Receptor protein serine/threonine kinase

Overview
NameReceptor protein serine/threonine kinase
Smed IDSMED30012283
Length (bp)1665
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor protein serine/threonine kinase (SMED30012283) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor protein serine/threonine kinase (SMED30012283) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Human
Match: ACVR2A (activin A receptor type 2A [Source:HGNC Symbol;Acc:HGNC:173])

HSP 1 Score: 238.81 bits (608), Expect = 1.565e-72
Identity = 128/302 (42.38%), Postives = 187/302 (61.92%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            ++ A+GRFG VW    +  NE+    VA+KIF    + K+SW+NE  VYS L    H NIL++ GAE+R      +LWL+  ++  GSL ++LK + V+W++L  I + +A GLA+LH             I+HRDIKSKN+LLK N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE+ SR   +D  + ++  PF+E +G++PS E +++ V  KK RP   + W     +    +TI ECWD D +ARLSA CV ER+  +  + +I
Sbjct:   88 EVKARGRFGCVWKA--QLLNEY----VAVKIFP--IQDKQSWQNEYEVYS-LPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNI 380          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Human
Match: ACVR2A (activin A receptor type 2A [Source:HGNC Symbol;Acc:HGNC:173])

HSP 1 Score: 238.81 bits (608), Expect = 2.515e-71
Identity = 128/302 (42.38%), Postives = 187/302 (61.92%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            ++ A+GRFG VW    +  NE+    VA+KIF    + K+SW+NE  VYS L    H NIL++ GAE+R      +LWL+  ++  GSL ++LK + V+W++L  I + +A GLA+LH             I+HRDIKSKN+LLK N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE+ SR   +D  + ++  PF+E +G++PS E +++ V  KK RP   + W     +    +TI ECWD D +ARLSA CV ER+  +  + +I
Sbjct:  196 EVKARGRFGCVWKA--QLLNEY----VAVKIFP--IQDKQSWQNEYEVYS-LPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNI 488          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Human
Match: ACVR2A (activin A receptor type 2A [Source:HGNC Symbol;Acc:HGNC:173])

HSP 1 Score: 238.81 bits (608), Expect = 2.515e-71
Identity = 128/302 (42.38%), Postives = 187/302 (61.92%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            ++ A+GRFG VW    +  NE+    VA+KIF    + K+SW+NE  VYS L    H NIL++ GAE+R      +LWL+  ++  GSL ++LK + V+W++L  I + +A GLA+LH             I+HRDIKSKN+LLK N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE+ SR   +D  + ++  PF+E +G++PS E +++ V  KK RP   + W     +    +TI ECWD D +ARLSA CV ER+  +  + +I
Sbjct:  196 EVKARGRFGCVWKA--QLLNEY----VAVKIFP--IQDKQSWQNEYEVYS-LPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNI 488          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Human
Match: ACVR2B (activin A receptor type 2B [Source:HGNC Symbol;Acc:HGNC:174])

HSP 1 Score: 230.335 bits (586), Expect = 3.360e-68
Identity = 117/295 (39.66%), Postives = 186/295 (63.05%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS-----FSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMN 1592
            ++ A+GRFG VW      + +     VA+KIF    + K+SW++E  ++S      H N+L++  AE+R  +   ELWL+  ++  GSL +YLK + +TW++L  + + ++ GL++LH        +     IAHRD KSKN+LLK + TA +ADFGLA+  +        + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE++SR + +D  + ++  PF+E +G++PS E+L++ V  KK+RP   ++W+  P + +   TI ECWD D +ARLSA CV ER++
Sbjct:  194 EIKARGRFGCVW------KAQLMNDFVAVKIFP--LQDKQSWQSEREIFST-PGMKHENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQHPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVS 479          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Human
Match: TGFBR2 (transforming growth factor beta receptor 2 [Source:HGNC Symbol;Acc:HGNC:11773])

HSP 1 Score: 214.927 bits (546), Expect = 7.227e-62
Identity = 137/435 (31.49%), Postives = 227/435 (52.18%), Query Frame = 3
Query:  348 CCCKGNLCNDISVKYSIKFPKVYTTINPQSLVMIPNTGQVNIFWIYXXXXXXXXXXXXXXXXXXKRFAIHSKTSINSNRKIFDVEN----INDNVRTPIAKLCENGSRYEENTVLINQISTENLYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINSP---IAHRDIKSKNILLKENYTACIADFGLAICHQNT----DNSFNNRVGTLSYMAPEILEGSINFD-IYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            C C  + CND     +I F + Y T NP  L++I     +++     V +  I +         ++ +  S       RK+ +       I ++ R+ I+  C N   +  NT L+            + + L+ +GRF +V+   ++     + + VA+KIF    E   SW+ E  ++S + N  H NIL++  AE R  +   + WL+  ++  G+L  YL +  ++W DL ++  ++A G+AHLHS   P   P   I HRD+KS NIL+K + T C+ DFGL++    T    D + + +VGT  YMAPE+LE  +N + + SF + D++SM+LV WE+ SR       +KD++ PF   V E+P  E ++  V   + RP     W+N   +    +T+TECWD DP+ARL+A+CV ER ++L +++ +
Sbjct:  136 CSCSSDECND-----NIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLS--STWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINH--NTELLP----------IELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP--YEEYASWKTEKDIFSDI-NLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVG-EVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDRL 547          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Celegans
Match: daf-1 (Cell surface receptor daf-1 [Source:UniProtKB/Swiss-Prot;Acc:P20792])

HSP 1 Score: 171.785 bits (434), Expect = 5.693e-46
Identity = 104/311 (33.44%), Postives = 172/311 (55.31%), Query Frame = 3
Query:  705 LYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYS--ILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH---SFSKPINSP-IAHRDIKSKNILLKENYTACIADFGLAICHQNTDNS-----FNNRVGTLSYMAPEILEGSINFDIY-SFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQN--PFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMND 1595
            L+ L    Q+   GR G    G + +R +++ + VA+K+F  N   + ++  E+ ++   +L+   HPN+L+Y G++R     +TELWLV EY+P GSL ++L ++TV       + ++ A+GLA LH     SK  N P +AHRDIKSKNI++K + T  I D GL++       S      N + GT+ Y+APEIL  ++ F ++ S+   D++S SLV WE L R +  D+  ++     P+ E    +P   Q+   V  ++LRP  N  W + P++    + I  CW+ +P AR ++    +RM++
Sbjct:  284 LHKLTIGGQIRLTGRVGSGRFGNV-SRGDYRGEAVAVKVF--NALDEPAFHKETEIFETRMLR---HPNVLRYIGSDRVDTGFVTELWLVTEYHPSGSLHDFLLENTVNIETYYNLMRSTASGLAFLHNQIGGSKESNKPAMAHRDIKSKNIMVKNDLTCAIGDLGLSLSKPEDAASDIIANENYKCGTVRYLAPEILNSTMQFTVFESYQCADVYSFSLVMWETLCRCEDGDVLPREAATVIPYIEWTDRDPQDAQMFDVVCTRRLRPTENPLWKDHPEMKHIMEIIKTCWNGNPSARFTSYICRKRMDE 588          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Celegans
Match: daf-1 (Cell surface receptor daf-1 [Source:UniProtKB/Swiss-Prot;Acc:P20792])

HSP 1 Score: 166.777 bits (421), Expect = 3.381e-44
Identity = 104/311 (33.44%), Postives = 171/311 (54.98%), Query Frame = 3
Query:  705 LYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYS--ILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH---SFSKPINSP-IAHRDIKSKNILLKENYTACIADFGLAICHQNTDNS-----FNNRVGTLSYMAPEILEGSINFDIY-SFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQN--PFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMND 1595
            L+ L    Q+   GR G    G + +R +++ + VA+K+F  N   + ++  E+ ++   +L+   HPN+L+Y G++R     +TELWLV EY+P GSL ++L ++TV       + ++ A+GLA LH     SK  N P +AHRDIKSKNI++K + T  I D GL++       S      N + GT  Y+APEIL  ++ F ++ S+   D++S SLV WE L R +  D+  ++     P+ E    +P   Q+   V  ++LRP  N  W + P++    + I  CW+ +P AR ++    +RM++
Sbjct:  284 LHKLTIGGQIRLTGRVGSGRFGNV-SRGDYRGEAVAVKVF--NALDEPAFHKETEIFETRMLR---HPNVLRYIGSDRVDTGFVTELWLVTEYHPSGSLHDFLLENTVNIETYYNLMRSTASGLAFLHNQIGGSKESNKPAMAHRDIKSKNIMVKNDLTCAIGDLGLSLSKPEDAASDIIANENYKCGT-RYLAPEILNSTMQFTVFESYQCADVYSFSLVMWETLCRCEDGDVLPREAATVIPYIEWTDRDPQDAQMFDVVCTRRLRPTENPLWKDHPEMKHIMEIIKTCWNGNPSARFTSYICRKRMDE 587          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Celegans
Match: daf-4 (Cell surface receptor daf-4 [Source:UniProtKB/Swiss-Prot;Acc:P50488])

HSP 1 Score: 157.918 bits (398), Expect = 8.564e-42
Identity = 110/322 (34.16%), Postives = 172/322 (53.42%), Query Frame = 3
Query:  663 EENTVLINQISTENLYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGP--HPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS-----FSKPINSPIAHRDIKSKNILLKENYTACIADFGLA--ICHQNTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKD----FQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERM 1589
            E    +I  + T     + D  QL+++GRFG+V+     T +  +K++VA+K    N+  K S+  E  ++  L   P  + +I+++  AE+ + D   E W+V E++   SL+  LK + ++ +   +I  ++  GL  LH      F  P   PI HRDIKSKNIL+K + T CIADFGLA    +    +    +VGT  YM+PE+LEG+  F   +F  +D++SM LV WEV+SR   + LH  D    +Q PFQ ++G +P+   +R  V  KK RP + +  I    +    K   E WD +  AR++A C   R+
Sbjct:   70 EPEEEMIEMVETPKELPITD-FQLISKGRFGKVFKAQY-TPDSGEKRLVAVKKL--NEFQKASFLAEKRIFDELNEYPKWYKSIVEFVCAEK-IGD---EYWIVTEFHERLSLYELLKNNVISITSANRIIMSMIDGLQFLHDDRPYFFGHP-KKPIIHRDIKSKNILVKSDMTTCIADFGLARIYSYDIEQSDLLGQVGTKRYMSPEMLEGATEFTPTAFKAMDVYSMGLVMWEVISR---TKLHQTDEPPNYQMPFQ-VIGFDPTIGLMRNYVVSKKERPQWRDEIIKHEYMSLLKKVTEEMWDPEACARITAGCAFARV 378          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Celegans
Match: daf-4 (Cell surface receptor daf-4 [Source:UniProtKB/Swiss-Prot;Acc:P50488])

HSP 1 Score: 157.918 bits (398), Expect = 2.086e-41
Identity = 110/322 (34.16%), Postives = 172/322 (53.42%), Query Frame = 3
Query:  663 EENTVLINQISTENLYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGP--HPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS-----FSKPINSPIAHRDIKSKNILLKENYTACIADFGLA--ICHQNTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKD----FQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERM 1589
            E    +I  + T     + D  QL+++GRFG+V+     T +  +K++VA+K    N+  K S+  E  ++  L   P  + +I+++  AE+ + D   E W+V E++   SL+  LK + ++ +   +I  ++  GL  LH      F  P   PI HRDIKSKNIL+K + T CIADFGLA    +    +    +VGT  YM+PE+LEG+  F   +F  +D++SM LV WEV+SR   + LH  D    +Q PFQ ++G +P+   +R  V  KK RP + +  I    +    K   E WD +  AR++A C   R+
Sbjct:  137 EPEEEMIEMVETPKELPITD-FQLISKGRFGKVFKAQY-TPDSGEKRLVAVKKL--NEFQKASFLAEKRIFDELNEYPKWYKSIVEFVCAEK-IGD---EYWIVTEFHERLSLYELLKNNVISITSANRIIMSMIDGLQFLHDDRPYFFGHP-KKPIIHRDIKSKNILVKSDMTTCIADFGLARIYSYDIEQSDLLGQVGTKRYMSPEMLEGATEFTPTAFKAMDVYSMGLVMWEVISR---TKLHQTDEPPNYQMPFQ-VIGFDPTIGLMRNYVVSKKERPQWRDEIIKHEYMSLLKKVTEEMWDPEACARITAGCAFARV 445          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Celegans
Match: daf-4 (Cell surface receptor daf-4 [Source:UniProtKB/Swiss-Prot;Acc:P50488])

HSP 1 Score: 158.688 bits (400), Expect = 3.265e-41
Identity = 109/317 (34.38%), Postives = 171/317 (53.94%), Query Frame = 3
Query:  678 LINQISTENLYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGP--HPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS-----FSKPINSPIAHRDIKSKNILLKENYTACIADFGLA--ICHQNTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKD----FQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERM 1589
            +I  + T     + D  QL+++GRFG+V+     T +  +K++VA+K    N+  K S+  E  ++  L   P  + +I+++  AE+ + D   E W+V E++   SL+  LK + ++ +   +I  ++  GL  LH      F  P   PI HRDIKSKNIL+K + T CIADFGLA    +    +    +VGT  YM+PE+LEG+  F   +F  +D++SM LV WEV+SR   + LH  D    +Q PFQ ++G +P+   +R  V  KK RP + +  I    +    K   E WD +  AR++A C   R+
Sbjct:  273 MIEMVETPKELPITD-FQLISKGRFGKVFKAQY-TPDSGEKRLVAVKKL--NEFQKASFLAEKRIFDELNEYPKWYKSIVEFVCAEK-IGD---EYWIVTEFHERLSLYELLKNNVISITSANRIIMSMIDGLQFLHDDRPYFFGHP-KKPIIHRDIKSKNILVKSDMTTCIADFGLARIYSYDIEQSDLLGQVGTKRYMSPEMLEGATEFTPTAFKAMDVYSMGLVMWEVISR---TKLHQTDEPPNYQMPFQ-VIGFDPTIGLMRNYVVSKKERPQWRDEIIKHEYMSLLKKVTEEMWDPEACARITAGCAFARV 576          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Fly
Match: put (gene:FBgn0003169 transcript:FBtr0334030)

HSP 1 Score: 236.113 bits (601), Expect = 1.034e-70
Identity = 131/300 (43.67%), Postives = 182/300 (60.67%), Query Frame = 3
Query:  729 QLLAQ---GRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH-----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTD--NSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDL 1598
            QLL Q   GRFG VW   +        Q VA+KIF    + K+SW  E  +Y  L    HPNIL++ G E+ M     E WL+  Y   GSL +YLK  T++W +L +I +++A GLAHLH     S +  +   IAHRD KSKN+LLK + TACIADFGLA+  Q        + +VGT  YMAPE+LEG+INF+  +FL+ID+++  LV WE++SR  F+   + +FQ PF+  +G  PS +++++ V +KKLRP    +W   P +  F  T+ ECWD D +ARLS+ CV+ER   L
Sbjct:  203 QLLEQKASGRFGDVWQAKL------NNQDVAVKIF--RMQEKESWTTEHDIYK-LPRMRHPNILEFLGVEKHMDKP--EYWLISTYQHNGSLCDYLKSHTISWPELCRIAESMANGLAHLHEEIPASKTDGLKPSIAHRDFKSKNVLLKSDLTACIADFGLAMIFQPGKPCGDTHGQVGTRRYMAPEVLEGAINFNRDAFLRIDVYACGLVLWEMVSRCDFAG-PVGEFQLPFEAELGLRPSLDEVQESVVMKKLRPRLLNSWRAHPGLNVFCDTMEECWDHDAEARLSSSCVMERFAQL 490          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Fly
Match: put (gene:FBgn0003169 transcript:FBtr0082977)

HSP 1 Score: 236.113 bits (601), Expect = 1.034e-70
Identity = 131/300 (43.67%), Postives = 182/300 (60.67%), Query Frame = 3
Query:  729 QLLAQ---GRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH-----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTD--NSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDL 1598
            QLL Q   GRFG VW   +        Q VA+KIF    + K+SW  E  +Y  L    HPNIL++ G E+ M     E WL+  Y   GSL +YLK  T++W +L +I +++A GLAHLH     S +  +   IAHRD KSKN+LLK + TACIADFGLA+  Q        + +VGT  YMAPE+LEG+INF+  +FL+ID+++  LV WE++SR  F+   + +FQ PF+  +G  PS +++++ V +KKLRP    +W   P +  F  T+ ECWD D +ARLS+ CV+ER   L
Sbjct:  203 QLLEQKASGRFGDVWQAKL------NNQDVAVKIF--RMQEKESWTTEHDIYK-LPRMRHPNILEFLGVEKHMDKP--EYWLISTYQHNGSLCDYLKSHTISWPELCRIAESMANGLAHLHEEIPASKTDGLKPSIAHRDFKSKNVLLKSDLTACIADFGLAMIFQPGKPCGDTHGQVGTRRYMAPEVLEGAINFNRDAFLRIDVYACGLVLWEMVSRCDFAG-PVGEFQLPFEAELGLRPSLDEVQESVVMKKLRPRLLNSWRAHPGLNVFCDTMEECWDHDAEARLSSSCVMERFAQL 490          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Fly
Match: put (gene:FBgn0003169 transcript:FBtr0330227)

HSP 1 Score: 236.113 bits (601), Expect = 1.198e-70
Identity = 131/300 (43.67%), Postives = 182/300 (60.67%), Query Frame = 3
Query:  729 QLLAQ---GRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH-----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTD--NSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDL 1598
            QLL Q   GRFG VW   +        Q VA+KIF    + K+SW  E  +Y  L    HPNIL++ G E+ M     E WL+  Y   GSL +YLK  T++W +L +I +++A GLAHLH     S +  +   IAHRD KSKN+LLK + TACIADFGLA+  Q        + +VGT  YMAPE+LEG+INF+  +FL+ID+++  LV WE++SR  F+   + +FQ PF+  +G  PS +++++ V +KKLRP    +W   P +  F  T+ ECWD D +ARLS+ CV+ER   L
Sbjct:  203 QLLEQKASGRFGDVWQAKL------NNQDVAVKIF--RMQEKESWTTEHDIYK-LPRMRHPNILEFLGVEKHMDKP--EYWLISTYQHNGSLCDYLKSHTISWPELCRIAESMANGLAHLHEEIPASKTDGLKPSIAHRDFKSKNVLLKSDLTACIADFGLAMIFQPGKPCGDTHGQVGTRRYMAPEVLEGAINFNRDAFLRIDVYACGLVLWEMVSRCDFAG-PVGEFQLPFEAELGLRPSLDEVQESVVMKKLRPRLLNSWRAHPGLNVFCDTMEECWDHDAEARLSSSCVMERFAQL 490          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Fly
Match: sax (gene:FBgn0003317 transcript:FBtr0088833)

HSP 1 Score: 201.445 bits (511), Expect = 1.680e-57
Identity = 109/287 (37.98%), Postives = 173/287 (60.28%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS--FSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTDNSF----NNRVGTLSYMAPEILEGSINFDIYSFL-KIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSA 1568
            + + +G++G+VW G     + H + I A+KIF    E  +SW+ E+ +YS +    H NIL + G++   ++S T+LWL+  YYPLGSL+++L ++ ++ +D++ IC +IA GL HLH+  F K     +AHRD+KSKNIL+  N +  IADFGLA+ H +         N +VGT  YMAPE+L+ SI+ + +  L + DI++  LV WEV  R     +  ++++ PF ++V  +PSFE +R+ V I   RP+    W +   +    K + ECW ++PD RL A
Sbjct:  233 ECIGRGKYGEVWRG-----HWHGESI-AVKIFFSRDE--ESWKRETEIYSTILLR-HENILGFIGSDMTSRNSCTQLWLMTHYYPLGSLFDHLNRNALSHNDMVWICLSIANGLVHLHTEIFGKQGKPAMAHRDLKSKNILVTSNGSCVIADFGLAVTHSHVTGQLDLGNNPKVGTKRYMAPEVLDESIDLECFEALRRTDIYAFGLVLWEVCRRTISCGI-AEEYKVPFYDVVPMDPSFEDMRKVVCIDNYRPSIPNRWSSDSLMTGMSKLMKECWHQNPDVRLPA 509          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Fly
Match: sax (gene:FBgn0003317 transcript:FBtr0308825)

HSP 1 Score: 201.445 bits (511), Expect = 4.060e-57
Identity = 110/287 (38.33%), Postives = 173/287 (60.28%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS--FSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTDNSF----NNRVGTLSYMAPEILEGSINFDIYSFL-KIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSA 1568
            + + +G++G+VW G     + H + I A+KIF    E  +SW+ E+ +YS +    H NIL + G++   ++S T+LWL+  YYPLGSL+++L ++ ++ +D++ IC +IA GL HLH+  F K     +AHRD+KSKNIL+  N +  IADFGLA+ H +         N +VGT  YMAPE+L+ SI+ + +  L + DI++  LV WEV  R   S    ++++ PF ++V  +PSFE +R+ V I   RP+    W +   +    K + ECW ++PD RL A
Sbjct:  280 ECIGRGKYGEVWRG-----HWHGESI-AVKIFFSRDE--ESWKRETEIYSTILLR-HENILGFIGSDMTSRNSCTQLWLMTHYYPLGSLFDHLNRNALSHNDMVWICLSIANGLVHLHTEIFGKQGKPAMAHRDLKSKNILVTSNGSCVIADFGLAVTHSHVTGQLDLGNNPKVGTKRYMAPEVLDESIDLECFEALRRTDIYAFGLVLWEVCRR-TISCGIAEEYKVPFYDVVPMDPSFEDMRKVVCIDNYRPSIPNRWSSDSLMTGMSKLMKECWHQNPDVRLPA 556          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Zebrafish
Match: acvr2bb (activin A receptor type 2Bb [Source:ZFIN;Acc:ZDB-GENE-170621-5])

HSP 1 Score: 240.35 bits (612), Expect = 3.770e-72
Identity = 130/300 (43.33%), Postives = 187/300 (62.33%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS----FSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNIN 1610
            +L A+GRFG VW   + +      + VA+KIF    + K+SW+NE  +Y + +   H NIL Y  AE+R  +   ELWLV E++  GSL +YLK + V+W  L  I  +++ GLA+LH      ++     IAHRD KSKN+LLK + TA IADFGLA+  +        + +VGT  YMAPE+LEG+INF   SFL+ID++++ LV WE++SR   SD  + ++Q PF+E VG++PS E L+  V  KK+RP F + W+    + +  +TI ECWD D +ARLSA CV ER++ +   N
Sbjct:  191 ELKARGRFGCVWKAQLLS------EYVAVKIFP--IQDKQSWQNERDIY-LTEGFKHENILHYISAEKRGTNLQMELWLVTEFHERGSLTDYLKGNVVSWPQLCHISASMSRGLAYLHEDLPYRAEGPKPAIAHRDFKSKNVLLKMDLTAVIADFGLAVRFEPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDSFLRIDMYALGLVLWELVSRCTASDGPVGEYQLPFEEEVGQHPSLEDLQDAVVHKKMRPVFKDCWVKHQGLSQLCETIEECWDHDAEARLSAGCVEERISTISKSN 481          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Zebrafish
Match: acvr2aa (activin A receptor type 2Aa [Source:ZFIN;Acc:ZDB-GENE-980526-227])

HSP 1 Score: 238.424 bits (607), Expect = 1.144e-71
Identity = 132/302 (43.71%), Postives = 190/302 (62.91%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS---FSKPINSP-IAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            ++ A+GRFG VW    +  N++    VA+KIF    + K SW+NE  +Y+I     H NIL++ GAE+R  +   ELWL+  Y+   SL +YLK + VTW++L  I Q +A GLA+LHS     +  + P IAHRD KSKN+LLK N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID++++ LV WE+ +R   SD  + ++  PF+E VG++P+ E +++ V  KKLRP   E W   P +    +TI ECWD + +ARLSA CV ER+  +    S+
Sbjct:  178 EIKARGRFGCVWKA--QLLNDY----VAVKIFP--IQDKLSWQNEYDIYNI-PGMRHENILQFIGAEKRGSNLDIELWLITAYHEKSSLTDYLKANVVTWNELCHIAQTMARGLAYLHSDFPGHRDGHKPAIAHRDFKSKNVLLKTNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAVGLVLWELAARCTASDGPVDEYMLPFEEEVGQHPTLEDMQEVVVHKKLRPTLRECWQKHPGLAMLCETIEECWDHEAEARLSAGCVEERVVQMQRQTSV 470          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Zebrafish
Match: acvr2aa (activin A receptor type 2Aa [Source:ZFIN;Acc:ZDB-GENE-980526-227])

HSP 1 Score: 238.81 bits (608), Expect = 1.460e-71
Identity = 132/302 (43.71%), Postives = 190/302 (62.91%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS---FSKPINSP-IAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            ++ A+GRFG VW    +  N++    VA+KIF    + K SW+NE  +Y+I     H NIL++ GAE+R  +   ELWL+  Y+   SL +YLK + VTW++L  I Q +A GLA+LHS     +  + P IAHRD KSKN+LLK N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID++++ LV WE+ +R   SD  + ++  PF+E VG++P+ E +++ V  KKLRP   E W   P +    +TI ECWD + +ARLSA CV ER+  +    S+
Sbjct:  197 EIKARGRFGCVWKA--QLLNDY----VAVKIFP--IQDKLSWQNEYDIYNI-PGMRHENILQFIGAEKRGSNLDIELWLITAYHEKSSLTDYLKANVVTWNELCHIAQTMARGLAYLHSDFPGHRDGHKPAIAHRDFKSKNVLLKTNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAVGLVLWELAARCTASDGPVDEYMLPFEEEVGQHPTLEDMQEVVVHKKLRPTLRECWQKHPGLAMLCETIEECWDHEAEARLSAGCVEERVVQMQRQTSV 489          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Zebrafish
Match: acvr2aa (activin A receptor type 2Aa [Source:ZFIN;Acc:ZDB-GENE-980526-227])

HSP 1 Score: 239.195 bits (609), Expect = 1.988e-71
Identity = 132/302 (43.71%), Postives = 190/302 (62.91%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS---FSKPINSP-IAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            ++ A+GRFG VW    +  N++    VA+KIF    + K SW+NE  +Y+I     H NIL++ GAE+R  +   ELWL+  Y+   SL +YLK + VTW++L  I Q +A GLA+LHS     +  + P IAHRD KSKN+LLK N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID++++ LV WE+ +R   SD  + ++  PF+E VG++P+ E +++ V  KKLRP   E W   P +    +TI ECWD + +ARLSA CV ER+  +    S+
Sbjct:  221 EIKARGRFGCVWKA--QLLNDY----VAVKIFP--IQDKLSWQNEYDIYNI-PGMRHENILQFIGAEKRGSNLDIELWLITAYHEKSSLTDYLKANVVTWNELCHIAQTMARGLAYLHSDFPGHRDGHKPAIAHRDFKSKNVLLKTNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAVGLVLWELAARCTASDGPVDEYMLPFEEEVGQHPTLEDMQEVVVHKKLRPTLRECWQKHPGLAMLCETIEECWDHEAEARLSAGCVEERVVQMQRQTSV 513          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Zebrafish
Match: acvr2ab (activin A receptor type 2Ab [Source:ZFIN;Acc:ZDB-GENE-120215-23])

HSP 1 Score: 226.483 bits (576), Expect = 8.909e-68
Identity = 124/302 (41.06%), Postives = 181/302 (59.93%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS----FSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            +L A+GRFG VW   + +      + VA+KIF    + K+SW+NE  +Y+      H N+L + GAE+R      ELWL+  Y+  GSL ++LK + ++W++L  I Q    GLA+LH             IAHRDIKSKN+LLK + TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+I+F   +FL+ID+++  LV WE+ +R   +D  + +F  PF+E  G +PS E ++  V  KKLRP F E+W+    +    +T+ ECWD + +ARLSA CV ER+  +    SI
Sbjct:  122 ELKARGRFGCVWKAQLLS------EAVAVKIFP--VQNKQSWQNEYEIYNA-SGMKHENLLHFIGAEKRGNGVDIELWLITTYHEKGSLTDFLKANVLSWNELCLIAQTFVRGLAYLHEDIPNLKDGHKPAIAHRDIKSKNVLLKSDLTACIADFGLALKFEAGKSTGDTHGQVGTRRYMAPEVLEGAISFQRDAFLRIDMYAAGLVLWELATRCTAADGPVDEFCLPFEEEAGLHPSLEDMQDVVVHKKLRPIFREHWLKHTGLSLLCETMEECWDHEAEARLSAGCVEERIISMQRSTSI 414          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Xenopus
Match: acvr2a (activin A receptor type 2A [Source:NCBI gene;Acc:100216172])

HSP 1 Score: 237.269 bits (604), Expect = 4.613e-71
Identity = 132/306 (43.14%), Postives = 186/306 (60.78%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLER---MNDLCNINSIE 1619
            ++ A+GRFG VW   +        + VA+KIF    + K SW+NE  +Y+ L    H NIL++ GAE+R  +  T+LWL+  ++  GSL +YLK + V+W++L  I + +A GLA+LH             +AHRDIKSKNILLK + TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++  LV WE+ SR   SD  + ++  PF+E VG++PS E +++ V  KK RP   E W     +    +TI ECWD D +ARLSA CV ER   M  L NI + E
Sbjct:  178 EVKARGRFGCVWKAQL------LNETVAVKIFP--IQDKLSWQNEYEIYN-LPGMKHENILQFIGAEKRGTNLDTDLWLITAFHEKGSLTDYLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAVAHRDIKSKNILLKNSLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAFGLVLWELASRCTASDGPVDEYMLPFEEEVGQHPSLEDMQEVVVHKKKRPILRECWQKHAGMAMLCETIEECWDHDAEARLSAGCVEERIIQMQKLTNIITTE 474          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Xenopus
Match: acvr2a (activin A receptor type 2A [Source:NCBI gene;Acc:100216172])

HSP 1 Score: 237.269 bits (604), Expect = 7.448e-71
Identity = 132/306 (43.14%), Postives = 187/306 (61.11%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLER---MNDLCNINSIE 1619
            ++ A+GRFG VW      + +   + VA+KIF    + K SW+NE  +Y+ L    H NIL++ GAE+R  +  T+LWL+  ++  GSL +YLK + V+W++L  I + +A GLA+LH             +AHRDIKSKNILLK + TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++  LV WE+ SR   SD  + ++  PF+E VG++PS E +++ V  KK RP   E W     +    +TI ECWD D +ARLSA CV ER   M  L NI + E
Sbjct:  192 EVKARGRFGCVW------KAQLLNETVAVKIFP--IQDKLSWQNEYEIYN-LPGMKHENILQFIGAEKRGTNLDTDLWLITAFHEKGSLTDYLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAVAHRDIKSKNILLKNSLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAFGLVLWELASRCTASDGPVDEYMLPFEEEVGQHPSLEDMQEVVVHKKKRPILRECWQKHAGMAMLCETIEECWDHDAEARLSAGCVEERIIQMQKLTNIITTE 488          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Xenopus
Match: acvr2a (activin A receptor type 2A [Source:NCBI gene;Acc:100216172])

HSP 1 Score: 237.269 bits (604), Expect = 7.866e-71
Identity = 132/306 (43.14%), Postives = 187/306 (61.11%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLER---MNDLCNINSIE 1619
            ++ A+GRFG VW      + +   + VA+KIF    + K SW+NE  +Y+ L    H NIL++ GAE+R  +  T+LWL+  ++  GSL +YLK + V+W++L  I + +A GLA+LH             +AHRDIKSKNILLK + TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++  LV WE+ SR   SD  + ++  PF+E VG++PS E +++ V  KK RP   E W     +    +TI ECWD D +ARLSA CV ER   M  L NI + E
Sbjct:  196 EVKARGRFGCVW------KAQLLNETVAVKIFP--IQDKLSWQNEYEIYN-LPGMKHENILQFIGAEKRGTNLDTDLWLITAFHEKGSLTDYLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAVAHRDIKSKNILLKNSLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAFGLVLWELASRCTASDGPVDEYMLPFEEEVGQHPSLEDMQEVVVHKKKRPILRECWQKHAGMAMLCETIEECWDHDAEARLSAGCVEERIIQMQKLTNIITTE 492          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Xenopus
Match: acvr2a (activin A receptor type 2A [Source:NCBI gene;Acc:100216172])

HSP 1 Score: 236.884 bits (603), Expect = 8.365e-71
Identity = 132/306 (43.14%), Postives = 187/306 (61.11%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLER---MNDLCNINSIE 1619
            ++ A+GRFG VW      + +   + VA+KIF    + K SW+NE  +Y+ L    H NIL++ GAE+R  +  T+LWL+  ++  GSL +YLK + V+W++L  I + +A GLA+LH             +AHRDIKSKNILLK + TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++  LV WE+ SR   SD  + ++  PF+E VG++PS E +++ V  KK RP   E W     +    +TI ECWD D +ARLSA CV ER   M  L NI + E
Sbjct:  189 EVKARGRFGCVW------KAQLLNETVAVKIFP--IQDKLSWQNEYEIYN-LPGMKHENILQFIGAEKRGTNLDTDLWLITAFHEKGSLTDYLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAVAHRDIKSKNILLKNSLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAFGLVLWELASRCTASDGPVDEYMLPFEEEVGQHPSLEDMQEVVVHKKKRPILRECWQKHAGMAMLCETIEECWDHDAEARLSAGCVEERIIQMQKLTNIITTE 485          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Xenopus
Match: acvr2a (activin A receptor type 2A [Source:NCBI gene;Acc:100216172])

HSP 1 Score: 237.269 bits (604), Expect = 8.413e-71
Identity = 132/306 (43.14%), Postives = 187/306 (61.11%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLER---MNDLCNINSIE 1619
            ++ A+GRFG VW      + +   + VA+KIF    + K SW+NE  +Y+ L    H NIL++ GAE+R  +  T+LWL+  ++  GSL +YLK + V+W++L  I + +A GLA+LH             +AHRDIKSKNILLK + TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++  LV WE+ SR   SD  + ++  PF+E VG++PS E +++ V  KK RP   E W     +    +TI ECWD D +ARLSA CV ER   M  L NI + E
Sbjct:  194 EVKARGRFGCVW------KAQLLNETVAVKIFP--IQDKLSWQNEYEIYN-LPGMKHENILQFIGAEKRGTNLDTDLWLITAFHEKGSLTDYLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAVAHRDIKSKNILLKNSLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAFGLVLWELASRCTASDGPVDEYMLPFEEEVGQHPSLEDMQEVVVHKKKRPILRECWQKHAGMAMLCETIEECWDHDAEARLSAGCVEERIIQMQKLTNIITTE 490          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Mouse
Match: Acvr2a (activin receptor IIA [Source:MGI Symbol;Acc:MGI:102806])

HSP 1 Score: 238.424 bits (607), Expect = 1.938e-71
Identity = 128/302 (42.38%), Postives = 187/302 (61.92%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            ++ A+GRFG VW    +  NE+    VA+KIF    + K+SW+NE  VYS L    H NIL++ GAE+R      +LWL+  ++  GSL ++LK + V+W++L  I + +A GLA+LH             I+HRDIKSKN+LLK N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE+ SR   +D  + ++  PF+E +G++PS E +++ V  KK RP   + W     +    +TI ECWD D +ARLSA CV ER+  +  + +I
Sbjct:  196 EVKARGRFGCVWKA--QLLNEY----VAVKIFP--IQDKQSWQNEYEVYS-LPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNI 488          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Mouse
Match: Acvr2b (activin receptor IIB [Source:MGI Symbol;Acc:MGI:87912])

HSP 1 Score: 232.646 bits (592), Expect = 4.227e-69
Identity = 144/452 (31.86%), Postives = 230/452 (50.88%), Query Frame = 3
Query:  273 WPNTSDCPDEAGPCYLLGHNTKQPACCCKGNLCNDISVKY-SIKFPKVYTTINPQSLVMIPNTGQVNI----FWIYXXXXXXXXXXXXXXXXXXKRFAIHSKTSINSNRKIFDVENINDNVRTPIAKLCENGSRYEENTVLINQISTENLYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS-----FSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMN 1592
            W +  +C D    C     N +   CCC+GN CN+          P+  T +   +  ++P  G   I    FW+Y                   R   +    I+  R+        D        L          + L+     + L       ++ A+GRFG VW      + +     VA+KIF    + K+SW++E  ++S      H N+L++  AE+R  +   ELWL+  ++  GSL +YLK + +TW++L  + + ++ GL++LH        +     IAHRD KSKN+LLK + TA +ADFGLA+  +        + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE++SR + +D  + ++  PF+E +G++PS E+L++ V  KK+RP   ++W+  P + +   TI ECWD D +ARLSA CV ER++
Sbjct:   78 WLDDFNCYDRQ-ECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEAPTLLTVLAYSLLPIGGLSLIVLLAFWMYR-----------------HRKPPYGHVDIHEVRQCQRWAGRRDGCADSFKPLPFQDPGPPPPSPLVGLKPLQLL-------EIKARGRFGCVW------KAQLMNDFVAVKIFP--LQDKQSWQSEREIFST-PGMKHENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQHPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVS 495          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Mouse
Match: Acvr2b (activin receptor IIB [Source:MGI Symbol;Acc:MGI:87912])

HSP 1 Score: 230.335 bits (586), Expect = 2.307e-68
Identity = 117/295 (39.66%), Postives = 186/295 (63.05%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS-----FSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMN 1592
            ++ A+GRFG VW      + +     VA+KIF    + K+SW++E  ++S      H N+L++  AE+R  +   ELWL+  ++  GSL +YLK + +TW++L  + + ++ GL++LH        +     IAHRD KSKN+LLK + TA +ADFGLA+  +        + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE++SR + +D  + ++  PF+E +G++PS E+L++ V  KK+RP   ++W+  P + +   TI ECWD D +ARLSA CV ER++
Sbjct:  194 EIKARGRFGCVW------KAQLMNDFVAVKIFP--LQDKQSWQSEREIFST-PGMKHENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQHPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVS 479          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Mouse
Match: Acvr2b (activin receptor IIB [Source:MGI Symbol;Acc:MGI:87912])

HSP 1 Score: 230.72 bits (587), Expect = 3.331e-68
Identity = 146/461 (31.67%), Postives = 231/461 (50.11%), Query Frame = 3
Query:  273 WPNTSDCPDEAGPCYLLGHNTKQPACCCKGNLCND----------ISVKYSIKFPKVYTTINPQSLVMIPNTGQVNI----FWIYXXXXXXXXXXXXXXXXXXKRFAIHSKTSINSNRKIFDVENINDNVRTPIAKLCENGSRYEENTVLINQISTENLYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS-----FSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMN 1592
            W +  +C D    C     N +   CCC+GN CN+            V Y    P   T +   +  ++P  G   I    FW+Y                   R   +    I+  R+        D        L          + L+     + L       ++ A+GRFG VW      + +     VA+KIF    + K+SW++E  ++S      H N+L++  AE+R  +   ELWL+  ++  GSL +YLK + +TW++L  + + ++ GL++LH        +     IAHRD KSKN+LLK + TA +ADFGLA+  +        + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE++SR + +D  + ++  PF+E +G++PS E+L++ V  KK+RP   ++W+  P + +   TI ECWD D +ARLSA CV ER++
Sbjct:   78 WLDDFNCYDRQ-ECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPP-PTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYR-----------------HRKPPYGHVDIHEVRQCQRWAGRRDGCADSFKPLPFQDPGPPPPSPLVGLKPLQLL-------EIKARGRFGCVW------KAQLMNDFVAVKIFP--LQDKQSWQSEREIFST-PGMKHENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQHPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVS 503          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Mouse
Match: Tgfbr2 (transforming growth factor, beta receptor II [Source:MGI Symbol;Acc:MGI:98729])

HSP 1 Score: 216.083 bits (549), Expect = 1.577e-62
Identity = 138/429 (32.17%), Postives = 225/429 (52.45%), Query Frame = 3
Query:  348 CCCKGNLCNDISVKYSIKFPKVYTTINPQSLVMIPNTGQVNIFWIYXXXXXXXXXXXXXXXXXXKRFAIHSKTSINSNRKIFDVEN----INDNVRTPIAKLCENGSRYEENTVLINQISTENLYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINSP---IAHRDIKSKNILLKENYTACIADFGLAICHQNT----DNSFNNRVGTLSYMAPEILEGSINFD-IYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDL 1598
            C C    CND      I F + YTT +P  L++I     V++     + +  I +         ++ +   ++S    RK+ D  +    I ++ R+ I+  C N   +  NT L+            + + L+ +GRF +V+   ++     + + VA+KIF    E   SW+ E  ++S + N  H NIL++  AE R  +   + WL+  ++  G+L  YL +  ++W DL ++  ++A G+AHLHS   P   P   I HRD+KS NIL+K + T C+ DFGL++    T    D + + +VGT  YMAPE+LE  +N + + SF + D++SM+LV WE+ SR       +KD++ PF   V E+P  E ++  V   + RP     W+N   +    +T+TECWD DP+ARL+A+CV ER ++L
Sbjct:  136 CACNMEECNDY-----IIFSEEYTTSSPDLLLVIIQVTGVSLLPPLGIAIAVIIIFYCYRVHRQQKLSPSWESS--KPRKLMDFSDNCAIILEDDRSDISSTCANNINH--NTELLP----------IELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP--YEEYSSWKTEKDIFSDI-NLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVG-EVKDYEPPFGSKVREHPCVESMKDSVLRDRGRPEIPSFWLNHQGIQIVCETLTECWDHDPEARLTAQCVAERFSEL 541          
BLAST of Receptor protein serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q90669|AVR2A_CHICK (Activin receptor type-2A OS=Gallus gallus OX=9031 GN=ACVR2A PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 2.026e-71
Identity = 134/306 (43.79%), Postives = 188/306 (61.44%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLER---MNDLCNINSIE 1619
            ++ A+GRFG VW    +  NE+    VA+KIF    + K+SW+NE  +YS L    H NIL++ GAE+R      +LWL+  ++  GSL ++LK + V+W++L  I Q +A GLA+LH             I+HRDIKSKN+LLK N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE+ SR   SD  + ++  PF+E +G++PS E +++ V  KK RP   E W     +    +TI ECWD D +ARLSA CV ER   M  L NI + E
Sbjct:  196 EIKARGRFGCVWKA--QLLNEY----VAVKIFP--IQDKQSWQNEYEIYS-LPGMKHDNILQFIGAEKRGTSIDVDLWLITAFHEKGSLTDFLKANVVSWNELCHIAQTMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTASDGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRECWQKHSGMAMLCETIEECWDHDAEARLSAGCVEERIIQMQKLTNIITTE 492          
BLAST of Receptor protein serine/threonine kinase vs. UniProt/SwissProt
Match: sp|P27039|AVR2A_XENLA (Activin receptor type-2A OS=Xenopus laevis OX=8355 GN=acvr2a PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 5.513e-71
Identity = 133/306 (43.46%), Postives = 186/306 (60.78%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLER---MNDLCNINSIE 1619
            ++ A+GRFG VW      + +   + VA+KIF    + K SW+NE  +YS L    H NIL + GAE+R  +  T+LWL+  ++  GSL +YLK + V+W++L  I + +A GL+HLH             +AHRDIKSKN+LLK N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++  LV WE+ SR   SD  + ++  PF+E VG++PS E +++ V  KK RP   E W     +    +TI ECWD D +ARLSA CV ER   M  L NI + E
Sbjct:  197 EVKARGRFGCVW------KAQLLNETVAVKIFP--VQDKLSWQNEYEIYS-LPGMKHENILYFIGAEKRGTNLDTDLWLITAFHEKGSLTDYLKANVVSWNELCLIAETMARGLSHLHEDIPGLKDGHKPAVAHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAFGLVLWELASRCTASDGPVDEYMLPFEEEVGQHPSLEDMQEVVVHKKKRPILRECWQKHAGMAMLCETIEECWDHDAEARLSAGCVEERIIQMQKLTNIITTE 493          
BLAST of Receptor protein serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q28043|AVR2A_BOVIN (Activin receptor type-2A OS=Bos taurus OX=9913 GN=ACVR2A PE=2 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 1.158e-70
Identity = 128/302 (42.38%), Postives = 187/302 (61.92%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            ++ A+GRFG VW    +  NE+    VA+KIF    + K+SW+NE  VYS L    H NIL++ GAE+R      +LWL+  ++  GSL ++LK + V+W++L  I + +A GLA+LH             I+HRDIKSKN+LLK N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE+ SR   +D  + ++  PF+E +G++PS E +++ V  KK RP   + W     +    +TI ECWD D +ARLSA CV ER+  +  + +I
Sbjct:  196 EVKARGRFGCVWKA--QLLNEY----VAVKIFP--IQDKQSWQNEYEVYS-LPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNI 488          
BLAST of Receptor protein serine/threonine kinase vs. UniProt/SwissProt
Match: sp|P27037|AVR2A_HUMAN (Activin receptor type-2A OS=Homo sapiens OX=9606 GN=ACVR2A PE=1 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 1.208e-70
Identity = 128/302 (42.38%), Postives = 187/302 (61.92%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            ++ A+GRFG VW    +  NE+    VA+KIF    + K+SW+NE  VYS L    H NIL++ GAE+R      +LWL+  ++  GSL ++LK + V+W++L  I + +A GLA+LH             I+HRDIKSKN+LLK N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE+ SR   +D  + ++  PF+E +G++PS E +++ V  KK RP   + W     +    +TI ECWD D +ARLSA CV ER+  +  + +I
Sbjct:  196 EVKARGRFGCVWKA--QLLNEY----VAVKIFP--IQDKQSWQNEYEVYS-LPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNI 488          
BLAST of Receptor protein serine/threonine kinase vs. UniProt/SwissProt
Match: sp|P27038|AVR2A_MOUSE (Activin receptor type-2A OS=Mus musculus OX=10090 GN=Acvr2a PE=1 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 1.356e-70
Identity = 128/302 (42.38%), Postives = 187/302 (61.92%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            ++ A+GRFG VW    +  NE+    VA+KIF    + K+SW+NE  VYS L    H NIL++ GAE+R      +LWL+  ++  GSL ++LK + V+W++L  I + +A GLA+LH             I+HRDIKSKN+LLK N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE+ SR   +D  + ++  PF+E +G++PS E +++ V  KK RP   + W     +    +TI ECWD D +ARLSA CV ER+  +  + +I
Sbjct:  196 EVKARGRFGCVWKA--QLLNEY----VAVKIFP--IQDKQSWQNEYEVYS-LPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNI 488          
BLAST of Receptor protein serine/threonine kinase vs. TrEMBL
Match: A0A023F3N5 (Serine/threonine-protein kinase receptor (Fragment) OS=Triatoma infestans OX=30076 PE=2 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 7.349e-75
Identity = 125/294 (42.52%), Postives = 189/294 (64.29%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINS-----PIAHRDIKSKNILLKENYTACIADFGLAICHQNTD--NSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERM 1589
            ++ A+GRFG VW      + ++K ++VA+KIF  +   K+SW++E  ++  L +  H +IL+Y G E+R     +E WL+  Y+ LGSL +YLK +T+TW+ L  + +++A GL HLH    P  +      IAHRD KSKN+LLK + TAC+ADFGLA+  Q        + +VGT  YMAPE+LEG+INF   +FL+ID+++  LV WE+ +R    D  + ++Q PF+E VG++P+ E +++CV  KK RP  N +W + P ++    T+ ECWD D +ARLSA CV+ER+
Sbjct:  181 EVKAKGRFGAVW------KAQYKTELVAVKIFPVHD--KQSWQSEQEIFK-LAHMRHDSILRYIGVEKRGDGLQSEYWLITAYHDLGSLCDYLKANTLTWAQLCHVAESMARGLMHLHEEMGPTKTEGYKPAIAHRDFKSKNVLLKSDLTACVADFGLALVFQPGKPCGDTHGQVGTRRYMAPEVLEGAINFSRDAFLRIDMYACGLVLWELATRCTAQDSAVGEYQLPFEEEVGQHPTLEDMQECVVHKKQRPLLNNSWKSHPGLLALCDTMEECWDHDAEARLSASCVMERI 465          
BLAST of Receptor protein serine/threonine kinase vs. TrEMBL
Match: R7TEH1 (Serine/threonine-protein kinase receptor OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_94926 PE=3 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 2.986e-73
Identity = 127/297 (42.76%), Postives = 191/297 (64.31%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH-----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQN--TDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDL 1598
            ++ A+GRFG V+   +  R      ++A+K+F    + K+SW  E  +YS+ Q   H NIL Y GAE+R ++   +LWL+ +++  GSL++YLK + V+W  LL IC+++A GLA+LH     + ++     IAHRD KSKN+L+K + TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   SFL+ID+++  LV WE++SR   +D  +++++ P +E VG +PS E+++  V  KK RP F + W   P +     TI ECWD DP+ARLSA CV ER++ L
Sbjct:  197 EVKARGRFGCVYKAQMGER------VIAVKVFP--LQDKQSWATEKDIYSLPQLNCHANILHYIGAEKRGENLNMDLWLITQFHEQGSLYDYLKGNLVSWQQLLAICESMAKGLAYLHEDLPATRTQQAKPAIAHRDFKSKNVLIKSDLTACIADFGLALKFEGGVSVGETHGQVGTRRYMAPEVLEGAINFSRDSFLRIDMYACGLVLWELISRCSAADGPVEEYRLPLEEDVGTHPSLEEMQDAVVSKKSRPGFKDVWRKHPGLCTMCDTIEECWDHDPEARLSAGCVQERLSQL 485          
BLAST of Receptor protein serine/threonine kinase vs. TrEMBL
Match: A0A1S3IPV1 (Serine/threonine-protein kinase receptor OS=Lingula unguis OX=7574 GN=LOC106166288 PE=3 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 5.146e-73
Identity = 131/305 (42.95%), Postives = 198/305 (64.92%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH--------SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINS 1613
            +L A+GRFG VW      + +   + VA+KIF    + K+SW  E  VYS L    H NILK+  AE+R  +  TELWL+ E++ LGSL +YLK + + W+D+L++ + +A GLA+LH        S  KP    +AHRD KSKN+L+K++ + CIADFGLA+     ++    + +VGT  YMAPE+LEG+INF+  +F++ID+++  LV WE++SR   +D  ++D+Q PF++ VG++P+ E ++  V  KK+RPAF E+W+    +  F  TI ECWD+D +ARLSA CV ER++ L  + +
Sbjct:  212 ELKARGRFGTVW------KAQLLNEFVAVKIFP--IQDKQSWMREQEVYS-LPLMKHENILKFTAAEKRGDNLNTELWLITEFHELGSLCDYLKGNLIAWNDMLKMAETMARGLAYLHEDIPGVKGSDGKPA---VAHRDFKSKNVLMKKDMSCCIADFGLAMKFDPGSSPGETHGQVGTRRYMAPEVLEGAINFNRDAFMRIDMYACGLVLWEIVSRCSAADGPVEDYQLPFEDEVGQHPTLEDMQDAVVHKKVRPAFKEHWLKHGGLQAFCDTIEECWDQDAEARLSAGCVEERISQLVRLTA 504          
BLAST of Receptor protein serine/threonine kinase vs. TrEMBL
Match: T1HXB4 (Serine/threonine-protein kinase receptor (Fragment) OS=Rhodnius prolixus OX=13249 PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.286e-72
Identity = 123/294 (41.84%), Postives = 187/294 (63.61%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINS-----PIAHRDIKSKNILLKENYTACIADFGLAICHQNTD--NSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERM 1589
            ++ A+GRFG VW      + ++K ++VA+KIF  +   K+SW++E  ++  L +  H +IL+Y G E+R     +E WL+  Y+ LGSL +YLK + +TW+ L  + ++++ GL HLH    P  +      IAHRD KSKN+LLK + TACIADFGLA+  Q        + +VGT  YMAPE+LEG+INF   +FL+ID+++  LV WE+ +R    D  + ++Q PF+E VG++P+ E +++CV  KK RP    +W + P ++    T+ ECWD D +ARLSA CV+ER+
Sbjct:  170 EVKAKGRFGAVW------KAQYKTELVAVKIFPVHD--KQSWQSEQEIFK-LAHMRHDSILRYIGVEKRGDGLQSEYWLITAYHDLGSLCDYLKANNLTWAQLCHVAESMSRGLMHLHEEMGPTKTEGYKPAIAHRDFKSKNVLLKSDLTACIADFGLALVFQPGKPCGDTHGQVGTRRYMAPEVLEGAINFSRDAFLRIDMYACGLVLWELATRCTAQDSAVGEYQLPFEEEVGQHPTLEDMQECVVHKKQRPLLKNSWKSHPGLLALCDTMEECWDHDAEARLSASCVMERI 454          
BLAST of Receptor protein serine/threonine kinase vs. TrEMBL
Match: O13102 (Serine/threonine-protein kinase receptor OS=Carassius auratus OX=7957 PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 1.302e-72
Identity = 126/298 (42.28%), Postives = 190/298 (63.76%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            ++ A+GRFGQVW      R +   + VA+KIF    + K+SW+NE  ++S      H N+L+Y GAERR  +  TE WL+ E++  GSL ++LK + ++W+DL  I + +A GLA+LH         IAHRD KS+N+LLK + +A + D GLA+  +        + +VGT  YMAPE+LEG+INF   SFL+ID+++M LV WE++SR + +D  + ++  PF+E +G++PS E L+  V  KK+RPAF + W+    + +  +TI ECWD D +ARLSA CV ER++ +  + SI
Sbjct:  192 EVKARGRFGQVW------RAQMMNECVAVKIFP--IQDKQSWQNERDMFST-PGMKHENLLRYIGAERRGANLETEFWLITEFHERGSLTDHLKGNVLSWTDLCHIAETMACGLAYLHEDVPRSKPAIAHRDFKSRNVLLKSDLSAVLGDLGLAVRFEPGTPPGDTHGQVGTRRYMAPEVLEGAINFQRDSFLRIDMYAMGLVLWELVSRCRAADGPVDEYMLPFEEEIGQHPSLEDLQDAVVHKKMRPAFKDCWLKHSGLAQMCETIEECWDHDAEARLSAGCVEERISQIRRLTSI 480          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Cavefish
Match: acvr2ab (activin receptor type-2A [Source:NCBI gene;Acc:103040899])

HSP 1 Score: 247.669 bits (631), Expect = 6.405e-75
Identity = 166/464 (35.78%), Postives = 239/464 (51.51%), Query Frame = 3
Query:  258 QSCWEWPNTSDCPDEAGPCYLLGHNTKQPACCCKGNLCNDISVKYSIKFPKVYTTINP--------QSLV--MIPNTGQVNI----FWIYXXXXXXXXXXXXXXXXXXKRFAIHSKTSINSNRKIFDVENINDNVRTPIAKLCENGSRYEENTVLINQISTENLYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERM 1589
            Q CW   +  +C D +G C     + +   CCC+GN+CN+  + YS     V TT+NP         +L+  ++P  G   I    FW+Y                  +   +     +   +  F +  I D   TP + L             + Q   + L       ++ A+GRFG VW    +  NEH    VA+KIF    + K+SW+NE  +Y I     H N+L + GAE+R      ELWL+  Y+  GSL +YLK + V+W++L  I Q  A GLA+LH             IAHRDIKSKNIL+K N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID++++ LV WE+  R   +D  + ++  PF+E VG++PS E +++ V  KKLRP   E W     +    +TI ECWD + +ARLSA CV ER+
Sbjct:   76 QGCWL--DDVNCYD-SGECVERKDSPEVFFCCCEGNMCNE-KIYYSPDTQAVQTTLNPYPPKPELCSTLLYSLVPIMGIAAILLFSFWMY------------------RHHKLAYPPVLVPTQHAFHI-MIEDPGPTPPSPL-------------LGQKPLQLL-------EVKARGRFGCVWKA--QLLNEH----VAVKIFP--IQNKQSWQNEYEIYCI-SGMKHENLLNFIGAEKRGNGMDIELWLITSYHEKGSLTDYLKANVVSWNELCHIAQTFARGLAYLHEDIPGLKDGHKPAIAHRDIKSKNILMKTNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAVGLVLWELAFRCTAADGPVDEYALPFEEEVGQHPSLEDMQEVVVHKKLRPTLREYWQKHTGLAMLCETIEECWDHEAEARLSAGCVEERI 487          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Cavefish
Match: acvr2aa (activin receptor type-2A-like [Source:NCBI gene;Acc:103032572])

HSP 1 Score: 239.58 bits (610), Expect = 5.853e-72
Identity = 130/302 (43.05%), Postives = 187/302 (61.92%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS----FSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            ++ A+GRFG VW    +  N++    VA+KIF    + K+SW+NE  +Y+ L    H NIL + GAE+R  +   ELWL+  Y+  GSL +YLK + VTW++L  I Q +A GLA+LH+            +AHRDIKSKN+LLK N T CIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID++++ LV WE+ SR   +D  + ++  PF+E VG++P+ E +++ V  KKLRP   E W     +    +TI ECWD + +ARLSA CV ER+  +    SI
Sbjct:  196 EVKARGRFGCVWKA--QLLNDY----VAVKIFP--IQDKQSWQNEYEIYN-LPGMRHENILHFMGAEKRGANLDIELWLITAYHEKGSLTDYLKANVVTWNELCHIAQTMARGLAYLHADIPGLRDGHKPAVAHRDIKSKNVLLKANLTVCIADFGLALRFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAVGLVLWELASRCTAADGPVDEYMLPFEEEVGQHPTLEDMQEVVVHKKLRPTLRECWQKHAGLTMLCETIEECWDHEAEARLSAGCVEERVVQMQRQTSI 488          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Cavefish
Match: acvr2ab (activin receptor type-2A [Source:NCBI gene;Acc:103040899])

HSP 1 Score: 239.195 bits (609), Expect = 6.372e-72
Identity = 130/293 (44.37%), Postives = 180/293 (61.43%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERM 1589
            ++ A+GRFG VW    +  NEH    VA+KIF    + K+SW+NE  +Y I     H N+L + GAE+R      ELWL+  Y+  GSL +YLK + V+W++L  I Q  A GLA+LH             IAHRDIKSKNIL+K N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID++++ LV WE+  R   +D  + ++  PF+E VG++PS E +++ V  KKLRP   E W     +    +TI ECWD + +ARLSA CV ER+
Sbjct:  190 EVKARGRFGCVWKA--QLLNEH----VAVKIFP--IQNKQSWQNEYEIYCI-SGMKHENLLNFIGAEKRGNGMDIELWLITSYHEKGSLTDYLKANVVSWNELCHIAQTFARGLAYLHEDIPGLKDGHKPAIAHRDIKSKNILMKTNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAVGLVLWELAFRCTAADGPVDEYALPFEEEVGQHPSLEDMQEVVVHKKLRPTLREYWQKHTGLAMLCETIEECWDHEAEARLSAGCVEERI 473          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Cavefish
Match: acvr2ab (activin receptor type-2A [Source:NCBI gene;Acc:103040899])

HSP 1 Score: 239.58 bits (610), Expect = 6.780e-72
Identity = 130/293 (44.37%), Postives = 180/293 (61.43%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERM 1589
            ++ A+GRFG VW    +  NEH    VA+KIF    + K+SW+NE  +Y I     H N+L + GAE+R      ELWL+  Y+  GSL +YLK + V+W++L  I Q  A GLA+LH             IAHRDIKSKNIL+K N TACIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID++++ LV WE+  R   +D  + ++  PF+E VG++PS E +++ V  KKLRP   E W     +    +TI ECWD + +ARLSA CV ER+
Sbjct:  196 EVKARGRFGCVWKA--QLLNEH----VAVKIFP--IQNKQSWQNEYEIYCI-SGMKHENLLNFIGAEKRGNGMDIELWLITSYHEKGSLTDYLKANVVSWNELCHIAQTFARGLAYLHEDIPGLKDGHKPAIAHRDIKSKNILMKTNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAVGLVLWELAFRCTAADGPVDEYALPFEEEVGQHPSLEDMQEVVVHKKLRPTLREYWQKHTGLAMLCETIEECWDHEAEARLSAGCVEERI 479          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Cavefish
Match: acvr2aa (activin receptor type-2A-like [Source:NCBI gene;Acc:103032572])

HSP 1 Score: 239.195 bits (609), Expect = 9.829e-72
Identity = 130/302 (43.05%), Postives = 187/302 (61.92%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS----FSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSI 1616
            ++ A+GRFG VW    +  N++    VA+KIF    + K+SW+NE  +Y+ L    H NIL + GAE+R  +   ELWL+  Y+  GSL +YLK + VTW++L  I Q +A GLA+LH+            +AHRDIKSKN+LLK N T CIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   +FL+ID++++ LV WE+ SR   +D  + ++  PF+E VG++P+ E +++ V  KKLRP   E W     +    +TI ECWD + +ARLSA CV ER+  +    SI
Sbjct:  204 EVKARGRFGCVWKA--QLLNDY----VAVKIFP--IQDKQSWQNEYEIYN-LPGMRHENILHFMGAEKRGANLDIELWLITAYHEKGSLTDYLKANVVTWNELCHIAQTMARGLAYLHADIPGLRDGHKPAVAHRDIKSKNVLLKANLTVCIADFGLALRFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAVGLVLWELASRCTAADGPVDEYMLPFEEEVGQHPTLEDMQEVVVHKKLRPTLRECWQKHAGLTMLCETIEECWDHEAEARLSAGCVEERVVQMQRQTSI 496          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ACVR2B (activin A receptor type 2B [Source:HGNC Symbol;Acc:HGNC:174])

HSP 1 Score: 219.164 bits (557), Expect = 5.017e-65
Identity = 116/300 (38.67%), Postives = 176/300 (58.67%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS-----FSKPINSPIAHRDIKSKNILLKENYTACIADFGLAI--CHQNTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNI 1607
            ++ A G FG VW   +         +VA+KIF+  +  ++SW NE  ++       H N+L +  AE+R+    TE WL+  ++  GSL  YLK + ++W +L  + + +A GLA+LH        + I   IAHRDIKS+NILLK + TACIADFGLA+           + +VGTL YMAPEILEG+I+F   SFL+ID++++ LV WE+  R    +  + +F  PF+E +G++ S E+++  V  K++RP   + W   P +    +T+ ECWD + +ARLSA CV ER+  +  I
Sbjct:  191 EVKAMGHFGSVWKARL------LGDLVAVKIFTVKE--RRSWENEIDIFKT-AGVAHENLLHFIAAEKRVSGLDTEYWLITTFHEKGSLAEYLKGNVLSWRELCHVAETMARGLAYLHEDIVSPKGELIKPAIAHRDIKSRNILLKGDLTACIADFGLAVKFAPGKPAGDTHGQVGTLRYMAPEILEGAIHFQRDSFLRIDVYALGLVLWELAWRCTVIEERVGEFSLPFEEELGKHLSLEEMQDLVVQKRVRPTMKDCWRKHPGMSLLCETMEECWDHEAEARLSAGCVEERVQTMRRI 481          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ACVR2B (activin A receptor type 2B [Source:HGNC Symbol;Acc:HGNC:174])

HSP 1 Score: 212.616 bits (540), Expect = 7.083e-63
Identity = 112/295 (37.97%), Postives = 177/295 (60.00%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFS-----KPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMN 1592
            ++ A GR+G VW   + +        VA+K+F+   +  +SW  E  +YS      H N+L++  AE+R+     E W++  ++  GSL  YLK + +TW +L  I + ++ GLA+LH  +     + +   IAHRD+KS+N+LLK + TACIADFGLA+  +        + +VGT+ YMAPE+LEG+I+F   +FL+IDI+++ LV WE+ SR    D  + D+  PF+E +G + S +++++ V  K++RPA    W     +  F +TI ECWD + +ARLSA CV ER+ 
Sbjct:  179 EVKAVGRYGSVWKAQLFS------DYVAVKVFT--AKDLRSWEKEVDIYSS-PGIKHDNLLQFIAAEQRVSGLDVEYWIITAFHEKGSLMEYLKGNVLTWRELCLITETMSRGLAYLHEDAMGPKGELLKPSIAHRDMKSRNVLLKSDLTACIADFGLAVRFEPGKPPGDTHGQVGTMRYMAPEVLEGAIHFQRDAFLRIDIYALGLVLWELTSRCTAVDGPVGDYTLPFEEELGRHASLDEIQELVVQKRIRPALKPCWRKHALLRFFCETIEECWDHEAEARLSAGCVEERVQ 464          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006012.1 (pep scaffold:Pmarinus_7.0:GL476493:425401:440684:1 gene:ENSPMAG00000005387.1 transcript:ENSPMAT00000006012.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.216 bits (513), Expect = 1.329e-58
Identity = 115/305 (37.70%), Postives = 180/305 (59.02%), Query Frame = 3
Query:  735 LAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH-----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTDNSF----NNRVGTLSYMAPEILEGSINFDIY-SFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSIE 1619
            + +GRFG+VW      R   + + VA+KIFS  +E  +SW  E+ +Y  +    H NIL +  A+ +   + T+LWLV +Y+ LGSL++YL + +++  +L++   ++A+GLAHLH     +  KP    IAHRDIKSKNIL+K N T CIAD GLA+ H +T +S     NNRVGT  YMAPE+L+ +IN   + SF + DI++  LV WE+  R     +  +D+Q P+ ++V  +PS + +R+ V  + LRP     W +   +    + + ECW  +  ARL+A  V + ++ L  +  I+
Sbjct:  214 IGKGRFGEVW------RGRWRGEDVAVKIFSSREE--RSWFREAEIYQTVMLR-HENILGFIAADNKDNGTWTQLWLVSDYHELGSLFDYLNRFSLSVEELVKFSLSVASGLAHLHMDIVGTQGKP---AIAHRDIKSKNILVKRNRTCCIADLGLAVRHDSTTDSIDIAPNNRVGTKRYMAPEVLDDTINMKHFDSFKRGDIYAFGLVLWEISRRCVVGGI-TEDYQLPYHDMVSPDPSVDDMRRVVCEQSLRPNVPNRWQSSESLRVMGRVMRECWYANASARLTALRVKKSLSQLSQLEDIK 505          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009742.1 (pep scaffold:Pmarinus_7.0:GL481861:10:12380:1 gene:ENSPMAG00000008794.1 transcript:ENSPMAT00000009742.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.586 bits (488), Expect = 5.086e-58
Identity = 90/205 (43.90%), Postives = 133/205 (64.88%), Query Frame = 3
Query:  987 GSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLH--IKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERM 1589
            GS+ +YLK   VTWS+L  I + +A GL+ LH     +   IAHRD KSKN+LLK + TAC+AD GLA+  +        + +VGT  YMAPE+LEG+INF   +FL+ID++++ LV WE++SR   +     + D++ PF++  G++PS E +++ V  KK RPA  + W   P + +  +T+ ECWD D +ARLSA CV+ER+
Sbjct:    2 GSVGDYLKGIVVTWSELCHIAETMARGLSFLHEEGPDLKPAIAHRDFKSKNVLLKSDLTACVADLGLAVKFEPGKPPGDMHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAVGLVMWELVSRCTVAARAGPVGDYRMPFEDEAGQHPSLEDMQEVVVNKKQRPALRDCWRKHPGLSQLCETVEECWDHDAEARLSAGCVVERV 206          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005861.1 (pep scaffold:Pmarinus_7.0:GL476493:320276:325221:1 gene:ENSPMAG00000005274.1 transcript:ENSPMAT00000005861.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.282 bits (495), Expect = 6.671e-58
Identity = 105/288 (36.46%), Postives = 174/288 (60.42%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVY-SILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS--FSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNT----DNSFNNRVGTLSYMAPEILEGSINFDIY-SFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSA 1568
            + + +GR+G+VW G  +  N      VA+KIFS   E  KSW  E+ +Y ++L    H NIL +  ++   ++S T+LWL+  Y+  GSL+++L++  +  S  L++  ++AAGL+HLH   F       IAHRD+KSKNIL+K N   CIAD GLA+ H       D   N RVGT+ +MAPE+L+ ++  D + ++ + DI+++ LV WE+ +R   S+   ++++ PF + V  +PSF+++++ V +++ RP     W + P +    K + ECW ++P ARL+A
Sbjct:   31 ECVGKGRYGEVWRGQWQGEN------VAVKIFSSRDE--KSWCRETEIYNTVLLR--HENILGFIASDMTSRNSSTQLWLITHYHECGSLYDWLQRWPLEASSCLRLALSVAAGLSHLHGEIFGTHGKPAIAHRDLKSKNILVKGNGQCCIADLGLAVMHSQEWSRLDIGQNPRVGTVRFMAPEVLDETLQTDCFDAYKRADIWALGLVLWEI-ARRTLSNGIAEEYRVPFHDAVPSDPSFDEMKKVVCVEQQRPNIPNRWFSDPSLTALAKLMKECWYQNPSARLTA 307          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 86.6557 bits (213), Expect = 2.854e-18
Identity = 83/301 (27.57%), Postives = 137/301 (45.51%), Query Frame = 3
Query:  702 NLYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIF---SDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTDNSFNNRVGTLSYMAPE-ILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSF---EQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLE 1583
            ++ SL  + +++ +G+FG V+ G     N    ++ AIK+    SD+ E +   R    + S+ Q     NI +Y+G+   +KD  T LW+++E+   GSL + L+   +    +  I + +   L  +H  +      + HRDIK+ N+L+       + DFG+A     T        GT  +MAPE I+EG     +Y   K+DI+S+ +  +                     EI   NP +   E LR    I K +P   E+      + +F   I  C DEDP  RLSA+ +L+
Sbjct:   18 DVSSLFKRTEVIGRGKFGVVYKGY----NVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQIS---NITRYYGS--YLKD--TSLWIIMEHCAGGSLRSLLRPGKIDEKYIGVIMRELLVALKCIHKDN------VIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEG-----VYYDTKVDIWSLGITTY---------------------EIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEF---IALCLDEDPKERLSADDLLK 272          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 82.0333 bits (201), Expect = 9.427e-17
Identity = 63/183 (34.43%), Postives = 97/183 (53.01%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIK-IFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSD---LLQICQNIAAGLAHLHSFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTDNSFNNRVGTLSYMAPEIL 1265
            Q++ +G +G V+  I    N+H  Q+VAIK +  +N E       E    S+L+N  H NI+KY G  R+      EL++++EY   GSL   + +S+   S+      + Q +  GL +LH         + HRDIK+ NILL  + T  +ADFG++      ++S     GTL++MAPEIL
Sbjct:   29 QVIGRGSYGVVYKAI----NKHTDQVVAIKEVVYENDEELNDIMAE---ISLLKNLNHNNIVKYHGFIRKSY----ELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLL-GLKYLHG------EGVIHRDIKAANILLSADNTVKLADFGVSTI---VNSSALTLAGTLNWMAPEIL 190          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Yeast
Match: SSK22 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; functionally redundant with Ssk2p; interacts with and is activated by Ssk1p; phosphorylates Pbs2p; SSK22 has a paralog, SSK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000669])

HSP 1 Score: 71.633 bits (174), Expect = 1.781e-13
Identity = 66/206 (32.04%), Postives = 92/206 (44.66%), Query Frame = 3
Query:  723 KNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFS--DNKEGKKSW---RNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQ-NIAAGLAHLHSFSKPINSPIAHRDIKSKNILLKENYTACIADFGLA--ICHQNT--------------DNSFNNRVGTLSYMAPEILEGS 1274
            K   +  G FGQV+S I    N    +I+A+K     D    KK +   + E TV  +L    HPNI++Y+G E   +D +    + +EY   GSL + L    +    + Q+    +  GLA+LH       S + HRDIK +NILL  N      DFG A  +    T                S N  +GT  YMAPE + GS
Sbjct: 1036 KRSFIGGGTFGQVYSAI----NLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLN---HPNIVQYYGVEVH-RDKVN---IFMEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLHQ------SGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPETISGS 1224          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Yeast
Match: FMP48 (Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies; induced by treatment with 8-methoxypsoralen and UVA irradiation [Source:SGD;Acc:S000003284])

HSP 1 Score: 70.0922 bits (170), Expect = 1.916e-13
Identity = 76/260 (29.23%), Postives = 118/260 (45.38%), Query Frame = 3
Query:  735 LAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQN-GPHPNILKYFGAERRMKDSITE---LWLVVEYYPLGSLWNYLKKSTVTWS---------DLLQICQNIAAGLAHLHSFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTDNSFNNRVGTLSYMAPEILEGSI-------NFD-----IYSFLKIDIFSMS-----LVFWEVLSRFQFSD--LHIKDF----QNPFQEI 1406
            +  G F  V+     T N +    VA+KI    K  + + +NE  V  IL +  PHPNI         M D  T+     +V+EY   G L+++L  +    S         D+ +I + + + ++  HS        IAHRDIK +NILL  N    +AD+G AI    +  S + ++GT +Y APE   G +       NFD     +Y+  + D +S+      L+F + L R   S    H+K+F    ++PF  I
Sbjct:    8 IQSGTFSTVYKAWSTTHNRY----VALKITPKYKTSEANMKNEYDVMKILSSCNPHPNICS-------MLDFYTDDSYYIMVLEYCECGDLYDFLDIAKSQGSPSSPSLIQIDMQKIIKQLCSAISFAHSLG------IAHRDIKPENILLTINGDIKLADWGHAI---QSPKSNDFQIGTDNYRAPETFSGRVSNSCFKKNFDRSSAPLYNTYQADYWSLGATIFYLMFGDCLFRVSKSKKVQHLKNFDEFEKDPFAFI 247          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 68.9366 bits (167), Expect = 1.167e-12
Identity = 56/211 (26.54%), Postives = 102/211 (48.34%), Query Frame = 3
Query:  897 HPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYL-KKSTVTWSDLLQICQNIAAGLAHLHSFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSR---FQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVT--IKKLRPAFNENWINLPDVIK 1511
            HPN+L+ +     + ++ T+L+LV+EY   G L+N L ++  +   + ++  + I  G+++ H+        I HRD+K +N+LL   Y   IADFG+A   +          G+  Y APEI+ G      Y     D++S  ++ + +L+    F   D +I+      Q+   E PS +++ +     I+K+     E  I   D++K
Sbjct:   90 HPNVLRLYD----VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALG------IVHRDLKPENLLLDHKYNIKIADFGMAAL-ETEGKLLETSCGSPHYAAPEIVSGI----PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILK 285          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Nematostella
Match: EDO49370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG69])

HSP 1 Score: 214.542 bits (545), Expect = 1.984e-63
Identity = 118/303 (38.94%), Postives = 185/303 (61.06%), Query Frame = 3
Query:  729 QLLAQGRFG-QVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSI-----TELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINSP-----IAHRDIKSKNILLKENYTACIADFGLAICHQNTD--NSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDL 1598
            ++++QG+FG  VW      + ++    VA+KIF   +    +W NE   Y  L    H N+L + G E   +        TE WL+ +++  GSL ++LK+ ++  ++LLQ+  ++  GLA+LHS    IN+      IAHRD+KSKNIL+K + T CI+DFGLA+    +D     + +VGT  YMAPE+LEG+I+F   SFL+ID+++  LV WE+LSRF   D  ++D++ PF++ VG +PS E ++Q V  KK+RP F ++W     +    +TI ECWD+D +ARL++ CV +R+  +
Sbjct:  148 EVVSQGQFGVTVW------KAKYSINTVAVKIFPHQE--FTAWVNERDFYK-LCGLDHENVLTFIGDEVHHESQYNGQIYTEYWLITDFHENGSLSDFLKQRSLDLAELLQLASSVCDGLAYLHSDVPAINNSSHKPCIAHRDVKSKNILVKSDLTCCISDFGLALKFDQSDKLGETHGQVGTKRYMAPEVLEGAISFTRESFLRIDMYACGLVLWELLSRFSVHDDPVEDYRLPFEQEVGLHPSLEDMQQVVVQKKMRPQFKDSWRCHAALRVIIQTIEECWDQDGEARLTSHCVAQRLKQV 441          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Nematostella
Match: EDO41379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4E9])

HSP 1 Score: 203.371 bits (516), Expect = 4.751e-60
Identity = 119/301 (39.53%), Postives = 178/301 (59.14%), Query Frame = 3
Query:  726 NQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINSP-IAHRDIKSKNILLKENYTACIADFGLAICHQNT-----DNSFNNRVGTLSYMAPEILEGSINF-DIYSFLK-IDIFSMSLVFWEVLSRFQ-FSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWK-TITECWDEDPDARLSAECVLERMNDL 1598
             QL+ QGR+G VW G +        +++A+K+F    E +  W+ E  ++S L +  HP+IL++F A  R  +S  E  L+ EY+P GSL NYL++ +V W ++  +  +++AGLA LH   +  N P  AHRDI SKNIL+K + +  +ADFG A+   +      D +    VGTL YMAPE+L+G++N  DI   LK ID+++MSLV WEV  R +      +  ++ PF+  +G   + E +   V  KKLRP F + W      ++F K TI +CWD+D DARL A C+ +RM+DL
Sbjct:  100 GQLIGQGRYGTVWKGTMFN------EVMAVKVF--GAEHRLFWQAEKDLFSALDH--HPSILRFFAACERETNSSPEYLLLSEYHPRGSLQNYLRQHSVCWREMCIMGSSMSAGLAFLH---QDANKPSFAHRDINSKNILVKVDGSCVLADFGFAMNVSDATKPADDGTLITEVGTLRYMAPEVLDGAVNLHDIQGALKQIDVYAMSLVIWEVSMRCEDIFGKQVPPYKAPFEAELGPMITSEHMHTYVVQKKLRPGFPDAWKRNHSGLRFLKETIEDCWDQDGDARLLALCIKDRMSDL 387          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Nematostella
Match: EDO49083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI35])

HSP 1 Score: 197.978 bits (502), Expect = 1.854e-56
Identity = 108/293 (36.86%), Postives = 170/293 (58.02%), Query Frame = 3
Query:  735 LAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH--------SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTDNSFNN------RVGTLSYMAPEILEGSINFD-IYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSA 1568
            + +GR+G+VW G+      ++ + VAIKIFS   E   SW+ E+ +Y+ +    H NIL +  A+   + S T +WL++ Y+  GSL+++L +ST     L ++  + A+GLAHLH        + SKP    IAHRDIKSKNIL+K NYT  + D GLA+ +    +S +        VGT  YMAPEILE +IN   I SF + D+++  LV WE+  R+    + ++++Q PF ++V  +PS +++++ V  +  RP+    W   P +    K I ECW+ +P ARL++
Sbjct:  223 IGKGRYGEVWKGV------YQGESVAIKIFSTTDEA--SWKRETEIYNTVMLR-HDNILGFIAADVHSRKSTTYMWLIMHYHEQGSLYDFLNRSTFDAETLCRLALSAASGLAHLHTEIFGTNRTGSKP---AIAHRDIKSKNILVKSNYTCAVGDLGLAVMYSQDKDSVDMGENPKIAVGTRRYMAPEILEETINAKCINSFKRADVYAFGLVLWEIARRYVSGGI-VEEYQPPFYDMVQSDPSIDEMKKVVVTENKRPSLPNRWTGDPTLQVMSKLIRECWNPNPAARLTS 502          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Nematostella
Match: EDO30434 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0S6])

HSP 1 Score: 193.741 bits (491), Expect = 1.971e-55
Identity = 111/290 (38.28%), Postives = 173/290 (59.66%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH-----SFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICH---QNT-DNSFNNRVGTLSYMAPEILEGSINF-DIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSA 1568
            +L+  GR+G V+      R + + + VA+KIFS  +E   SW  E+ +Y  +    H NIL +  A+ +   + T+LWL+ +Y+  GSL++YL++ T+    +L++  +IA+GLAHLH     +  KP    IAHRD+KS+NIL+K+N T CIAD GLA+CH   Q+T D  + NRVGT  YMAPE LE S    +  ++   DI++  LV WE+  R   SD   +D+Q P+ + +  +PS E++ + V ++K RP+    W+    +++  K + ECW   P+ARL A
Sbjct:  186 ELIGSGRYGDVY------RGQWRGEDVAVKIFSSREEC--SWFREAQIYQTVMLR-HENILGFIAADNKDNGAWTQLWLITDYHANGSLYDYLQRVTLDMKSMLKLTISIASGLAHLHMEIIGTQGKP---AIAHRDLKSRNILVKDNGTCCIADLGLAVCHNSEQDTLDIPYGNRVGTRRYMAPEFLEDSNQVRNFCAYKHGDIYAFGLVLWEITRRCICSD-KCEDYQLPYFDKICVDPSIEEVWKVVCLEKYRPSHPNYWLQDQVMMRVAKLMQECWHHSPEARLPA 462          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Nematostella
Match: EDO41833 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S365])

HSP 1 Score: 178.333 bits (451), Expect = 1.520e-49
Identity = 109/311 (35.05%), Postives = 184/311 (59.16%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVY-SILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSF-----SKPINSPIAHRDIKSKNILLKENYTACIADFGLAICH----QNTD-NSFNNRVGTLSYMAPEILEGSINFDIYSFLKI-DIFSMSLVFWEVLSRFQFSDLHI-KDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCN-INSIE 1619
            Q + +GR+G+VW      +     + VA+KIF  + E  KSW  E+ +Y ++L    H +IL +  ++      +T+++L+++Y+PLGSL+++L+   +      ++  + AAG+AHLH+       KP+   IAHRDIKSKNIL+KEN T CIADFGLA+ +    +  D N   NRVGT  YM+PE+L  +I+ + +S  K+ D++S +LV WE+  R    +  + ++++ P+ + V  +P+FE++++ V +++ RP     W     +    K + ECW + P ARL+A  V + ++ L + INS E
Sbjct:  214 QSVGKGRYGEVW------KARWHGEDVAVKIFLSHCE--KSWMRETEIYQTVLLR--HESILGFIASDIIGSGQVTQMYLIMDYHPLGSLYDFLRGHQLNKKITGKLAFSAAAGIAHLHAEILGTQGKPM---IAHRDIKSKNILVKENLTCCIADFGLAVKYIPETKGIDLNKDTNRVGTKRYMSPEVLSQTIDPESFSAYKMADMYSFALVLWEISRRCISDETGLCEEYEVPYFDAVSNDPTFEEMKRVVVLERRRPNIPNRWFRDEMLRTMGKLMAECWSQQPAARLTALRVKKSLSKLVSAINSHE 511          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Medaka
Match: acvr2bb (activin receptor type-2B [Source:NCBI gene;Acc:101171650])

HSP 1 Score: 243.047 bits (619), Expect = 3.384e-73
Identity = 126/302 (41.72%), Postives = 187/302 (61.92%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLH----SFSKPINSP-IAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINS 1613
            ++ A+GRFG VW   +      K + VA+KIF    + K+SW+NE  +Y +     H NIL Y  AE+      TELWL+ E++  GSL ++LK +TVTW++L  I + ++ GLA+LH    SF      P IAHRD KSKN++L+++ +A I DFGLA+C +        + +VGT  YMAPE+LEG+INF   SFL+ID+++M LV WE++SR    D  + ++  PF++ +G++PS E L+  V  KK+RP   + W+  P + +  +T+ ECWD D +ARLSA CV ER+  +    S
Sbjct:  196 EIKARGRFGCVWKAHL------KNEFVAVKIFP--VQDKQSWQNERDIY-LTPGMRHENILHYIAAEKHGASLETELWLITEFHERGSLTDHLKGNTVTWAELCHIAETMSRGLAYLHEDISSFKGEGPKPTIAHRDFKSKNVMLRDDLSAVIGDFGLAVCFEPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDSFLRIDMYAMGLVLWELVSRCTERDGTVGEYMLPFEDEIGQHPSLEDLQDVVVHKKMRPVIKDCWLKHPGLSQICETMEECWDHDAEARLSAGCVEERIGQIARTTS 488          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Medaka
Match: acvr2ba (activin receptor type-2B [Source:NCBI gene;Acc:101161926])

HSP 1 Score: 239.58 bits (610), Expect = 5.779e-72
Identity = 124/297 (41.75%), Postives = 185/297 (62.29%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINS-----PIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDL 1598
            ++ A+GRFG VW   +        + VA+KIF    + K+SW+NE+ V+       H NIL+Y GAERR      ELW++ E++  GSL ++LK + ++WS++  I + +A GLA+LH     +        IAHRD KSKNI+L+ + TA I DFGLA+  +        + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE++SR + +D  +  +  PF+E VG++PS E L++ V  KK+RPAF E W+    +    +T+ ECWD D +ARLSA CV ER++ +
Sbjct:  190 EIKARGRFGCVWKAQL------LNEFVAVKIFP--IQNKESWQNETEVFQT-PGMKHQNILRYIGAERRGNHLEAELWIITEFHERGSLSDFLKGNAISWSEMCHIAETMACGLAYLHEDLPRLKGEGHKPAIAHRDFKSKNIILRTDLTAVIGDFGLAVLFEAGKPPGETHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDQYLLPFEEEVGQHPSLEDLQEVVVHKKMRPAFKEPWLKHSGLAHICETVEECWDHDAEARLSAGCVEERISQI 477          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Medaka
Match: acvr2ba (activin receptor type-2B [Source:NCBI gene;Acc:101161926])

HSP 1 Score: 239.58 bits (610), Expect = 6.598e-72
Identity = 124/297 (41.75%), Postives = 185/297 (62.29%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINS-----PIAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDL 1598
            ++ A+GRFG VW   +        + VA+KIF    + K+SW+NE+ V+       H NIL+Y GAERR      ELW++ E++  GSL ++LK + ++WS++  I + +A GLA+LH     +        IAHRD KSKNI+L+ + TA I DFGLA+  +        + +VGT  YMAPE+LEG+INF   +FL+ID+++M LV WE++SR + +D  +  +  PF+E VG++PS E L++ V  KK+RPAF E W+    +    +T+ ECWD D +ARLSA CV ER++ +
Sbjct:  192 EIKARGRFGCVWKAQL------LNEFVAVKIFP--IQNKESWQNETEVFQT-PGMKHQNILRYIGAERRGNHLEAELWIITEFHERGSLSDFLKGNAISWSEMCHIAETMACGLAYLHEDLPRLKGEGHKPAIAHRDFKSKNIILRTDLTAVIGDFGLAVLFEAGKPPGETHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDQYLLPFEEEVGQHPSLEDLQEVVVHKKMRPAFKEPWLKHSGLAHICETVEECWDHDAEARLSAGCVEERISQI 479          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Medaka
Match: acvr2ab (activin A receptor type 2A [Source:NCBI gene;Acc:100049489])

HSP 1 Score: 231.106 bits (588), Expect = 1.013e-68
Identity = 126/296 (42.57%), Postives = 182/296 (61.49%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS---FSKPINSP-IAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDL 1598
            ++ A+GRFG VW   + +      + VA+KIF    + K SW+NE  +Y++     H NIL + G E+R  +   ELWL+  Y+  GSL ++LK + V+W++L  I Q  A GLA+LH      K  + P IAHRDIKSKN+LLK N T CIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   SFL+ID+++  LV WE+ SR   +D  + ++  PF+E VG++PS E +++ V  KKLRP   + W     +    +TI +CWD + +ARLSA CV ER+  +
Sbjct:  202 EVKARGRFGCVWKAQLLS------EYVAVKIFP--IQDKLSWQNEYEIYTV-SGMKHENILHFIGVEKRNNNLDLELWLITAYHEKGSLTDFLKANVVSWNELCHIAQTAARGLAYLHEDIPGHKDGHKPSIAHRDIKSKNLLLKSNLTICIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDSFLRIDMYAFGLVLWELASRCTAADGPVDEYMLPFEEEVGQHPSLEDMQEVVVHKKLRPCLRDCWQKHAGLTILCETIEDCWDHEAEARLSAGCVEERIGQM 488          
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Medaka
Match: acvr2ab (activin A receptor type 2A [Source:NCBI gene;Acc:100049489])

HSP 1 Score: 230.72 bits (587), Expect = 1.552e-68
Identity = 126/296 (42.57%), Postives = 182/296 (61.49%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHS---FSKPINSP-IAHRDIKSKNILLKENYTACIADFGLAICHQ--NTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDL 1598
            ++ A+GRFG VW   + +      + VA+KIF    + K SW+NE  +Y++     H NIL + G E+R  +   ELWL+  Y+  GSL ++LK + V+W++L  I Q  A GLA+LH      K  + P IAHRDIKSKN+LLK N T CIADFGLA+  +   +    + +VGT  YMAPE+LEG+INF   SFL+ID+++  LV WE+ SR   +D  + ++  PF+E VG++PS E +++ V  KKLRP   + W     +    +TI +CWD + +ARLSA CV ER+  +
Sbjct:  210 EVKARGRFGCVWKAQLLS------EYVAVKIFP--IQDKLSWQNEYEIYTV-SGMKHENILHFIGVEKRNNNLDLELWLITAYHEKGSLTDFLKANVVSWNELCHIAQTAARGLAYLHEDIPGHKDGHKPSIAHRDIKSKNLLLKSNLTICIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDSFLRIDMYAFGLVLWELASRCTAADGPVDEYMLPFEEEVGQHPSLEDMQEVVVHKKLRPCLRDCWQKHAGLTILCETIEDCWDHEAEARLSAGCVEERIGQM 496          
BLAST of Receptor protein serine/threonine kinase vs. Planmine SMEST
Match: SMESG000070956.1 (SMESG000070956.1)

HSP 1 Score: 1028.47 bits (2658), Expect = 0.000e+0
Identity = 521/539 (96.66%), Postives = 521/539 (96.66%), Query Frame = 3
Query:    3 LSLKRIRICSFLLIISQSYQNHRIRSVYKFNSQSIVENCEFCL*NKMWCYCTRSQHHICNESIGKIKCANGTKHCVIGLSEKGKTQSCWEWPNTSDCPDEAGPCYLLGHNTKQPACCCKGNLCNDISVKYSIKFPKVYTTINPQSLVMIPNTGQVNIFWIYXXXXXXXXXXXXXXXXXXKRFAIHSKTSINSNRKIFDVENINDNVRTPIAKLCENGSRYEENTVLINQISTENLYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSIE 1619
            LSLKRIRICSFLLIISQSYQNHRIRS                  NKMWCYCTRSQHHICNESIGKIKCANGTKHCVIGLSEKGKTQSCWEWPNTSDCPDEAGPCYLLGHNTKQPACCCKGNLCNDISVKYSIKFPKVYTTINPQSLVMIPNTGQVNIFWIYVVLLLAISLIASIVFIVVKRFAIHSKTSINSNRKIFDVENINDNVRTPIAKLCENGSRYEENTVLINQISTENLYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSIE
Sbjct:   51 LSLKRIRICSFLLIISQSYQNHRIRS------------------NKMWCYCTRSQHHICNESIGKIKCANGTKHCVIGLSEKGKTQSCWEWPNTSDCPDEAGPCYLLGHNTKQPACCCKGNLCNDISVKYSIKFPKVYTTINPQSLVMIPNTGQVNIFWIYVVLLLAISLIASIVFIVVKRFAIHSKTSINSNRKIFDVENINDNVRTPIAKLCENGSRYEENTVLINQISTENLYSLCDKNQLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINSPIAHRDIKSKNILLKENYTACIADFGLAICHQNTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSIE 571          
BLAST of Receptor protein serine/threonine kinase vs. Planmine SMEST
Match: SMESG000060769.1 (SMESG000060769.1)

HSP 1 Score: 219.935 bits (559), Expect = 1.475e-64
Identity = 155/474 (32.70%), Postives = 241/474 (50.84%), Query Frame = 3
Query:  264 CWEWPNTSD-CPDEAGPCYLLGHNTKQPACCCKGNLCN---DISVKYSIKFPKV---YTTINPQSLVMIPNTGQVNIFWIYXXXXXXXXXXXXXXXXXXKRFAIHSKTSINSNRKIFDVENINDNVRTPIAKLC-ENGSRYEENTVLINQISTENLYSLCDKNQLLAQGRFGQVWSG-IIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDS-ITELWLVVEYYPLGSLWNYLKKSTVT---WSDLLQICQNIAAGLAHLHSFSKPINSP-------IAHRDIKSKNILLKENYTACIADFGLAICHQNTDN--SFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSR---FQ-FSDLHIKD---FQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDL 1598
            CW W + +  CP EAG C  +  N      CC G+LCN   ++S +  I+   +   + +     L+  PN+  ++I+    +  L   LI   +  + K   I  + +       ++  ++  +  T ++K+  +N S    ++     +   N Y  C+K  L   G+FG++WSG +I   +      VAIKI     E   SW  E  +Y  ++N     IL+Y G ++ + ++ I E WLV +Y   GSL++ L  S  T   W  +L +C +IA GL++LH       S        IAHRD+KS+NIL+K ++ ACIAD GLA+  Q   +    + +VGT  YMAPE+LEG+INF   SFL IDI++M+L+ WEV S+   FQ  ++    +   +  PF++ +G + + E L+  V     RP     +    D    W+TI ECWD D +ARLSA CV ER+  L
Sbjct:   23 CWMWDHENHYCPAEAGKCLSVHVNNNHKTFCCTGDLCNKPQNLSCEMKIRSISIINKFFSPTTSPLIKEPNSTFISIYIAIGIFFLMTILILIFLRGMWKNMKISMRRTFAKRETTYNGLSLMSDHNTCMSKVTSDNFSLNNHHSFSEELLKASNYYQKCEKKCL---GKFGEIWSGKLISDHSNGAIGNVAIKILRPRDES--SWETEIDMYRYIRNRC-SRILRYIGCDKIVTNNEIEEFWLVTQYIEYGSLYDCLSDSVRTKPNWFQVLNVCLDIAGGLSYLHEDGSYQTSAHISGKPSIAHRDLKSRNILIKADWKACIADLGLAVSFQGNRSLSDLHLQVGTQRYMAPEVLEGAINFSRDSFLGIDIYAMALIMWEVFSQCTDFQGLAECEASEPSVYMQPFEQELGIHITMESLQSWVVNDNKRPQLPSQYSGFSDGQSLWRTIVECWDRDAEARLSAGCVYERLMTL 490          
BLAST of Receptor protein serine/threonine kinase vs. Planmine SMEST
Match: SMESG000060769.1 (SMESG000060769.1)

HSP 1 Score: 220.32 bits (560), Expect = 2.675e-64
Identity = 155/474 (32.70%), Postives = 241/474 (50.84%), Query Frame = 3
Query:  264 CWEWPNTSD-CPDEAGPCYLLGHNTKQPACCCKGNLCN---DISVKYSIKFPKV---YTTINPQSLVMIPNTGQVNIFWIYXXXXXXXXXXXXXXXXXXKRFAIHSKTSINSNRKIFDVENINDNVRTPIAKLC-ENGSRYEENTVLINQISTENLYSLCDKNQLLAQGRFGQVWSG-IIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDS-ITELWLVVEYYPLGSLWNYLKKSTVT---WSDLLQICQNIAAGLAHLHSFSKPINSP-------IAHRDIKSKNILLKENYTACIADFGLAICHQNTDN--SFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWEVLSR---FQ-FSDLHIKD---FQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMNDL 1598
            CW W + +  CP EAG C  +  N      CC G+LCN   ++S +  I+   +   + +     L+  PN+  ++I+    +  L   LI   +  + K   I  + +       ++  ++  +  T ++K+  +N S    ++     +   N Y  C+K  L   G+FG++WSG +I   +      VAIKI     E   SW  E  +Y  ++N     IL+Y G ++ + ++ I E WLV +Y   GSL++ L  S  T   W  +L +C +IA GL++LH       S        IAHRD+KS+NIL+K ++ ACIAD GLA+  Q   +    + +VGT  YMAPE+LEG+INF   SFL IDI++M+L+ WEV S+   FQ  ++    +   +  PF++ +G + + E L+  V     RP     +    D    W+TI ECWD D +ARLSA CV ER+  L
Sbjct:   72 CWMWDHENHYCPAEAGKCLSVHVNNNHKTFCCTGDLCNKPQNLSCEMKIRSISIINKFFSPTTSPLIKEPNSTFISIYIAIGIFFLMTILILIFLRGMWKNMKISMRRTFAKRETTYNGLSLMSDHNTCMSKVTSDNFSLNNHHSFSEELLKASNYYQKCEKKCL---GKFGEIWSGKLISDHSNGAIGNVAIKILRPRDES--SWETEIDMYRYIRNRC-SRILRYIGCDKIVTNNEIEEFWLVTQYIEYGSLYDCLSDSVRTKPNWFQVLNVCLDIAGGLSYLHEDGSYQTSAHISGKPSIAHRDLKSRNILIKADWKACIADLGLAVSFQGNRSLSDLHLQVGTQRYMAPEVLEGAINFSRDSFLGIDIYAMALIMWEVFSQCTDFQGLAECEASEPSVYMQPFEQELGIHITMESLQSWVVNDNKRPQLPSQYSGFSDGQSLWRTIVECWDRDAEARLSAGCVYERLMTL 539          
BLAST of Receptor protein serine/threonine kinase vs. Planmine SMEST
Match: SMESG000068827.1 (SMESG000068827.1)

HSP 1 Score: 190.66 bits (483), Expect = 5.612e-53
Identity = 121/319 (37.93%), Postives = 177/319 (55.49%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNGPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINS--PIAHRDIKSKNILLKENYTACIADFGLAIC-------HQNTDNSFNNRVGTLSYMAPEILE---------------GSINFDIYSFLKI---------------DIFSMSLVFWEVLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENW-INLPDVIKFWKTITECWDEDPDARLS 1565
            + + +G+FG+VW G      + + ++VA+KIFS  +E   SW  E+ +Y+ +    H NIL Y+ ++       T+LW+V++Y+PLGSL  YL  +T+T S +L++  + AAGL HLH+    +     IAHRD+KSKNIL+K+N T CIAD GLA+         Q ++N+ N  VGT  YMAPE+LE                +I+ +I S   I               D++S SLV WE+LSR  F D  I+ +Q PF E V  +PSFE++ + V  + LRP  +EN    L  V+K    + ECW + P  RLS
Sbjct:  261 ECIGKGKFGEVWKG------QFQGELVAVKIFSSREES--SWTRETNIYNTVL-LRHDNILGYYASDLISNSGCTQLWMVMQYHPLGSLHEYLSANTLTVSTVLKLAHSAAAGLCHLHTRIMGLQGKPAIAHRDVKSKNILVKKNLTCCIADLGLAVFPESMGNNEQLSENNNNRIVGTKRYMAPELLELACFLSNNQSENFNSNNIHLNISSTSSIMNIHGENYMESLKAADVYSYSLVLWEILSRTTF-DGVIQPYQLPFGENVQSDPSFEEMFKVVVEQGLRPNLSENIKAQLNPVVKI---MEECWHQRPSIRLS 566          
BLAST of Receptor protein serine/threonine kinase vs. Planmine SMEST
Match: SMESG000006023.1 (SMESG000006023.1)

HSP 1 Score: 176.792 bits (447), Expect = 1.061e-47
Identity = 111/302 (36.75%), Postives = 168/302 (55.63%), Query Frame = 3
Query:  729 QLLAQGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQNG-PHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLLQICQNIAAGLAHLHSFSKPINSP--IAHRDIKSKNILLKENYTACIADFGLAICHQNTDNSFN-NRVGTLSYMAPEILEGSI-------NFDIYSFLKIDIFSMSLVFWEVLSRFQFSDLHIKD--FQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWINLPDVIKFWKTITECWDEDPDARLSAECVLERMND 1595
            Q + +GRFG VW G     N      VA+KIFS   E   SW  E  +Y   QN   H N+L +   +RR     TELWLV +Y+  GSL+ YL+   ++    +++ ++I  GLA+LH+    ++    IAHRD+KS+NIL+K     CI D GLA+      ++ + N VGT  YMAPEI+   I       N  + +F K DI+S SLV WE+L R + S L+I    ++ P+Q +V  +PS E+++  +  +K+RP  N +W NL  +    K++ E W E+P +RL+   + + MN+
Sbjct:  288 QAVGEGRFGTVWLGKWNGDN------VAVKIFSSRDE--VSWAREKDMYQ--QNFLRHSNVLGFVTTDRRDNGLATELWLVTDYHENGSLFEYLRAHIISIEQAVKMTRSITNGLAYLHTEINGLDGKPGIAHRDLKSRNILVKSCGECCIGDLGLAVRLIEDCSTLDLNNVGTRRYMAPEIILDKIVQPDMIYNGGLEAFKKADIYSYSLVIWEILRRCECSSLNISASAYEMPYQNLVSNDPSIEEMKSIICDRKIRPPINSSWDNLNPLKDISKSVRESWFEEPASRLNIMRLKKIMNN 579          
The following BLAST results are available for this feature:
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACVR2A1.565e-7242.38activin A receptor type 2A [Source:HGNC Symbol;Acc... [more]
ACVR2A2.515e-7142.38activin A receptor type 2A [Source:HGNC Symbol;Acc... [more]
ACVR2A2.515e-7142.38activin A receptor type 2A [Source:HGNC Symbol;Acc... [more]
ACVR2B3.360e-6839.66activin A receptor type 2B [Source:HGNC Symbol;Acc... [more]
TGFBR27.227e-6231.49transforming growth factor beta receptor 2 [Source... [more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daf-15.693e-4633.44Cell surface receptor daf-1 [Source:UniProtKB/Swi... [more]
daf-13.381e-4433.44Cell surface receptor daf-1 [Source:UniProtKB/Swi... [more]
daf-48.564e-4234.16Cell surface receptor daf-4 [Source:UniProtKB/Swi... [more]
daf-42.086e-4134.16Cell surface receptor daf-4 [Source:UniProtKB/Swi... [more]
daf-43.265e-4134.38Cell surface receptor daf-4 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
put1.034e-7043.67gene:FBgn0003169 transcript:FBtr0334030[more]
put1.034e-7043.67gene:FBgn0003169 transcript:FBtr0082977[more]
put1.198e-7043.67gene:FBgn0003169 transcript:FBtr0330227[more]
sax1.680e-5737.98gene:FBgn0003317 transcript:FBtr0088833[more]
sax4.060e-5738.33gene:FBgn0003317 transcript:FBtr0308825[more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acvr2bb3.770e-7243.33activin A receptor type 2Bb [Source:ZFIN;Acc:ZDB-G... [more]
acvr2aa1.144e-7143.71activin A receptor type 2Aa [Source:ZFIN;Acc:ZDB-G... [more]
acvr2aa1.460e-7143.71activin A receptor type 2Aa [Source:ZFIN;Acc:ZDB-G... [more]
acvr2aa1.988e-7143.71activin A receptor type 2Aa [Source:ZFIN;Acc:ZDB-G... [more]
acvr2ab8.909e-6841.06activin A receptor type 2Ab [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acvr2a4.613e-7143.14activin A receptor type 2A [Source:NCBI gene;Acc:1... [more]
acvr2a7.448e-7143.14activin A receptor type 2A [Source:NCBI gene;Acc:1... [more]
acvr2a7.866e-7143.14activin A receptor type 2A [Source:NCBI gene;Acc:1... [more]
acvr2a8.365e-7143.14activin A receptor type 2A [Source:NCBI gene;Acc:1... [more]
acvr2a8.413e-7143.14activin A receptor type 2A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acvr2a1.938e-7142.38activin receptor IIA [Source:MGI Symbol;Acc:MGI:10... [more]
Acvr2b4.227e-6931.86activin receptor IIB [Source:MGI Symbol;Acc:MGI:87... [more]
Acvr2b2.307e-6839.66activin receptor IIB [Source:MGI Symbol;Acc:MGI:87... [more]
Acvr2b3.331e-6831.67activin receptor IIB [Source:MGI Symbol;Acc:MGI:87... [more]
Tgfbr21.577e-6232.17transforming growth factor, beta receptor II [Sour... [more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90669|AVR2A_CHICK2.026e-7143.79Activin receptor type-2A OS=Gallus gallus OX=9031 ... [more]
sp|P27039|AVR2A_XENLA5.513e-7143.46Activin receptor type-2A OS=Xenopus laevis OX=8355... [more]
sp|Q28043|AVR2A_BOVIN1.158e-7042.38Activin receptor type-2A OS=Bos taurus OX=9913 GN=... [more]
sp|P27037|AVR2A_HUMAN1.208e-7042.38Activin receptor type-2A OS=Homo sapiens OX=9606 G... [more]
sp|P27038|AVR2A_MOUSE1.356e-7042.38Activin receptor type-2A OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023F3N57.349e-7542.52Serine/threonine-protein kinase receptor (Fragment... [more]
R7TEH12.986e-7342.76Serine/threonine-protein kinase receptor OS=Capite... [more]
A0A1S3IPV15.146e-7342.95Serine/threonine-protein kinase receptor OS=Lingul... [more]
T1HXB41.286e-7241.84Serine/threonine-protein kinase receptor (Fragment... [more]
O131021.302e-7242.28Serine/threonine-protein kinase receptor OS=Carass... [more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acvr2ab6.405e-7535.78activin receptor type-2A [Source:NCBI gene;Acc:103... [more]
acvr2aa5.853e-7243.05activin receptor type-2A-like [Source:NCBI gene;Ac... [more]
acvr2ab6.372e-7244.37activin receptor type-2A [Source:NCBI gene;Acc:103... [more]
acvr2ab6.780e-7244.37activin receptor type-2A [Source:NCBI gene;Acc:103... [more]
acvr2aa9.829e-7243.05activin receptor type-2A-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACVR2B5.017e-6538.67activin A receptor type 2B [Source:HGNC Symbol;Acc... [more]
ACVR2B7.083e-6337.97activin A receptor type 2B [Source:HGNC Symbol;Acc... [more]
ENSPMAT00000006012.11.329e-5837.70pep scaffold:Pmarinus_7.0:GL476493:425401:440684:1... [more]
ENSPMAT00000009742.15.086e-5843.90pep scaffold:Pmarinus_7.0:GL481861:10:12380:1 gene... [more]
ENSPMAT00000005861.16.671e-5836.46pep scaffold:Pmarinus_7.0:GL476493:320276:325221:1... [more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIC12.854e-1827.57Protein kinase of the PAK/Ste20 family, required f... [more]
CDC159.427e-1734.43Protein kinase of the Mitotic Exit Network; locali... [more]
SSK221.781e-1332.04MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
FMP481.916e-1329.23Putative protein of unknown function; the authenti... [more]
GIN41.167e-1226.54Protein kinase involved in bud growth and assembly... [more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493701.984e-6338.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413794.751e-6039.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490831.854e-5636.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO304341.971e-5538.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418331.520e-4935.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acvr2bb3.384e-7341.72activin receptor type-2B [Source:NCBI gene;Acc:101... [more]
acvr2ba5.779e-7241.75activin receptor type-2B [Source:NCBI gene;Acc:101... [more]
acvr2ba6.598e-7241.75activin receptor type-2B [Source:NCBI gene;Acc:101... [more]
acvr2ab1.013e-6842.57activin A receptor type 2A [Source:NCBI gene;Acc:1... [more]
acvr2ab1.552e-6842.57activin A receptor type 2A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Receptor protein serine/threonine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070956.10.000e+096.66SMESG000070956.1[more]
SMESG000060769.11.475e-6432.70SMESG000060769.1[more]
SMESG000060769.12.675e-6432.70SMESG000060769.1[more]
SMESG000068827.15.612e-5337.93SMESG000068827.1[more]
SMESG000006023.11.061e-4736.75SMESG000006023.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012283 ID=SMED30012283|Name=Receptor protein serine/threonine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1665bp
CCTTATCTTTGAAACGAATAAGAATCTGTTCATTTTTGCTGATAATAAGC
CAATCATATCAAAATCATAGAATTCGATCCGTATATAAATTTAACTCTCA
ATCTATTGTTGAAAATTGTGAATTTTGTTTATAGAATAAAATGTGGTGTT
ATTGCACTCGATCGCAGCATCACATTTGTAACGAATCTATTGGAAAAATC
AAATGTGCAAATGGAACAAAGCATTGTGTGATTGGCTTATCAGAAAAAGG
AAAAACCCAAAGCTGCTGGGAATGGCCAAATACGTCGGATTGTCCCGATG
AAGCCGGACCGTGCTATTTATTGGGGCACAATACAAAACAACCGGCATGC
TGCTGCAAAGGAAATCTGTGCAATGATATATCTGTGAAATATTCGATAAA
ATTCCCTAAAGTTTATACAACAATAAATCCTCAATCTCTCGTCATGATTC
CCAATACCGGACAAGTAAATATATTTTGGATTTACGTCGTTCTATTATTA
GCAATCTCGTTAATTGCCTCGATTGTATTCATCGTTGTGAAAAGATTTGC
CATCCATTCTAAAACGTCTATCAATTCAAATCGGAAAATATTTGATGTAG
AAAATATAAATGACAATGTCCGAACGCCTATTGCAAAGTTGTGTGAAAAC
GGTAGCAGATATGAAGAAAATACAGTATTAATTAATCAAATTTCTACAGA
AAATTTGTATTCGTTGTGTGATAAAAACCAATTGCTAGCTCAGGGAAGAT
TCGGTCAAGTGTGGAGTGGAATTATTGAAACTAGAAACGAACACAAAAAA
CAAATTGTGGCCATTAAAATCTTTTCAGATAACAAAGAAGGGAAAAAAAG
TTGGCGAAATGAATCAACTGTTTATTCAATTTTGCAAAATGGACCTCATC
CGAACATTCTGAAATATTTTGGAGCAGAGAGAAGAATGAAAGATTCTATA
ACGGAGCTTTGGTTAGTCGTTGAATATTATCCTCTTGGCAGTTTGTGGAA
TTATTTAAAAAAGTCAACTGTCACATGGTCAGATCTTTTACAAATTTGTC
AAAATATCGCTGCTGGCTTGGCCCATTTACATAGCTTCTCAAAACCCATA
AATTCTCCAATTGCTCATCGGGATATTAAGTCGAAAAATATTTTACTCAA
AGAAAATTATACAGCTTGCATCGCAGATTTTGGTTTGGCAATTTGTCACC
AAAACACGGATAATTCATTCAATAACCGAGTTGGAACATTAAGTTACATG
GCCCCAGAAATACTTGAAGGTTCAATTAATTTTGACATTTATTCTTTTTT
GAAAATAGATATATTTTCAATGTCCTTGGTATTTTGGGAAGTATTGAGTC
GTTTTCAATTCTCTGATTTACATATTAAAGATTTTCAAAACCCTTTCCAA
GAAATTGTTGGTGAAAATCCATCATTTGAGCAGTTACGACAATGTGTGAC
GATAAAGAAATTGAGACCTGCATTCAATGAAAACTGGATAAATCTTCCAG
ATGTAATAAAATTTTGGAAAACAATTACAGAATGTTGGGATGAAGATCCA
GATGCTCGATTAAGTGCGGAGTGTGTTCTAGAAAGAATGAATGATCTTTG
TAATATTAACTCTATTGAATAATATTTTTCTATTTGATTTATTTTAAATT
CGTTTAATAAAGTCC
back to top

protein sequence of SMED30012283-orf-1

>SMED30012283-orf-1 ID=SMED30012283-orf-1|Name=SMED30012283-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=494bp
MWCYCTRSQHHICNESIGKIKCANGTKHCVIGLSEKGKTQSCWEWPNTSD
CPDEAGPCYLLGHNTKQPACCCKGNLCNDISVKYSIKFPKVYTTINPQSL
VMIPNTGQVNIFWIYVVLLLAISLIASIVFIVVKRFAIHSKTSINSNRKI
FDVENINDNVRTPIAKLCENGSRYEENTVLINQISTENLYSLCDKNQLLA
QGRFGQVWSGIIETRNEHKKQIVAIKIFSDNKEGKKSWRNESTVYSILQN
GPHPNILKYFGAERRMKDSITELWLVVEYYPLGSLWNYLKKSTVTWSDLL
QICQNIAAGLAHLHSFSKPINSPIAHRDIKSKNILLKENYTACIADFGLA
ICHQNTDNSFNNRVGTLSYMAPEILEGSINFDIYSFLKIDIFSMSLVFWE
VLSRFQFSDLHIKDFQNPFQEIVGENPSFEQLRQCVTIKKLRPAFNENWI
NLPDVIKFWKTITECWDEDPDARLSAECVLERMNDLCNINSIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000299FERM_domain
IPR000333TGFB_receptor
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004675transmembrane receptor protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007178transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000333Ser/Thr protein kinase, TGFB receptorPRINTSPR00653ACTIVIN2Rcoord: 58..81
score: 35.0
coord: 337..358
score: 46.67
coord: 454..473
score: 45.0
IPR000333Ser/Thr protein kinase, TGFB receptorPANTHERPTHR23255TRANSFORMING GROWTH FACTOR-BETA RECEPTOR TYPE I AND IIcoord: 4..489
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 193..481
e-value: 1.6E-23
score: 94.1
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 195..481
e-value: 4.4E-38
score: 131.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 193..486
score: 36.895
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 282..491
e-value: 4.0E-53
score: 182.1
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 186..281
e-value: 1.2E-20
score: 75.3
NoneNo IPR availableTMHMMTMhelixcoord: 111..133
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 324..336
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 194..482