVSDRGSQFTSRLWSAFFKNLQVNISLTSGYHPQSNDQTERLNQEIGRFLRTYCHSNQAEWAKFL 268          

HSP 2 Score: 33.4982 bits (75), Expect = 2.682e-15
Identity = 30/114 (26.32%), Postives = 49/114 (42.98%), Query Frame = 1
Query: 1795 GKTNIVADKLSRSTIQDVENCFTWSVEEIIQLQRKEMNLTVETVLMDINKLVVSPSLRKSMFKTVYELAYTGVKIT---------KYVWH*VTKDIQK*YRECNECARTKIYRH 2109
            G   I+ D L  + IQ       W +E  I LQ  E + T ++     NK+ V P+LR+ +   V++   +G   +         +Y W  + KDI     +C+    +K  RH
Sbjct:   22 GDGPILKDPLIITPIQ-------WDIEHEI-LQASEHSSTPQSCPE--NKIFVPPALRERLIAEVHDHPSSGHPGSTATAQLIQSRYWWSSINKDIINFINKCSPYQMSKHSRH 125          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Zebrafish
Match: CU929458.1 (pep chromosome:GRCz11:11:43363075:43368382:1 gene:ENSDARG00000114395.1 transcript:ENSDART00000179934.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU929458.1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.286e-14
Identity = 36/125 (28.80%), Postives = 66/125 (52.80%), Query Frame = 2
Query: 2138 IHIDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTE-SVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLL 2509
            I +D +  L   Q+   +L ++ R +     IP+  + +    A AL +     FG+P++IV DRG+QFTS  +  L K L+I  + T+ YHP +N + ER ++ +   + +     + +W++ L
Sbjct: 1066 IAVDFITDLPVSQNNTVILTVVDRFSKACRLIPLPKLPSAFETAEALCNHVFRMFGLPDDIVSDRGSQFTSRVWSALCKNLNINVSLTSGYHPQSNGQTERMNQEVIRFLRSYCHQQQHDWSRYL 1190          

HSP 2 Score: 33.4982 bits (75), Expect = 2.286e-14
Identity = 43/163 (26.38%), Postives = 67/163 (41.10%), Query Frame = 1
Query: 1681 IYTDYKPLSH-SHAKDPSPRQWRQLQFR*ALQCSI*YCPGKTNIVADKLSR-----STIQD--------VENCFTWSVEEIIQLQRKEMNLTVETVLMDINKLVVSP-SLRKSMFKTVYEL---AYTGVKIT------KYVWH*VTKDIQK*YRECNECARTK 2097
            I TD+K L +   AK  +PRQ R   F       + Y PG  N  AD LSR     + I D        +     W +   IQ   +E N  V+      N L+  P ++R  +   +++     + G+  T      ++ W  +TKD+    ++C  C  TK
Sbjct:  885 ILTDHKNLEYLRSAKRLNPRQARWALFFTRFDFIVTYRPGSKNSKADALSRLSEDKTPISDETIIPTNLLVAPVQWDILTEIQEANRENNPPVDCP----NHLIFVPNNIRTRLLTHIHDTPSSGHPGITATLELVKARFWWPSLTKDVINYVQKCEICQSTK 1043          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Zebrafish
Match: CR533578.3 (pep chromosome:GRCz11:16:23466094:23471387:-1 gene:ENSDARG00000115891.1 transcript:ENSDART00000180899.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR533578.3)

HSP 1 Score: 66.2402 bits (160), Expect = 2.460e-14
Identity = 36/125 (28.80%), Postives = 66/125 (52.80%), Query Frame = 2
Query: 2138 IHIDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTE-SVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLL 2509
            I +D +  L   Q+   +L ++ R +     IP+  + +    A AL +     FG+P++IV DRG+QFTS  +  L K L+I  + T+ YHP +N + ER ++ +   + +     + +W++ L
Sbjct: 1066 IAVDFITDLPVSQNNTVILTVVDRFSKACRLIPLPKLPSAFETAEALCNHVFRMFGLPDDIVSDRGSQFTSRVWSALCKNLNINVSLTSGYHPQSNGQTERMNQEVIRFLRSYCHQQQHDWSRYL 1190          

HSP 2 Score: 33.4982 bits (75), Expect = 2.460e-14
Identity = 43/163 (26.38%), Postives = 67/163 (41.10%), Query Frame = 1
Query: 1681 IYTDYKPLSH-SHAKDPSPRQWRQLQFR*ALQCSI*YCPGKTNIVADKLSR-----STIQD--------VENCFTWSVEEIIQLQRKEMNLTVETVLMDINKLVVSP-SLRKSMFKTVYEL---AYTGVKIT------KYVWH*VTKDIQK*YRECNECARTK 2097
            I TD+K L +   AK  +PRQ R   F       + Y PG  N  AD LSR     + I D        +     W +   IQ   +E N  V+      N L+  P ++R  +   +++     + G+  T      ++ W  +TKD+    ++C  C  TK
Sbjct:  885 ILTDHKNLEYLRSAKRLNPRQARWALFFTRFDFIVTYRPGSKNSKADALSRLSEDKTPISDETIIPTNLLVAPVQWDILTEIQEANRENNPPVDCP----NHLIFVPNNIRTRLLTHIHDTPSSGHPGITATLELVKARFWWPSLTKDVINYVQKCKICQSTK 1043          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Xenopus
Match: mybl2 (MYB proto-oncogene like 2 [Source:Xenbase;Acc:XB-GENE-982419])

HSP 1 Score: 97.8265 bits (242), Expect = 2.834e-21
Identity = 52/152 (34.21%), Postives = 90/152 (59.21%), Query Frame = 2
Query: 2129 FQSIHIDIV-ELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESR-YFPTQKVY 2578
            F+ I +D+V  ++K  +   ++L+I+   T + EAIP+ N +++S+AR L+  + S+ GIP EI+ D+GT F S   +EL +   +   RT+ YHP  +  +ERF++TLK+ +        +NW  LLP ++ ++R  P  S  Y P + +Y
Sbjct:  146 FERIAMDLVGPIVKSARGHQHILVIMDYATRYPEAIPLRNTSSKSIARELVHVF-SRVGIPKEILTDQGTPFMSRVMKELCRLFKVVQLRTSVYHPQTDGLVERFNKTLKSMLKKVVDKDGKNWDYLLPYLMFAIREVPQSSTGYSPFELLY 296          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000023941.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV463742.1:21:4282:-1 gene:ENSXETG00000015734.1 transcript:ENSXETT00000023941.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 1.995e-18
Identity = 48/149 (32.21%), Postives = 83/149 (55.70%), Query Frame = 2
Query: 2120 SQCFQSIHIDIVELLKQVQ--SKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYF 2560
            S+ FQ + +D++  L +     K Y+L ++   T + EA+ +  I   +VA AL+  + S+ G P+EI+ D+G QFTS   Q L++   +++  ++ YHP  N   ERF+ TLK  +    ++  ++W + LP +L + R  P ES  F
Sbjct:  705 SEPFQRVAVDLIGPLSRPSRSGKQYILTVMDYATRYPEAVALRKIDAPTVADALIQIF-SRVGFPSEILSDQGPQFTSQLLQCLWQRCGVRAIHSSPYHPQTNGLCERFNGTLKTMLRTFVESGEKDWERYLPHLLFAYREVPQESTGF 852          

HSP 2 Score: 23.8682 bits (50), Expect = 1.995e-18
Identity = 14/60 (23.33%), Postives = 28/60 (46.67%), Query Frame = 1
Query: 1942 KLVVSPSLRKSMFKTVYEL---AYTGVKITK------YVWH*VTKDIQK*YRECNECART 2094
            +L V  S R  +    +E+    + GV  T+      + W  +++++ +  R C+ C RT
Sbjct:  628 QLTVPLSYRAQLLHMAHEIPLAGHQGVTRTRHRLTQNFYWPGISQEVTRYCRTCDSCQRT 687          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000023851.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV461115.1:7997:9051:-1 gene:ENSXETG00000015824.1 transcript:ENSXETT00000023851.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 2.705e-18
Identity = 52/160 (32.50%), Postives = 84/160 (52.50%), Query Frame = 2
Query: 2129 FQSIHIDIVELLKQVQ--SKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYF-PTQKVYDADLAIP 2599
            FQ + +D++  L +     K Y+L ++   T + EA+ +  I   +VA AL+  + S+ G P+EI+ D+G QF S   Q L++   + S R++ YHP  N   ERF+ TLK  +    +    +W K LP +L + R  P ES  F P + +Y   +  P
Sbjct:  155 FQRVAVDLIGPLSRPSRTGKQYILTMVDYATRYPEAVALRRIDAPAVADALIQIF-SRVGFPSEILSDQGPQFMSQLLQCLWQRCGVTSLRSSPYHPQTNGLCERFNGTLKNMLRTFVEAGEGDWEKFLPCLLFAYREVPQESTGFSPFELLYGRRVRGP 313          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Xenopus
Match: nmbr (neuromedin B receptor [Source:Xenbase;Acc:XB-GENE-6074611])

HSP 1 Score: 80.8777 bits (198), Expect = 9.989e-16
Identity = 41/111 (36.94%), Postives = 71/111 (63.96%), Query Frame = 2
Query: 2129 FQSIHIDIV-ELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKA 2458
            F+ I +D+V  ++K  +   ++L+I+   T + EAIP+ N +++S+AR L+  + S+ GIP EI+ D+GT F S   +EL +   +   RT+ YHP  +  +ERF++TLK+
Sbjct:  213 FERIAMDLVGPIVKSARGHQHILVIMDYATRYPEAIPLRNTSSKSIARELVHVF-SRVGIPKEILTDQGTPFMSRVMKELCRLFKVVQLRTSVYHPQTDGLVERFNKTLKS 322          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Xenopus
Match: zpy1 (zona pellucida protein Y1 [Source:Xenbase;Acc:XB-GENE-1019596])

HSP 1 Score: 77.7962 bits (190), Expect = 1.433e-14
Identity = 45/135 (33.33%), Postives = 71/135 (52.59%), Query Frame = 2
Query: 2198 IIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYF-PTQKVYDADLAIP 2599
            ++   T + EA+ +  I   +VA AL+  + S+ G P+EI+ D+G QF S   Q L++   + S R++ YHP  N   ERF+ TLK  +    +    +W K LP +L + R  P ES  F P + +Y   +  P
Sbjct:    1 MVDYATRYPEAVALRRIDAPAVADALIQIF-SRVGFPSEILSDQGPQFMSQLLQCLWQRCGVTSLRSSPYHPQTNGLCERFNGTLKNMLRTFVEAGEGDWEKFLPCLLFAYREVPQESTGFSPFELLYGRRVQGP 134          
BLAST of Integrase catalytic domain-containing protein vs. UniProt/SwissProt
Match: sp|P10273|POL_FLV (Gag-Pol polyprotein OS=Feline leukemia virus OX=11768 GN=pol PE=3 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 2.762e-14
Identity = 49/158 (31.01%), Postives = 79/158 (50.00%), Query Frame = 2
Query: 2144 IDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITA-SSKTTRQNWTKLLPKILLSLRNCPDESRYFPTQKVYDADLAIPGPITH 2614
            +D  E+   +    YLL+ I   + W EA P  + T + VA+ LL+E   ++GIP  +  D G  F S   Q +   L I      AY P ++ ++ER +R++K  +T  + +T  ++W  LLP +L  +RN P      P + +Y A    P P+ H
Sbjct: 1421 VDFTEIKPGMYGYKYLLVFIDTFSGWAEAYPAKHETAKVVAKKLLEEIFPRYGIPQVLGSDNGPAFISQVSQSVATLLGINWKLHCAYRPQSSGQVERMNRSIKETLTKLTLETGSKDWVLLLPLVLYRVRNTPGPHGLTPFEILYGA----PPPMAH 1574          
BLAST of Integrase catalytic domain-containing protein vs. UniProt/SwissProt
Match: sp|P03360|POL_AVIRE (Gag-Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus OX=11636 GN=pol PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 3.381e-14
Identity = 43/146 (29.45%), Postives = 73/146 (50.00%), Query Frame = 2
Query: 2141 HIDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYFPTQKVY 2578
             +D  E++       YLL+++   + W+EA P    T++ V + L+ +   +FG+P +I  D G  F +   Q+L + L++      AY P ++ ++ER +RTLK  I      T  +W  LLP+ LL  R  P      P + +Y
Sbjct:  872 EVDFTEMITAKGGYKYLLVLVDTFSGWVEAYPAKRETSQVVIKHLIHDIIPRFGLPVQIGSDNGPAFVAKVTQQLCEALNVSWKLHCAYRPQSSGQVERMNRTLKETIAKLRIETGGDWVSLLPQALLRARCTPGREGLSPFEILY 1017          
BLAST of Integrase catalytic domain-containing protein vs. UniProt/SwissProt
Match: sp|P31795|POL_MLVRK (Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) OX=31689 GN=pol PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 3.685e-14
Identity = 47/148 (31.76%), Postives = 73/148 (49.32%), Query Frame = 2
Query: 2144 IDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITA-SSKTTRQNWTKLLPKILLSLRNCPDESRYFPTQKVYDA 2584
            ID  E+   +    YLL+ +   + W+EA P  + T + V + LL+E   +FG+P  +  D G  F S   Q + K L I      AY P ++ ++ER +RT+K  +T  +  T  ++W  LLP  L   RN P      P + +Y A
Sbjct:  300 IDFTEVKPGLYGYKYLLVFVDTFSGWVEAFPTKHETAKIVTKKLLEEIFPRFGMPQVLGTDNGPAFVSQVSQSVAKLLGIDWKLHCAYRPQSSGQVERMNRTIKETLTKLTLATGTRDWVLLLPLALYRARNTPGPHGLTPYEILYGA 447          
BLAST of Integrase catalytic domain-containing protein vs. UniProt/SwissProt
Match: sp|P03355|POL_MLVMS (Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) OX=928306 GN=gag-pol PE=1 SV=5)

HSP 1 Score: 78.1814 bits (191), Expect = 3.103e-13
Identity = 47/148 (31.76%), Postives = 71/148 (47.97%), Query Frame = 2
Query: 2144 IDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITA-SSKTTRQNWTKLLPKILLSLRNCPDESRYFPTQKVYDA 2584
            ID  E+   +    YLL+ I   + W+EA P    T + V + LL+E   +FG+P  +  D G  F S   Q +   L I      AY P ++ ++ER +RT+K  +T  +  T  ++W  LLP  L   RN P      P + +Y A
Sbjct: 1454 IDFTEIKPGLYGYKYLLVFIDTFSGWIEAFPTKKETAKVVTKKLLEEIFPRFGMPQVLGTDNGPAFVSKVSQTVADLLGIDWKLHCAYRPQSSGQVERMNRTIKETLTKLTLATGSRDWVLLLPLALYRARNTPGPHGLTPYEILYGA 1601          
BLAST of Integrase catalytic domain-containing protein vs. UniProt/SwissProt
Match: sp|P08361|POL_MLVCB (Gag-Pol polyprotein OS=Cas-Br-E murine leukemia virus OX=11792 GN=gag-pol PE=3 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 5.069e-13
Identity = 46/148 (31.08%), Postives = 71/148 (47.97%), Query Frame = 2
Query: 2144 IDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITA-SSKTTRQNWTKLLPKILLSLRNCPDESRYFPTQKVYDA 2584
            ID  E+   +    YLL+ +   + W+EA P    T + V + LL+E   +FG+P  +  D G  F S   Q +   L I      AY P ++ ++ER +RT+K  +T  +  T  ++W  LLP  L   RN P      P + +Y A
Sbjct: 1452 IDFTEVKPGLYGYKYLLVFVDTFSGWIEAFPTKKETAKVVTKKLLEEIFPRFGMPQVLGTDNGPAFVSKVSQTVADLLGIDWKLHCAYRPQSSGQVERMNRTIKETLTKLTLATGSRDWVLLLPLALYRARNTPGPHGLTPYEILYGA 1599          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A2L2YVP0 (Integrase catalytic domain-containing protein (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 1.054e-46
Identity = 69/160 (43.12%), Postives = 91/160 (56.88%), Query Frame = 2
Query: 2129 FQSIHIDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNC--PDESRYFPTQKVYDADLAIPG 2602
            F  +HID++  L   + K Y L  I R T WMEAIPI +IT   V+RA  + W ++FG+P +I+ D+G QF S  F+ L      K   TT YHP +N K+ERFHRTLK  I A S      WT+ LP +LL LR    PD + +   Q VY   + +PG
Sbjct:  302 FSMVHIDLIGPLPPSEGKMYCLTCIDRYTCWMEAIPIPDITANIVSRAFYENWITRFGVPTQIITDQGRQFESQLFRSLAVICGAKVQHTTPYHPQSNGKVERFHRTLKTAIKAHSNI---RWTESLPTVLLGLRTVVRPD-TNFSIAQMVYGTHIKVPG 457          

HSP 2 Score: 73.1738 bits (178), Expect = 1.054e-46
Identity = 54/173 (31.21%), Postives = 89/173 (51.45%), Query Frame = 1
Query: 1681 IYTDYKPLSHSHAKD---PSPRQWRQLQFR*ALQCSI*YCPGKTNIVADKLSR---STIQDVENCFTWSVEEIIQLQRKEMNLTV----------ETVLMDINKLVVSP----SLRKSMFKTVYELAYTGVKIT------KYVWH*VTKDIQK*YRECNECARTKIYRHIESQ 2121
            IYTD+KP+  ++ +     SPRQ RQLQ+       I +  G  N+VAD LSR    ++ D +      V+    L+ K  N+++          +T+  D + L + P      RK MF  V+ L++ G+K T      K++W  +TK+I++  + C +C + KI+RH +SQ
Sbjct:  119 IYTDHKPIIFAYKQKYEKASPRQQRQLQYISEFTTDIRHIEGSKNLVADALSRLEAVSVIDYDAIADAQVDNADLLKLKSDNVSLIFKGCILPSGKTLWCDSSTLNIRPFIPEKFRKQMFNQVHGLSHPGIKATVAQMTKKFIWPDMTKEIREWAKTCIQCQKVKIHRHTKSQ 291          

HSP 3 Score: 35.4242 bits (80), Expect = 1.054e-46
Identity = 21/50 (42.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query: 1526 AVLEQ----NGRPKSFFTKNFSET*KI*STHDIELLTIYRACKKINHYLD 1663
            AVL+Q    + RP SF++K  +++ K  ST+D ELL IY A KK  + ++
Sbjct:   64 AVLQQLEDGDWRPISFYSKKLNDSQKGYSTYDRELLGIYLAVKKFKYLIE 113          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A1Y1N1G2 (Uncharacterized protein OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 2.648e-46
Identity = 69/165 (41.82%), Postives = 98/165 (59.39%), Query Frame = 2
Query: 2129 FQSIHIDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDES-RYFPTQKVYDADLAIPGPITHQQ 2620
            F+ +HID+V  L + Q   Y+L  I R T W EAIPI+NI +E+VA+  ++ W ++FG+P ++  D+G QF ++ F  L K +  K  RTTAYHP AN  +ERFHR LK  +     TTR  WT+ LP +LL +RN   E  +    + VY   L +PG    +Q
Sbjct:  529 FEHVHIDLVGPLPESQGFKYILTCIDRYTRWTEAIPISNIESETVAQEFINHWIARFGVPLQVTTDQGRQFEAALFHSLAKLIGFKRIRTTAYHPQANGMVERFHRQLKTALRCHD-TTR--WTQALPIVLLGIRNAWKEDIQATAAEMVYGQGLKLPGEFFEKQ 690          

HSP 2 Score: 80.8777 bits (198), Expect = 2.648e-46
Identity = 56/186 (30.11%), Postives = 93/186 (50.00%), Query Frame = 1
Query: 1681 IYTDYKPLSHSHAKDP---SPRQWRQLQFR*ALQCSI*YCPGKTNIVADKLSR-------------STIQ--DVENCFTWSVEEIIQLQRKEMNLTVETVLMDINKLVVSP----SLRKSMFKTVYELAYTGVKIT------KYVWH*VTKDIQK*YRECNECARTKIYRHIESQSVFSIHSYRHR 2154
            IYTD+KP++H+  + P   SPRQ+R L +       I +  GK N++AD LSR              T Q  D+E   T      +QLQ+ +++   + +  DI++  + P      RK  F ++++L++ G+K T      K+VW  + KD  +  ++C+ C R K+ RH  + +V      RHR
Sbjct:  344 IYTDHKPITHAFQQKPEKCSPRQFRYLDYIGQFSTDIKHIAGKENVIADNLSRIDQISKGVDFDALGTDQETDLELRATLQSNTSLQLQKIQLHHAKKPIYCDISQGFIRPFVTTPFRKEAFTSLHQLSHPGIKATTKILTDKFVWPGIKKDCAQWTKQCDHCQRNKVTRHTRT-AVTPFPVTRHR 528          

HSP 3 Score: 26.1794 bits (56), Expect = 2.648e-46
Identity = 14/38 (36.84%), Postives = 19/38 (50.00%), Query Frame = 2
Query: 1550 PKSFFTKNFSET*KI*STHDIELLTIYRACKKINHYLD 1663
            P +FF+K  S        +D ELL IY+  K   H L+
Sbjct:  301 PLAFFSKKLSPAECKYGAYDRELLAIYQTIKHHKHMLE 338          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A2G8KPA7 (Pol polyprotein OS=Stichopus japonicus OX=307972 GN=BSL78_13299 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.814e-45
Identity = 70/146 (47.95%), Postives = 94/146 (64.38%), Query Frame = 2
Query: 2102 IGILNRSQC-FQSIHIDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRN 2536
            IG    +Q  FQ IH+DIV  L   +  +YLL I+ R T W EAIPI+NIT E+VA++ +  W S FG+P+ I  DRG+QF SS F+ L + L     RTTAYHP AN  +ERFHR LK+ ++A+  T   +WT++LP  LL +R 
Sbjct:  244 IGSFPMTQTRFQHIHMDIVGPLPPSEGYSYLLTIVDRFTRWPEAIPISNITAETVAKSFVKRWVSTFGVPSVITTDRGSQFESSLFRHLNQLLGTHRIRTTAYHPAANGLVERFHRQLKSALSAADST---HWTEVLPLALLGIRT 386          

HSP 2 Score: 73.1738 bits (178), Expect = 1.814e-45
Identity = 53/183 (28.96%), Postives = 91/183 (49.73%), Query Frame = 1
Query: 1666 SRAQRIYTDYKPLSHSHAKDP---SPRQWRQLQFR*ALQCSI*YCPGKTNIVADKLSRS----TIQDVENCFTWSV------EEIIQLQRKEMNLTV---------ETVLMDINKLVVSP----SLRKSMFKTVYELAYTGVKITK------YVWH*VTKDIQK*YRECNECARTKIYRHIES 2118
             R+  +YTD+KPL+++ A  P   SPR+ R L +       + + PG+ N+VAD LSR+    TI      FT         +E+IQL RK  +L +          T+  D++     P      R+++F +++ L++ G+  TK      Y+W  V KD+    + C +C + K++RH ++
Sbjct:   61 GRSFTVYTDHKPLTYAFASKPDRYSPREIRHLDYISQYSTDLRHIPGRDNVVADALSRNVYGVTISSSPLDFTAIASAQQHDDELIQL-RKSSSLKLTDVPLPAAEGTITCDVSTGTARPYIPQQFRRAVFDSLHSLSHPGINATKRLITQRYIWSNVHKDVSNWCKSCIKCQQVKVHRHTKT 242          

HSP 3 Score: 28.4906 bits (62), Expect = 1.814e-45
Identity = 19/50 (38.00%), Postives = 25/50 (50.00%), Query Frame = 2
Query: 1526 AVLEQ--NG--RPKSFFTKNFSET*KI*STHDIELLTIYRACKKINHYLD 1663
             VL+Q  NG  RP SFF+K   +     S    ELL +Y + +   H LD
Sbjct:   11 GVLQQFINGTWRPLSFFSKRLQKAETRYSAFGRELLAVYLSIRHFRHLLD 60          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A4Y2GV27 (Transposon Tf2-11 polyprotein OS=Araneus ventricosus OX=182803 GN=Tf2-11_72 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 2.430e-45
Identity = 67/158 (42.41%), Postives = 89/158 (56.33%), Query Frame = 2
Query: 2129 FQSIHIDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYFPTQKVYDADLAIPG 2602
            F  +HID++  L   +   Y L  I R  +WMEAIP+ NI+ ++VARA    W ++FG P++++ DRGTQF S   Q L K   IK   TTAYHP  N K+E  HRTLK  + A +    Q+W   LP +LL LR    E  +   Q VY   L +PG
Sbjct:  345 FCVVHIDLIGPLPPSRGNIYCLTCIDRFLNWMEAIPLDNISADTVARAFYSNWIARFGTPHKLITDRGTQFRSETLQTLSKLCGIKLQHTTAYHPACNGKVECLHRTLKTALKAHNN---QSWIDTLPTVLLGLRTAIQEDNHSIAQIVYGESLRLPG 499          

HSP 2 Score: 70.0922 bits (170), Expect = 2.430e-45
Identity = 58/180 (32.22%), Postives = 82/180 (45.56%), Query Frame = 1
Query: 1666 SRAQRIYTDYKPL---SHSHAKDPSPRQWRQLQFR*ALQCSI*YCPGKTNIVADKLSRST--------------IQDVENCFTWSVEEIIQLQRKEMNLTVETVL-MDINKLVVSP----SLRKSMFKTVYELAYTGVKIT------KYVWH*VTKDIQK*YRECNECARTKIYRHIESQ 2121
             R   IYTD+KPL    H      +PRQ RQL +       I Y  G+ N VAD LSR T               QD E     S++ I  L  KE  L     L  D +   + P    + RK +F  ++ L+++G+K T      K++W  + KD+Q   R C  C + KI RHI+++
Sbjct:  158 GRKFTIYTDHKPLIFAFHQKLDKAAPRQARQLNYISQFSTDIKYIKGENNFVADTLSRVTEVSSIDYDQIADAQTQDEE---LKSLQTITSLNLKEYPLPSGKYLWCDTSTSKIRPYIPEAFRKQIFHHIHGLSHSGIKSTIKLMNSKFIWPSIKKDVQLWTRTCIPCEKAKINRHIKTK 334          

HSP 3 Score: 35.039 bits (79), Expect = 2.430e-45
Identity = 21/52 (40.38%), Postives = 32/52 (61.54%), Query Frame = 2
Query: 1520 I*AVLEQ----NGRPKSFFTKNFSET*KI*STHDIELLTIYRACKKINHYLD 1663
            I AVL+Q      +P +F++K  ++T +  ST+D ELL IY + K   HYL+
Sbjct:  106 IGAVLQQYENSTWKPIAFYSKKLNDTQQNYSTYDRELLGIYLSVKHFKHYLE 157          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A355B9L8 (Integrase catalytic domain-containing protein (Fragment) OS=Flavobacterium sp. OX=239 GN=DDZ41_02265 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.626e-45
Identity = 72/159 (45.28%), Postives = 98/159 (61.64%), Query Frame = 2
Query: 2129 FQSIHIDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNC-PDESRYFPTQKVYDADLAIPG 2602
            F++IHID+V  L       Y+L II R T W EAIPI +I  E+VA+AL+ ++ S+FGIP+++  DRG+QF S+ FQEL K L I   RTT YHP +N  IERFHR LK  + A   T   NW++ LP +LL +R     + +    + VY   L +PG
Sbjct:  379 FENIHIDLVGPLIPSNGNEYILTIIDRFTRWTEAIPIHDIKAETVAKALVSDYISRFGIPSQLTSDRGSQFESALFQELNKALGIHKIRTTPYHPQSNGIIERFHRNLKEILIARGNTA--NWSEELPFVLLGVRTAFKTDIKCSAAELVYGQTLKVPG 535          

HSP 2 Score: 64.3142 bits (155), Expect = 2.626e-45
Identity = 52/190 (27.37%), Postives = 82/190 (43.16%), Query Frame = 1
Query: 1657 FRCSRAQRIYTDYKPLSHS--HAKDPSPRQWRQLQFR*ALQCSI*YCPGKTNIVADKLSRSTIQDVENCFTWSVEEIIQLQRKEMNLT-----VETVLMDINKLVVSPS----------------------LRKSMFKTVYELAYTGVKIT------KYVWH*VTKDIQK*YRECNECARTKIYRHIESQ 2121
            F   R   ++TD+KPL+ +     D SPRQ R L+F       I Y  G  N+VAD LSR       +     + E+I  Q+ +  LT      + +  +I   +V+P+                      LR+ +F  V+ LA+ GV+ +      KY W  + KD     + C  C ++KI +H  S+
Sbjct:  179 FLEGREFTVFTDHKPLTTAINSKTDRSPRQTRHLEFIAQYTNDIRYVKGSENVVADTLSRPDDISALHFVGIDIPEMISCQKSDPELTKHLNGSKVISQNIKLELVAPNGMSESFWCDTSKNNCRPYIPEVLRRKIFNNVHNLAHPGVRASRKKVTAKYFWPSMNKDCSSWAKTCIACQKSKITKHTRSE 368          

HSP 3 Score: 36.1946 bits (82), Expect = 2.626e-45
Identity = 22/54 (40.74%), Postives = 30/54 (55.56%), Query Frame = 2
Query: 1526 AVLEQ----NGRPKSFFTKNFSET*KI*STHDIELLTIYRACKKINHYLDVVEL 1675
             VLEQ    N  P +FF+K FS+  +  ST D ELL I+   KK  ++L+  E 
Sbjct:  132 GVLEQKCTSNWEPLAFFSKKFSDAERKYSTFDRELLAIFIGIKKFKYFLEGREF 185          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000031920.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:11094903:11101818:1 gene:ENSAMXG00000039354.1 transcript:ENSAMXT00000031920.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 2.457e-20
Identity = 50/162 (30.86%), Postives = 92/162 (56.79%), Query Frame = 2
Query: 2120 SQCFQSIHIDIVELLKQVQSKN-YLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYF-PTQKVYDADLAIP 2599
            S+ ++ I +DI+  L +   KN Y+L++    + W EA  + N   ++VA+ L +EW  ++G P  I  D+G  F S  F EL + L++  +RT+ Y P ++  IERF+RTL + ++      +Q+W  LLP ++++ R+    S  F P + ++  ++ +P
Sbjct:   34 SRPYERIALDILGPLPETPQKNRYILVVGDYFSKWTEAFSLPNQEAKTVAKVLTEEWICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTLLSMLSLFVDANQQDWDALLPFVMMAYRSSVHASTGFTPYRVLFGHEIVLP 195          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000058127.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:35454045:35455481:1 gene:ENSAMXG00000038477.1 transcript:ENSAMXT00000058127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 3.934e-20
Identity = 50/162 (30.86%), Postives = 92/162 (56.79%), Query Frame = 2
Query: 2120 SQCFQSIHIDIVELLKQVQSKN-YLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYF-PTQKVYDADLAIP 2599
            S+ ++ I +DI+  L +   KN Y+L++    + W EA  + N   ++VA+ L +EW  ++G P  I  D+G  F S  F EL + L++  +RT+ Y P ++  IERF+RTL + ++      +Q+W  LLP ++++ R+    S  F P + ++  ++ +P
Sbjct:   70 SRPYERIALDILGPLPETPQKNRYILVVGDYFSKWTEAFSLPNQEAKTVAKVLTEEWICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTLLSMLSLFVDANQQDWDALLPFVMMAYRSSVHASTGFTPYRVLFGHEIVLP 231          

HSP 2 Score: 24.2534 bits (51), Expect = 3.934e-20
Identity = 9/26 (34.62%), Postives = 16/26 (61.54%), Query Frame = 1
Query: 2020 TKYVWH*VTKDIQK*YRECNECARTK 2097
            T++ W    +D+++  REC +CA  K
Sbjct:   29 TRFYWPGWVEDVERWCRECTDCASRK 54          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000039359.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:19359511:19362411:1 gene:ENSAMXG00000043892.1 transcript:ENSAMXT00000039359.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 5.485e-20
Identity = 61/186 (32.80%), Postives = 99/186 (53.23%), Query Frame = 2
Query: 2129 FQSIHIDIVELLKQVQSKN-YLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYF-PTQKVYDADLAIPGPITHQQKETDKQMKKNNRSK-EHCST 2677
            F+ + +D V  L + +S N +LL I+   T + EAIP+  IT   + RAL+ ++ S FG+P E+  D+GT F S  FQ++ K L+IK   ++ YHP     +ERFH++LK+ +      T + W + +P +L + R    ES  F P   V+   +  P  +  +   +D    K  +S  E+ ST
Sbjct:   98 FERVLVDCVGPLPKSKSGNQFLLTIMCTATRFPEAIPLRKITAPVIVRALV-KFFSTFGLPREVQTDQGTNFMSKIFQQVMKMLNIKHVVSSPYHPEFQGALERFHQSLKSALKRYCLETGKGWDEGVPLLLFAFREAVQESLSFSPADLVFGHTVRGPLKVLQESLMSDDGTSKKTKSVLEYVST 282          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000045638.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000061.1:953511:958244:1 gene:ENSAMXG00000040892.1 transcript:ENSAMXT00000045638.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 1.368e-19
Identity = 61/186 (32.80%), Postives = 100/186 (53.76%), Query Frame = 2
Query: 2129 FQSIHIDIVELLKQVQSKN-YLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYF-PTQKVYDADLAIPGPITHQQKETDKQMKKNNRSK-EHCST 2677
            F+ + +D V  L + +S N +LL I+   T + EAIP+  IT   + RAL+ ++ S FG+P E+  D+GT F S  FQ++ K L+IK   ++ YHP +   +ERFH++LK+ +      T + W + +P +L + R    ES  F P   V+   +  P  +  +   +D    K  +S  E+ ST
Sbjct:  775 FERVLVDCVGPLPKSKSGNQFLLTIMCTATRFPEAIPLRKITAPVIVRALV-KFFSTFGLPREVQTDQGTNFMSKIFQQVMKMLNIKHVVSSPYHPESQGALERFHQSLKSALKRYCLETGKGWDEGVPLLLFAFREAVQESLSFSPADLVFGHTVRGPLKVLQESLMSDDGTSKKTKSVLEYVST 959          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000051972.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001874.1:62655:65321:1 gene:ENSAMXG00000038230.1 transcript:ENSAMXT00000051972.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 2.874e-19
Identity = 56/175 (32.00%), Postives = 87/175 (49.71%), Query Frame = 2
Query: 2090 EQKYIGIL---NRSQCFQSIHIDIVELLKQVQSKN-YLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYF-PTQKVYDADLAIP 2599
            ++K  G+L   + S+ ++   +D V  L +  S N Y+L+ +   + W+E   +   T +  A     E  ++ G P  ++ DRGT F S  F ++ K +  +   TTAYHP  N   ER +RTLK  I A        W K +P+I  +LR  P ES  F P + +Y  +LA P
Sbjct:   22 QKKPAGLLVPIHASEPWEVAGVDFVGPLPRTASGNAYILVFVDYFSKWIEVCAVREATAQVAASKFQSEVFARHGAPKYLISDRGTPFMSELFNQVLKIVGSEHRLTTAYHPQTN-ATERVNRTLKTAICAYVGDKHNTWDKYIPQICFALRTAPHESTGFSPAKMLYGRELATP 195          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045127.1 (pep primary_assembly:ASM223467v1:10:587855:593081:1 gene:ENSORLG00000029202.1 transcript:ENSORLT00000045127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 1.564e-24
Identity = 56/162 (34.57%), Postives = 96/162 (59.26%), Query Frame = 2
Query: 2120 SQCFQSIHIDIVELLKQVQSKN-YLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYF-PTQKVYDADLAIP 2599
            S+ F+ + ++I+  L +  +KN Y+L+I    + W EA P+ N   +S+A+ L +EW  +FG P  I  D+G  F S+ F+EL   LSI  +RT+ YHP ++  +ERF+RTL + +    +  + NW KLLP ++L+ R+    S  F P + ++  ++ +P
Sbjct:   35 SRPFERVALEILGPLPETPNKNKYILVISDYFSKWTEAFPLPNQEAQSIAKVLTEEWVCRFGAPRSIHSDQGRNFESTLFKELCSLLSIHKSRTSPYHPQSDGLVERFNRTLLSLLALFVEDNQLNWDKLLPYVMLAYRSSVHASTSFTPYRVLFGREIVLP 196          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000046777.1 (pep primary_assembly:ASM223467v1:16:27344439:27346119:1 gene:ENSORLG00000026527.1 transcript:ENSORLT00000046777.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 1.953e-23
Identity = 64/167 (38.32%), Postives = 96/167 (57.49%), Query Frame = 2
Query: 2129 FQSIHIDIV-ELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYF-PTQKVYDADLAIPGPITHQQK 2623
            F+ + +DIV  L+K  Q   Y+L++    T + EA P+ NITT SV + L+  + S+ GIP+EI+ D+GT FTS   Q  +K L I S +TT YHP  +  +ERF++TLK  +      T ++W + LP +L + R  P  S  F P + +Y  D  + GP+   QK
Sbjct:   50 FRRLAMDIVGPLVKSSQGHQYILVVCDYATRFPEAFPLRNITTSSVMQCLVQLF-SRTGIPDEILTDQGTNFTSRLMQLFHKQLGITSIKTTPYHPQTDGLVERFNQTLKRMLQKFVDDTGRDWHRWLPFLLFAYREVPQASTGFSPFELLYGWD--VQGPLDLLQK 213          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000034492.1 (pep primary_assembly:ASM223467v1:15:13490768:13497120:-1 gene:ENSORLG00000024904.1 transcript:ENSORLT00000034492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 2.271e-22
Identity = 64/167 (38.32%), Postives = 96/167 (57.49%), Query Frame = 2
Query: 2129 FQSIHIDIV-ELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYF-PTQKVYDADLAIPGPITHQQK 2623
            F+ + +DIV  L+K  Q   Y+L++    T + EA P+ NITT SV + L+  + S+ GIP+EI+ D+GT FTS   Q  +K L I S +TT YHP  +  +ERF++TLK  +      T ++W + LP +L + R  P  S  F P + +Y  D  + GP+   QK
Sbjct:  685 FRRLAMDIVGPLVKSSQGHQYILVVCDYATRFPEAFPLRNITTSSVMQCLVQLF-SRTGIPDEILTDQGTNFTSRLMQLFHKQLGITSIKTTPYHPQTDGLVERFNQTLKRMLQKFVDDTGRDWHRWLPFLLFAYREVPQASTGFSPFELLYGWD--VQGPLDLLQK 848          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045950.1 (pep primary_assembly:ASM223467v1:13:8284602:8288126:-1 gene:ENSORLG00000029361.1 transcript:ENSORLT00000045950.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 2.313e-22
Identity = 61/162 (37.65%), Postives = 89/162 (54.94%), Query Frame = 2
Query: 2120 SQCFQSIHIDIV-ELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYF-PTQKVYDADLAIP 2599
            S  F+ I +DIV  L+K      Y+L++    T + EA P+   T  +V RAL+  + S+ GIP+EI+ D+GT FTS   Q  YK L I   RTT YHP  +  +ERF++TLK  +      T ++W + LP +L + R  P  S  F P + +Y  D+  P
Sbjct:  140 STPFRRIAMDIVGPLVKSSSGHEYILVVCDYATRFPEAFPLRTSTAPTVVRALVQLF-SRVGIPDEILTDQGTNFTSRLMQLFYKHLGISGIRTTPYHPQMDGLVERFNQTLKKMLQKFVDDTGKDWDRWLPFLLFAYREVPQASTGFSPFELLYGWDVQGP 300          
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027816.1 (pep primary_assembly:ASM223467v1:18:24566966:24568917:1 gene:ENSORLG00000029412.1 transcript:ENSORLT00000027816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.449 bits (254), Expect = 6.874e-22
Identity = 63/168 (37.50%), Postives = 97/168 (57.74%), Query Frame = 2
Query: 2129 FQSIHIDIVELLKQVQSKN-YLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYF-PTQKVYDADLAIPGPITHQQKE 2626
            FQ I +DIV  L++  S N Y+L+I    T + EA P+  I T+++  AL+  + S+ G+P+EI+ D+GT FTS+    L+K L IK  RTT YHP  +  +ERF+++LK  +      T ++W K LP +L + R  P  S  F P + +Y     + GP+   +KE
Sbjct:  218 FQRIAMDIVGPLEKSSSGNKYILVICDYATRFPEAFPLRTIKTKAIINALVQLF-SRVGVPSEILTDQGTNFTSNLMLLLHKELGIKGIRTTPYHPQTDGLVERFNQSLKQMLRKFVSETGRDWDKWLPFLLFAYREVPQASTGFSPFELLY--GWPVQGPLDLLRKE 382          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000063194.1 (SMESG000063194.1)

HSP 1 Score: 123.635 bits (309), Expect = 4.358e-32
Identity = 81/179 (45.25%), Postives = 100/179 (55.87%), Query Frame = 2
Query: 2267 RALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDESRYFPTQKVYDADLAIPGPITHQQKETDKQMKKN-----NRSKEHCSTSI*NTIQHTK*IKRCGIHLHNKRKHCLETGYIGPNEV 2788
            R   D W S+FGIP +IV +R T+ TSS    L KGL I SNR TA H  AN KIERFHRTLKA ITA S T RQNWTKLL KILL L NC                   PG +++Q KETDKQM K      N  ++     I +  +  K ++   +++  + K CLET Y+G  +V
Sbjct:   11 RYAFDVWISRFGIPRQIVSNRRTRLTSS----LCKGLVINSNRMTACHTQANGKIERFHRTLKAAITALSNTARQNWTKLLSKILLCLINC-------------------PGTMSYQPKETDKQMIKEITEAMNIVRDQFGIPI-DIPKELKDVEY--VYIRKENKTCLETVYVGSYQV 163          

HSP 2 Score: 54.299 bits (129), Expect = 4.513e-8
Identity = 32/61 (52.46%), Postives = 35/61 (57.38%), Query Frame = 3
Query: 2652 TEAKNIVRHQFKTPFNIQNELKDVEYIYIIKENIVLKLDILV---------PMKFKLNNGE 2807
            TEA NIVR QF  P +I  ELKDVEY+YI KEN      + V         P  FKLNNGE
Sbjct:  117 TEAMNIVRDQFGIPIDIPKELKDVEYVYIRKENKTCLETVYVGSYQVLEKQPKYFKLNNGE 177          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000019458.1 (SMESG000019458.1)

HSP 1 Score: 75.485 bits (184), Expect = 9.974e-15
Identity = 51/180 (28.33%), Postives = 89/180 (49.44%), Query Frame = 2
Query: 2129 FQSIHIDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITAS--SKTTRQNWTKLLPKILLSLR-NCPDESRYFPTQKVYDADLAIPGPITHQQK---ETDKQMKKN 2650
             + I +DI   ++  +SK Y+++II R +  +    +++    ++   +L+ W  +FG P  I+ DRG  F  S F++  +   IK   ++ Y    N   ER  RT+   +T S     T+ NW +LLPKI  SL     + +++ P + VYD  + +   + H QK   E + + K N
Sbjct:   38 LEQIVVDIA-YIETKESKKYMIVIIDRFSKLVSLSFVSSQDEATILNVILNNWIYRFGRPESILTDRGRIFEGSMFRDWMEKFGIKQEFSSPYQHQLNGLAERIIRTVWDMLTTSLTEIKTKNNWCRLLPKIEFSLNATIQNSTKFSPFEIVYDRKINLYSGVGHIQKCREEIEDETKTN 216          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000000071.1 (SMESG000000071.1)

HSP 1 Score: 76.2554 bits (186), Expect = 3.635e-14
Identity = 40/89 (44.94%), Postives = 54/89 (60.67%), Query Frame = 2
Query: 2285 WKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDES 2551
            W  ++G P  I+ D+  QF S  F+ L K  +IK NRTTA++P AN KIER H+TLK  +   +K   +NW    P ILL LRN P+ +
Sbjct:  267 WIGRYGQPKTIMTDQVRQFESQLFEMLCKIYNIKRNRTTAFNPQANGKIERLHKTLKESL--RTKAEDRNWLNQPPTILLGLRNTPNST 353          

HSP 2 Score: 53.9138 bits (128), Expect = 4.413e-7
Identity = 52/178 (29.21%), Postives = 80/178 (44.94%), Query Frame = 1
Query: 1666 SRAQRIYTDYKPLSHS-HAKDPSPRQWRQLQFR*ALQCSI*YCPGKTNIVADKLSR--STIQDVENCFTWSVEEIIQLQR---KEMNLTVETVLMDIN------------KLVVSPSLRKSMFKTVYELAYTGVKIT------KYVWH*VTKDIQK*YRECNECARTKIYRHIESQSV 2127
            +R  +IYTD+KPL ++   K+PS +Q RQL F      +I Y  G TNIVAD LSR    I  +E C     E+I   Q    KE+       L  IN            +L++    R +    V+ + +   K T      +Y+W  + K+I++  + C      K  + + +Q V
Sbjct:   53 ARNFKIYTDHKPLINAMEMKNPSSKQIRQLNFISQFNRTINYVTGATNIVADTLSRIGKDINTIEFCEIIKTEQIKTKQSETLKELPAKHSLQLEKINELWYDVRKENSPRLLLPIEFRNTCISKVHHINHPRNKATYKIIYNRYIWPNMRKEIKQFVKTCKRYQINKTTKKLLTQKV 230          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000007179.1 (SMESG000007179.1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.461e-13
Identity = 42/114 (36.84%), Postives = 61/114 (53.51%), Query Frame = 2
Query: 2210 QTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKTTRQNWTKLLPKILLSLRNCPDES 2551
            +T+W E I +  I+ + +   L   W +++  P  I+ D+  QF     + L K  + K NR TAY+P AN KIER HRTLK  +   +K   +NW   LP IL   RN P+ +
Sbjct:  209 KTNWFEVISLKEISAKYICNNLEFNWIARYDQPKTIITDQERQF-----EMLCKNYNFKRNRITAYNPQANGKIERLHRTLKESL--RTKAEDRNWLNQLPTILPGQRNTPNST 315          

HSP 2 Score: 56.9954 bits (136), Expect = 4.607e-8
Identity = 33/67 (49.25%), Postives = 41/67 (61.19%), Query Frame = 1
Query: 1666 SRAQRIYTDYKPLSHS-HAKDPSPRQWRQLQFR*ALQCSI*YCPGKTNIVADKLSR--STIQDVENC 1857
            +R  +IYT +KPL +S   K+PS RQ RQL F     C+I Y  G TNIVAD LSR  + I  +E C
Sbjct:  108 ARNFKIYTGHKPLINSMEMKNPSSRQIRQLNFISQFNCTINYVIGATNIVADTLSRIETDINTIEFC 174          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000021658.1 (SMESG000021658.1)

HSP 1 Score: 67.781 bits (164), Expect = 1.888e-12
Identity = 43/136 (31.62%), Postives = 72/136 (52.94%), Query Frame = 2
Query: 2132 QSIHIDIVELLKQVQSKNYLLIIIHRQTSWMEAIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGLSIKSNRTTAYHP*ANRKIERFHRTLKAEITASSKT---TRQNWTKLLPKILLSL 2530
            + I +DI   ++  +SK Y+++II R + ++     +     ++   +L+ W  +FGIP  I+ DRG  F  S F++L +   IK   ++ Y   +N   E   RT++  + A+S T   T  NW +LLPKI  SL
Sbjct:   45 EQIVVDIA-YMETKESKKYMIVIIDRFSKFVSLSTASTQNEATILNVILNNWIYRFGIPESILTDRGRIFEGSMFRDLMEKFGIKQEFSSPYQHQSNGLAEIIIRTVRV-MLATSLTEIKTMNNWCRLLPKIEFSL 178          
The following BLAST results are available for this feature:
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR749164.12.476e-1931.20pep chromosome:GRCz11:21:30355767:30361679:1 gene:... [more]
CABZ01030006.17.140e-1734.31pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene... [more]
CABZ01070852.22.682e-1531.20pep scaffold:GRCz11:KN150605.1:59641:62078:1 gene:... [more]
CU929458.12.286e-1428.80pep chromosome:GRCz11:11:43363075:43368382:1 gene:... [more]
CR533578.32.460e-1428.80pep chromosome:GRCz11:16:23466094:23471387:-1 gene... [more]
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mybl22.834e-2134.21MYB proto-oncogene like 2 [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000023941.11.995e-1832.21pep primary_assembly:Xenopus_tropicalis_v9.1:KV463... [more]
ENSXETT00000023851.12.705e-1832.50pep primary_assembly:Xenopus_tropicalis_v9.1:KV461... [more]
nmbr9.989e-1636.94neuromedin B receptor [Source:Xenbase;Acc:XB-GENE-... [more]
zpy11.433e-1433.33zona pellucida protein Y1 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P10273|POL_FLV2.762e-1431.01Gag-Pol polyprotein OS=Feline leukemia virus OX=11... [more]
sp|P03360|POL_AVIRE3.381e-1429.45Gag-Pol polyprotein (Fragment) OS=Avian reticuloen... [more]
sp|P31795|POL_MLVRK3.685e-1431.76Pol polyprotein (Fragment) OS=Radiation murine leu... [more]
sp|P03355|POL_MLVMS3.103e-1331.76Gag-Pol polyprotein OS=Moloney murine leukemia vir... [more]
sp|P08361|POL_MLVCB5.069e-1331.08Gag-Pol polyprotein OS=Cas-Br-E murine leukemia vi... [more]
back to top
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2L2YVP01.054e-4643.13Integrase catalytic domain-containing protein (Fra... [more]
A0A1Y1N1G22.648e-4641.82Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A2G8KPA71.814e-4547.95Pol polyprotein OS=Stichopus japonicus OX=307972 G... [more]
A0A4Y2GV272.430e-4542.41Transposon Tf2-11 polyprotein OS=Araneus ventricos... [more]
A0A355B9L82.626e-4545.28Integrase catalytic domain-containing protein (Fra... [more]
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000031920.12.457e-2030.86pep primary_assembly:Astyanax_mexicanus-2.0:12:110... [more]
ENSAMXT00000058127.13.934e-2030.86pep primary_assembly:Astyanax_mexicanus-2.0:16:354... [more]
ENSAMXT00000039359.15.485e-2032.80pep primary_assembly:Astyanax_mexicanus-2.0:5:1935... [more]
ENSAMXT00000045638.11.368e-1932.80pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051972.12.874e-1932.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045127.11.564e-2434.57pep primary_assembly:ASM223467v1:10:587855:593081:... [more]
ENSORLT00000046777.11.953e-2338.32pep primary_assembly:ASM223467v1:16:27344439:27346... [more]
ENSORLT00000034492.12.271e-2238.32pep primary_assembly:ASM223467v1:15:13490768:13497... [more]
ENSORLT00000045950.12.313e-2237.65pep primary_assembly:ASM223467v1:13:8284602:828812... [more]
ENSORLT00000027816.16.874e-2237.50pep primary_assembly:ASM223467v1:18:24566966:24568... [more]
back to top
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063194.14.358e-3245.25SMESG000063194.1[more]
SMESG000019458.19.974e-1528.33SMESG000019458.1[more]
SMESG000000071.13.635e-1444.94SMESG000000071.1[more]
SMESG000007179.11.461e-1336.84SMESG000007179.1[more]
SMESG000021658.11.888e-1231.62SMESG000021658.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012288 ID=SMED30012288|Name=Integrase catalytic domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2992bp
TATTATTAATATTATTATTATTACTATAAAACGATTTTATTTCTTACTAG
CAGTATAATTTGAATTTCAAGCAAGTAAATAAAAAAATAATCCTTAACAA
TCTCATCAAGTTGATAAGCATTATTTTATAATCGAAATCTAGATTTTTTC
TTCATAATAGTTTCACTTTCGGGTTTTTGACTGCCAATGTTTTTAGACAC
ATATGAGCATTATATAAATTAAGGAAGCAAATAAAAAGAAAAGAACTGTA
ATGATTTTGACGATATCACAAAATAGTAACATATTACGTAGCAGTATTTT
CATCTAATTTACAAGAAATATATTACGTTGCGGTATTTTAATCGTGAATA
TTAGTCTGTAATATTAATATAGTTTTGTCATTCAAATTGCTTTGACTTCT
TCAATTTGTCATGGAACAACAATAACCAAATAAAATCCTATATTACATAA
CCATAAAAATTGCATTGCTGAATAAGTTAAAATTATCTTACCACTAATTC
AAATTTGTCTGACAGCGATCGTTGTCAGAGCTGTGAAAATAAGAAATTTT
AACTGAAAATGAATTAGTGTTTGATTTATTAAATTTCACGTGTATATTTA
TACTGAATTTGAGTTGGTGTGTTTGCTGCTGTTTAGGGCATTCCACGCCT
TTTCATGCCTATATGTTACTTCAATATTACTATTATAAATTGTTTATTTT
GAAATAATTATTAATTGCATTGATGTTTAAATTGGTAACTTATAATATTA
AAATTGTTTATATATTTGATTTTTAATGAAATACAGAATTTGAATTTGAG
TTTGACTTTTAATAATGTTGGCAACTACGCAGAGACCCATATGATATCAA
TAAAGCCTCCTCGGTTTTATTATTCAAGTTCGAGATTATGATTTTAACAA
ATGGAATCACAATTCACCCTTGTTGGAATCAAGAATAATAATCTTAAATA
TCATCACGTTTGGTCAGTTCTCTCTGAGGATATTGCGACCAACATCCCAA
GACAGCTTTCAGAAAATCAAAGTTATGAAAAACTTAAATAATTCATAATG
TAAAATGGCCAAAAATCTAAAACAGCTACACTCGAAGAATTTTTGGGAAA
AGATTGGGTACCTCAACAATAAACACCTTAGAGGTACTAATTTCAAAATG
GTGCCACATCAATACATTATCCATAGTAAGTGAGGGAATAAAATTTATAA
TTGATACAGGTGCTAATTTTCGTGTTTACCGATAAAGGTTTTCCAACCAT
CATTAGATTGTTCCACAATTCTTCCAACTGCTCATCAATTAAATTGTTCG
GGAACAAGAACATTTCAATTAATTTAAATGGAAAAATTTAATATAGGATG
TTTCATGTTTGTAATGTTTCACAAGCAATATTGGGCTGCTTTTTTCTTGA
AAAACATCAACCAATTCTGGACTGTGTAAAAAAAGATATTATCATTATTG
TAATTGAATAAAAGTGTGAACATTCAGTCAAACATGAAATCCACTTAACA
AGAACTCCAAATAGATACGATTTGAGCAGTTTTGGAACAAAATGGTAGAC
CTAAATCATTTTTCACTAAGAACTTTTCAGAAACATAGAAAATATAGAGT
ACCCACGATATAGAACTTCTAACAATTTATCGCGCATGTAAAAAAATTAA
CCATTATTTAGATGTAGTAGAGCTCAAAGAATATATACGGATTACAAACC
GCTGTCTCATAGCCATGCAAAGGATCCGTCTCCTCGTCAATGGAGACAAC
TACAATTTAGATAAGCTCTTCAATGCTCAATATAATATTGTCCTGGAAAA
ACAAATATTGTAGCTGATAAACTTTCCAGATCAACAATACAAGATGTAGA
AAATTGCTTTACGTGGTCAGTCGAAGAAATAATTCAGCTACAAAGAAAGG
AAATGAACCTCACGGTCGAAACGGTTCTAATGGATATAAACAAGCTAGTA
GTTTCACCATCTTTAAGAAAATCGATGTTCAAAACAGTGTATGAGCTTGC
TTATACTGGTGTTAAGATTACGAAATATGTGTGGCATTAAGTGACAAAGG
ATATACAGAAATGATACCGAGAGTGTAATGAATGTGCTCGAACAAAAATA
TATAGGCATATTGAATCGCAGTCAGTGTTTTCAATCCATTCATATAGACA
TCGTTGAGCTTTTAAAACAAGTACAAAGTAAAAATTATTTATTAATCATA
ATACACAGGCAAACATCTTGGATGGAAGCAATACCTATTGCAAACATAAC
GACAGAAAGTGTTGCAAGAGCATTACTTGATGAGTGGAAATCGAAATTCG
GCATACCAAATGAAATTGTCTTAGATAGAGGAACTCAATTCACCAGTAGC
TTTTTTCAAGAACTATACAAAGGTTTGAGTATAAAGAGTAACAGAACGAC
AGCATATCATCCTTAAGCTAATAGAAAAATTGAAAGATTCCATCGAACTT
TGAAAGCGGAAATTACAGCATCATCAAAGACTACTCGTCAAAATTGGACA
AAATTACTACCAAAAATATTGTTATCTTTGAGAAACTGTCCAGATGAATC
AAGATATTTTCCGACTCAGAAAGTTTATGATGCTGATCTAGCCATTCCAG
GACCCATAACCCATCAGCAAAAAGAAACGGATAAACAAATGAAAAAAAAT
AACAGAAGCAAAGAACATTGTTCGACATCAATTTAAAACACCATTCAACA
TACAAAATGAATTAAAAGATGTGGAATACATTTACATAATAAAAGAAAAC
ATTGTCTTGAAACTGGATATATTGGTCCCAATGAAGTTCAAGCTTAATAA
TGGCGAATCTGTCTTAGTAGATCGATTAAAACCAGCGTTCTTATCACTGG
AGGCGTTTCAGACTTGACGGGGAGGAATGTTATAAATTGCTTATTTGGAT
ATTAATATTAATTGTATTGATGTTTAAATTGGTAATTTATAATATTAAAT
TTGTTTATATATTTGATATTTTAATGAAATATAGAATTTGAG
back to top

protein sequence of SMED30012288-orf-1

>SMED30012288-orf-1 ID=SMED30012288-orf-1|Name=SMED30012288-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=113bp
MNVLEQKYIGILNRSQCFQSIHIDIVELLKQVQSKNYLLIIIHRQTSWME
AIPIANITTESVARALLDEWKSKFGIPNEIVLDRGTQFTSSFFQELYKGL
SIKSNRTTAYHP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036397RNaseH_sf
IPR012337RNaseH-like_sf
IPR001584Integrase_cat-core
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0004190aspartic-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001584Integrase, catalytic corePFAMPF00665rvecoord: 18..112
e-value: 1.6E-10
score: 41.2
IPR001584Integrase, catalytic corePROSITEPS50994INTEGRASEcoord: 13..112
score: 13.367
IPR036397Ribonuclease H superfamilyGENE3DG3DSA:3.30.420.10coord: 11..112
e-value: 6.6E-27
score: 96.0
NoneNo IPR availablePANTHERPTHR24559:SF292coord: 3..112
NoneNo IPR availablePANTHERPTHR24559FAMILY NOT NAMEDcoord: 3..112
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 15..112