SMED30012285

Overview
NameSMED30012285
Smed IDSMED30012285
Length (bp)970
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30012285 (SMED30012285) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30012285 (SMED30012285) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30012285 (SMED30012285) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30012285 (SMED30012285) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012285

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30012285SMESG000004979.1 SmedASXL_007771SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30012285SMESG000004979.1 dd_Smed_v4_16079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012285SMESG000004979.1 dd_Smed_v4_16079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012285SMESG000004979.1 dd_Smed_v4_16079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012285SMESG000004979.1 dd_Smed_v4_16079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012285SMESG000004979.1 dd_Smed_v4_16079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012285SMESG000004979.1 Contig2426newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012285SMESG000004979.1 Contig2426uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012285SMESG000020570.1 Contig2426newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012285SMESG000020570.1 Contig2426uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30012285 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000114:16472..27161 +4309
Homology
BLAST of SMED30012285 vs. Ensembl Human
Match: TSPAN3 (tetraspanin 3 [Source:HGNC Symbol;Acc:HGNC:17752])

HSP 1 Score: 50.8322 bits (120), Expect = 7.023e-7
Identity = 38/158 (24.05%), Postives = 69/158 (43.67%), Query Frame = 2
Query:  311 VFLFVICSTYMHFSGIMYLILKLTSFSIQFVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLN-SSSYCIRNISYSVGCKTTLWKKLYD 781
             ++F+    Y HF   +Y ++          L+  I +    +    +   + T+ N  +  +Q +   Y G   ++  +  +DY Q Q  CCG +  +D+ N  W ++    N S     PLSCC +T  N + S    +  Y+ GC+  + KKL +
Sbjct:   32 AYVFITYDDYDHFFEDVYTLIPAVVIIAVGALLFIIGLIGCCATIRESRCGLATVENEVDRSIQKVYKTYNGTNPDA-ASRAIDYVQRQLHCCGIHNYSDWENTDWFKETK--NQS----VPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQE 182          
BLAST of SMED30012285 vs. Ensembl Human
Match: TSPAN3 (tetraspanin 3 [Source:HGNC Symbol;Acc:HGNC:17752])

HSP 1 Score: 49.2914 bits (116), Expect = 2.044e-6
Identity = 31/109 (28.44%), Postives = 51/109 (46.79%), Query Frame = 2
Query:  458 IYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLN-SSSYCIRNISYSVGCKTTLWKKLYD 781
            +Y   + N  +  +Q +   Y G   ++     +DY Q Q  CCG +  +D+ N  W ++    N S     PLSCC +T  N + S    +  Y+ GC+  + KKL +
Sbjct:   42 VYRAKVENEVDRSIQKVYKTYNGTNPDAASRA-IDYVQRQLHCCGIHNYSDWENTDWFKETK--NQS----VPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQE 143          
BLAST of SMED30012285 vs. Ensembl Human
Match: TSPAN3 (tetraspanin 3 [Source:HGNC Symbol;Acc:HGNC:17752])

HSP 1 Score: 48.9062 bits (115), Expect = 3.842e-6
Identity = 31/109 (28.44%), Postives = 52/109 (47.71%), Query Frame = 2
Query:  458 IYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLN-SSSYCIRNISYSVGCKTTLWKKLYD 781
            +Y   + N  +  +Q +   Y G   ++  +  +DY Q Q  CCG +  +D+ N  W ++    N S     PLSCC +T  N + S    +  Y+ GC+  + KKL +
Sbjct:  106 VYRAKVENEVDRSIQKVYKTYNGTNPDA-ASRAIDYVQRQLHCCGIHNYSDWENTDWFKETK--NQS----VPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQE 207          
BLAST of SMED30012285 vs. Ensembl Zebrafish
Match: tspan3b (tetraspanin 3b [Source:ZFIN;Acc:ZDB-GENE-070424-42])

HSP 1 Score: 48.521 bits (114), Expect = 3.280e-6
Identity = 35/131 (26.72%), Postives = 58/131 (44.27%), Query Frame = 2
Query:  392 IQFVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLNSSSYCIRNIS-YSVGCKTTLWKKLYD 781
            + F  +L +     +   +L  IY   +       +Q + + Y+G   ++  +  +DY Q Q  CCG +  +D++N  W   I   N S     P+SCC  T  N +   +R    Y  GC+  + KKL D
Sbjct:   84 VTFSAVLLLVFATEVVVVVLGYIYRAKVEAVVNHSIQKVYNEYKGTNTDA-PSRAIDYVQRQLHCCGIHNYSDWMNTHWF--IESKNNS----VPVSCCKPTISNCTGTLMRPGDLYPEGCEVLVVKKLKD 207          
BLAST of SMED30012285 vs. Ensembl Zebrafish
Match: tspan3b (tetraspanin 3b [Source:ZFIN;Acc:ZDB-GENE-070424-42])

HSP 1 Score: 48.521 bits (114), Expect = 3.280e-6
Identity = 35/131 (26.72%), Postives = 58/131 (44.27%), Query Frame = 2
Query:  392 IQFVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLNSSSYCIRNIS-YSVGCKTTLWKKLYD 781
            + F  +L +     +   +L  IY   +       +Q + + Y+G   ++  +  +DY Q Q  CCG +  +D++N  W   I   N S     P+SCC  T  N +   +R    Y  GC+  + KKL D
Sbjct:   84 VTFSAVLLLVFATEVVVVVLGYIYRAKVEAVVNHSIQKVYNEYKGTNTDA-PSRAIDYVQRQLHCCGIHNYSDWMNTHWF--IESKNNS----VPVSCCKPTISNCTGTLMRPGDLYPEGCEVLVVKKLKD 207          
BLAST of SMED30012285 vs. Ensembl Mouse
Match: Tspan3 (tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098])

HSP 1 Score: 48.9062 bits (115), Expect = 3.141e-6
Identity = 32/110 (29.09%), Postives = 53/110 (48.18%), Query Frame = 2
Query:  458 IYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLNSSSYCIRNIS--YSVGCKTTLWKKLYD 781
            +Y   + N  +  +Q +   Y G   ++  +  +DY Q Q  CCG +  +D+ N  W ++    N S     PLSCC +T   S +  + N S  Y+ GC+  + KKL +
Sbjct:  106 VYRAKVENEVDRSIQKVYKTYNGTNSDA-ASRAIDYVQRQLHCCGIHNYSDWENTDWFKETK--NQS----VPLSCCRET-AKSCNGSLANPSDLYAEGCEALVVKKLQE 207          
BLAST of SMED30012285 vs. Ensembl Mouse
Match: Tspan3 (tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098])

HSP 1 Score: 48.521 bits (114), Expect = 4.138e-6
Identity = 32/110 (29.09%), Postives = 53/110 (48.18%), Query Frame = 2
Query:  458 IYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLNSSSYCIRNIS--YSVGCKTTLWKKLYD 781
            +Y   + N  +  +Q +   Y G   ++  +  +DY Q Q  CCG +  +D+ N  W ++    N S     PLSCC +T   S +  + N S  Y+ GC+  + KKL +
Sbjct:  109 VYRAKVENEVDRSIQKVYKTYNGTNSDA-ASRAIDYVQRQLHCCGIHNYSDWENTDWFKETK--NQS----VPLSCCRET-AKSCNGSLANPSDLYAEGCEALVVKKLQE 210          
BLAST of SMED30012285 vs. TrEMBL
Match: A0A3R7BY80 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_6020s PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 5.929e-9
Identity = 44/153 (28.76%), Postives = 73/153 (47.71%), Query Frame = 2
Query:  317 LFVICSTYMHFSGIMYLILKLTSFSIQFVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNI--KWNRQISFGNASYYLAYPLSCCN----DTFLNSSSYCIRNISYSVGCKT 757
            L VI +  + F G+      L  F++  +++LF++      Y L+A  + Q   ++    +  L   Y G   ++F+T L+++ Q   QCCG Y  T++ N   KW R+I +G   Y L  P+SCC     D   N +  C   + Y  GC +
Sbjct:   29 LLVIINGALLFLGMFCRARFLLHFAMVMMILLFLAETICYIYYLVA--WEQMEFDAMVDTISGLRKAYLGAISDNFQTFLLNFIQQNFQCCGIYSFTEWFNPSYKWTRKIVYGGKEYELRIPISCCPNVSADRVPNCALKCATEMPYEHGCAS 179          
BLAST of SMED30012285 vs. TrEMBL
Match: G7YKX9 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_110615 PE=3 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 2.682e-8
Identity = 44/151 (29.14%), Postives = 71/151 (47.02%), Query Frame = 2
Query:  317 LFVICSTYMHFSGIMYLILKLTSFSIQFVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNI--KWNRQISFGNASYYLAYPLSCCN----DTFLNSSSYCIRNISYSVGC 751
            L VI +  + F G+      L  F++  + +LF++      Y L+A  + Q   ++    +  L   Y G   ++F+T L+++ Q   QCCG Y  T++ N   KW R+I +G   Y L  P+SCC     D   N +  C   + Y  GC
Sbjct:   29 LLVIINGALLFLGMFCRARFLLHFAMVMMSLLFLAETICYIYYLVA--WEQMEFDAMVDTISGLRKAYLGAISDNFQTFLLNFIQQNFQCCGIYSFTEWFNPSYKWTRKIVYGGKEYELRIPISCCPNVSADRVPNCALKCATEMPYEHGC 177          
BLAST of SMED30012285 vs. TrEMBL
Match: K1PZJ8 (Transient receptor potential cation channel subfamily V member 6 OS=Crassostrea gigas OX=29159 GN=CGI_10012744 PE=3 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.662e-7
Identity = 40/142 (28.17%), Postives = 70/142 (49.30%), Query Frame = 2
Query:  359 MYLILKLTSFSIQFVLMLFISIGFSLSYTLLANIYIQTLMNS-TETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIK-WNRQISFGNASYYLAYPLSCCNDTFLNSSSYCI---RNISYSVGCKTTLWK 769
            +Y  + +T   ++F+L++ I  GFS S           +M S  +T    ++S Y+GL GN+ +T   ++  T+ QCCG YG +D+   + W   +  G  +Y L  P+ CC++   ++   C       + + GC   LWK
Sbjct: 1684 LYAAILITFLIVEFILVIVI-YGFSDS----------MMMGSIKKTLTSVVVSEYQGLVGNNTETFGWNFIMTKYQCCGVYGYSDFTATEVWKSSLVAGGTTYNLKIPIVCCDELPSSTDLNCTGTKTGTNANKGCFEELWK 1814          
BLAST of SMED30012285 vs. TrEMBL
Match: A0A267GYU1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015017g1 PE=3 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.055e-6
Identity = 46/181 (25.41%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  263 DLDSVMNSLKDSWLKLVFLFVICSTYMHFSGIMYLILKLTSFSIQ---FVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISN-YEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIK-WNRQISFGNASYY-LAYPLSCCNDT----FLNSSSYCIRNISYSVGCKTTLWKKL 775
            D+++ +  L      L   F+I    +   G++ L+       I    ++++L I I   ++  ++      T ++  +T++Q  I+N Y G    + +T+L + F T   CCG    TD+ + K W R +++ + SY  +AYPL+CC  +     L S+   I+  + +VGC    W+K+
Sbjct:   63 DIETYIQQLPQITGNLAVTFIIMGIVIAAVGVIGLVAVCCEVKIMLIIYIVLLGILIAGQVTLIIVYYAARDTFISRAKTYMQDTINNKYSGYSNMNMETILWNVFHTSLGCCGITNGTDFASAKLWTRNVTYNSVSYTNIAYPLTCCRTSNYTGCLQSNHTSIQYTNLNVGC----WEKI 239          
BLAST of SMED30012285 vs. TrEMBL
Match: A0A1I8GVT5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003371g1 PE=3 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.180e-6
Identity = 46/181 (25.41%), Postives = 90/181 (49.72%), Query Frame = 2
Query:  263 DLDSVMNSLKDSWLKLVFLFVICSTYMHFSGIMYLIL---KLTSFSIQFVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISN-YEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIK-WNRQISFGNASYY-LAYPLSCCNDT----FLNSSSYCIRNISYSVGCKTTLWKKL 775
            D+++ +  L      L   F+I    +   G++ L+    ++    I ++++L I I   ++  ++      T ++  +T++Q  I+N Y G    + +T+L + F T   CCG    TD+ + K W R +++ + SY  +AYPL+CC  +     L S+   I+  + +VGC    W+K+
Sbjct:   63 DIETYIQQLPQITGNLAVTFIIMGIVIAAVGVIGLVAVCCEVKVMLIIYIVLLGILIAGQVTLIIVYYAARDTFISRAKTYMQDTINNKYSGYSNMNMETILWNVFHTSLGCCGITNGTDFASAKLWTRNVTYNSVSYTNIAYPLTCCRTSNYTGCLQSNHTSIQYTNLNVGC----WEKI 239          
BLAST of SMED30012285 vs. Ensembl Medaka
Match: tspan3a (tetraspanin-3 [Source:NCBI gene;Acc:101170088])

HSP 1 Score: 49.6766 bits (117), Expect = 1.288e-6
Identity = 37/140 (26.43%), Postives = 67/140 (47.86%), Query Frame = 2
Query:  377 LTSFSIQFVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLNSSSYCIRNISYS-----VGCKTTLWKKLYD 781
            LT+F I  +L++F+S    ++  +L  +Y   + +   + +  +   Y G   NS ++  +DY Q Q QCCG +  TD+L  +W  +    +       P+SCC  T     S C  ++++       GC+  + KKL +
Sbjct:   83 LTTFVI-ILLLVFLS---EVAVVVLGYVYRAKIEDEVNSSIVVVYEEYNGTNSNS-QSRAIDYTQRQLQCCGIHNYTDWLKTRWYEKTKNNSV------PISCCKTTV----SGCTGSLTHPEDLFKEGCEALVVKKLKE 207          
BLAST of SMED30012285 vs. Planmine SMEST
Match: SMESG000004979.1 (SMESG000004979.1)

HSP 1 Score: 479.945 bits (1234), Expect = 4.117e-173
Identity = 246/247 (99.60%), Postives = 246/247 (99.60%), Query Frame = 2
Query:  179 MLGSNVNMTQTIVQNQFKISNYSQTQISDLDSVMNSLKDSWLKLVFLFVICSTYMHFSGIMYLILKLTSFSIQFVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLNSSSYCIRNISYSVGCKTTLWKKLYDNGTFFNSVSNHFVPLLIFELINAXXXXXXAIGKCSRNFNHKVYNKF 919
            MLGSNVNMTQTIVQNQFKISNYSQTQISDLDSVMNSLKDSWLKLVFLFVICSTYMHFSGIMYLILKLTSFSIQFVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLNSSSYCIRNISYSVGCKTTLWKKLYDN TFFNSVSNHFVPLLIFELINAVLLVVLAIGKCSRNFNHKVYNKF
Sbjct:    1 MLGSNVNMTQTIVQNQFKISNYSQTQISDLDSVMNSLKDSWLKLVFLFVICSTYMHFSGIMYLILKLTSFSIQFVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLNSSSYCIRNISYSVGCKTTLWKKLYDNETFFNSVSNHFVPLLIFELINAVLLVVLAIGKCSRNFNHKVYNKF 247          
BLAST of SMED30012285 vs. Planmine SMEST
Match: SMESG000004979.1 (SMESG000004979.1)

HSP 1 Score: 467.618 bits (1202), Expect = 3.006e-168
Identity = 239/240 (99.58%), Postives = 239/240 (99.58%), Query Frame = 2
Query:  200 MTQTIVQNQFKISNYSQTQISDLDSVMNSLKDSWLKLVFLFVICSTYMHFSGIMYLILKLTSFSIQFVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLNSSSYCIRNISYSVGCKTTLWKKLYDNGTFFNSVSNHFVPLLIFELINAXXXXXXAIGKCSRNFNHKVYNKF 919
            MTQTIVQNQFKISNYSQTQISDLDSVMNSLKDSWLKLVFLFVICSTYMHFSGIMYLILKLTSFSIQFVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLNSSSYCIRNISYSVGCKTTLWKKLYDN TFFNSVSNHFVPLLIFELINAVLLVVLAIGKCSRNFNHKVYNKF
Sbjct:    1 MTQTIVQNQFKISNYSQTQISDLDSVMNSLKDSWLKLVFLFVICSTYMHFSGIMYLILKLTSFSIQFVLMLFISIGFSLSYTLLANIYIQTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKWNRQISFGNASYYLAYPLSCCNDTFLNSSSYCIRNISYSVGCKTTLWKKLYDNETFFNSVSNHFVPLLIFELINAVLLVVLAIGKCSRNFNHKVYNKF 240          
BLAST of SMED30012285 vs. Planmine SMEST
Match: SMESG000005510.1 (SMESG000005510.1)

HSP 1 Score: 48.9062 bits (115), Expect = 1.915e-6
Identity = 25/78 (32.05%), Postives = 39/78 (50.00%), Query Frame = 2
Query:  467 QTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNI-KW-NRQISFGNASYYLAYPLSCCND 694
            Q + N  E  +  LI  YEG    + ++++++  QTQ  CCG Y  +D+    KW  R++ F        +PLSCC  
Sbjct:  137 QKIFNYVEKNLYKLIEKYEGYNATNVESLIINVIQTQAHCCGLYNYSDFDRAEKWVGRKLGF-------KFPLSCCES 207          
BLAST of SMED30012285 vs. Planmine SMEST
Match: SMESG000041117.1 (SMESG000041117.1)

HSP 1 Score: 48.521 bits (114), Expect = 2.702e-6
Identity = 32/113 (28.32%), Postives = 52/113 (46.02%), Query Frame = 2
Query:  467 QTLMNSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIK--WNRQISFGNASYYLAYPLSCCN-----DTFLNSSSYCIRNISYS---VGCKTTLWKKL 775
            + L+  T T    +IS Y  +     +++L++  Q    CCG Y  TDY N    + +  +  N +Y + +PLSCC+        + S   CI+  + S   +GC T L   L
Sbjct:  137 RILVPLTNTIQNDIISKYRDMNSTEPQSMLINVIQITANCCGVYNYTDYNNATNFYRQATASDNKNYPIIFPLSCCDYKQDFTIDMASRDSCIKTQTSSKMNMGCYTRLEPDL 249          
The following BLAST results are available for this feature:
BLAST of SMED30012285 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TSPAN37.023e-724.05tetraspanin 3 [Source:HGNC Symbol;Acc:HGNC:17752][more]
TSPAN32.044e-628.44tetraspanin 3 [Source:HGNC Symbol;Acc:HGNC:17752][more]
TSPAN33.842e-628.44tetraspanin 3 [Source:HGNC Symbol;Acc:HGNC:17752][more]
back to top
BLAST of SMED30012285 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012285 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012285 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tspan3b3.280e-626.72tetraspanin 3b [Source:ZFIN;Acc:ZDB-GENE-070424-42... [more]
tspan3b3.280e-626.72tetraspanin 3b [Source:ZFIN;Acc:ZDB-GENE-070424-42... [more]
back to top
BLAST of SMED30012285 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012285 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tspan33.141e-629.09tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098][more]
Tspan34.138e-629.09tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098][more]
back to top
BLAST of SMED30012285 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012285 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7BY805.929e-928.76Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
G7YKX92.682e-829.14Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
K1PZJ82.662e-728.17Transient receptor potential cation channel subfam... [more]
A0A267GYU11.055e-625.41Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GVT51.180e-625.41Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30012285 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012285 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012285 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012285 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012285 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tspan3a1.288e-626.43tetraspanin-3 [Source:NCBI gene;Acc:101170088][more]
back to top
BLAST of SMED30012285 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000004979.14.117e-17399.60SMESG000004979.1[more]
SMESG000004979.13.006e-16899.58SMESG000004979.1[more]
SMESG000005510.11.915e-632.05SMESG000005510.1[more]
SMESG000041117.12.702e-628.32SMESG000041117.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012285 ID=SMED30012285|Name=SMED30012285|organism=Schmidtea mediterranea sexual|type=transcript|length=970bp
CAATGGACTTTGTTTTACCAGAAGATTCTAAAAACAGAATTGTTTATTCA
TTAAAATATCCTTTTTTTAATGTTACCATTGATTGATAATGATAAATATT
TTTTAATTTTTATTAAAAATTATAATTGACAATCTTCAGATTCTTTTCCT
AGTTTATCTGACTATATTTATTGGCATCATGCTTGGAAGCAATGTCAACA
TGACACAAACTATTGTTCAAAACCAGTTCAAAATCTCGAATTATTCCCAG
ACGCAAATTTCTGATCTTGATTCGGTCATGAATTCGTTGAAAGATTCGTG
GTTGAAATTAGTATTTTTATTTGTGATCTGCTCCACTTACATGCATTTCA
GTGGGATCATGTACTTGATCTTAAAGTTAACTTCTTTTTCAATACAATTC
GTTCTTATGCTATTTATATCAATTGGATTTTCCCTTTCTTACACATTATT
GGCCAACATATATATCCAAACTTTAATGAATTCAACAGAAACATTTGTTC
AATCTTTAATCTCTAACTACGAAGGTCTTGGTGGAAATTCATTCAAAACC
GTATTAGTCGACTATTTCCAAACTCAAAATCAGTGCTGTGGGTTCTATGG
AAATACTGACTATCTAAACATAAAATGGAATAGACAAATATCCTTCGGAA
ATGCATCTTATTACCTGGCATATCCACTGAGTTGTTGCAATGATACTTTC
CTCAACAGTTCTAGTTATTGCATTCGGAATATATCGTATTCGGTGGGATG
CAAAACAACACTTTGGAAGAAACTTTATGACAATGGAACTTTCTTCAATT
CTGTTTCAAATCACTTTGTTCCTCTATTAATATTTGAATTAATCAATGCA
GTGCTCCTAGTCGTGCTTGCAATCGGAAAATGTTCGAGGAATTTTAATCA
TAAAGTTTACAATAAATTTTAGTTAAAATTTTTCTACAAATCTGTGAAAA
ACTGAAATTGTAAATTGTCA
back to top

protein sequence of SMED30012285-orf-1

>SMED30012285-orf-1 ID=SMED30012285-orf-1|Name=SMED30012285-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=248bp
MLGSNVNMTQTIVQNQFKISNYSQTQISDLDSVMNSLKDSWLKLVFLFVI
CSTYMHFSGIMYLILKLTSFSIQFVLMLFISIGFSLSYTLLANIYIQTLM
NSTETFVQSLISNYEGLGGNSFKTVLVDYFQTQNQCCGFYGNTDYLNIKW
NRQISFGNASYYLAYPLSCCNDTFLNSSSYCIRNISYSVGCKTTLWKKLY
DNGTFFNSVSNHFVPLLIFELINAVLLVVLAIGKCSRNFNHKVYNKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 98..199
NoneNo IPR availableTMHMMTMhelixcoord: 74..96
NoneNo IPR availableTMHMMTMhelixcoord: 42..64
NoneNo IPR availableTMHMMTMhelixcoord: 211..233