Translocon-associated protein subunit alpha

Overview
NameTranslocon-associated protein subunit alpha
Smed IDSMED30012282
Length (bp)1072
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Translocon-associated protein subunit alpha (SMED30012282) t-SNE clustered cells

Violin plots show distribution of expression levels for Translocon-associated protein subunit alpha (SMED30012282) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Translocon-associated protein subunit alpha (SMED30012282) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Translocon-associated protein subunit alpha (SMED30012282) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012282

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30012282h1SMcG0021403 dd_Smed_v4_1657_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012282h1SMcG0021403 dd_Smed_v4_1657_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012282h1SMcG0021403 Contig42788newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012282h1SMcG0021403 Contig42788uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Human
Match: SSR1 (signal sequence receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:11323])

HSP 1 Score: 130.568 bits (327), Expect = 8.393e-35
Identity = 70/186 (37.63%), Postives = 104/186 (55.91%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTK---QVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSRR 932
            FTN      +D+ ++ ++   RYP DY +Y+QNFT+  L+  + P+R+AT  YSF PA+ + GRPFGL + + Y +  G +F    FN TV VIE E+G D E++F+YM               L  +  L +  +S   K   Q +E+GTS++ D+D+ WIP E L    + SP   PRKR  +R
Sbjct:  107 FTNK---GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYM---------FLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKR 280          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Human
Match: SSR1 (signal sequence receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:11323])

HSP 1 Score: 130.568 bits (327), Expect = 8.881e-35
Identity = 70/187 (37.43%), Postives = 104/187 (55.61%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTK---QVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSRRH 935
            FTN      +D+ ++ ++   RYP DY +Y+QNFT+  L+  + P+R+AT  YSF PA+ + GRPFGL + + Y +  G +F    FN TV VIE E+G D E++F+YM               L  +  L +  +S   K   Q +E+GTS++ D+D+ WIP E L    + SP   PRKR  +R 
Sbjct:  107 FTNK---GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYM---------FLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRS 281          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Human
Match: SSR1 (signal sequence receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:11323])

HSP 1 Score: 129.413 bits (324), Expect = 2.639e-34
Identity = 70/191 (36.65%), Postives = 105/191 (54.97%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTK---QVMELGTSNKADLDLQWIPAEHL-------KVRQSPTISPRKRKSRR 932
            FTN      +D+ ++ ++   RYP DY +Y+QNFT+  L+  + P+R+AT  YSF PA+ + GRPFGL + + Y +  G +F    FN TV VIE E+G D E++F+YM               L  +  L +  +S   K   Q +E+GTS++ D+D+ WIP E L       + + SP   PRKR  +R
Sbjct:  107 FTNK---GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYM---------FLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQIMQSRRDKASPRRLPRKRAQKR 285          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Human
Match: SSR1 (signal sequence receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:11323])

HSP 1 Score: 129.028 bits (323), Expect = 3.921e-34
Identity = 70/191 (36.65%), Postives = 105/191 (54.97%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTK---QVMELGTSNKADLDLQWIPAEHL-------KVRQSPTISPRKRKSRR 932
            FTN      +D+ ++ ++   RYP DY +Y+QNFT+  L+  + P+R+AT  YSF PA+ + GRPFGL + + Y +  G +F    FN TV VIE E+G D E++F+YM               L  +  L +  +S   K   Q +E+GTS++ D+D+ WIP E L       + + SP   PRKR  +R
Sbjct:  107 FTNK---GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYM---------FLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQIMQSRRDKASPRRLPRKRAQKR 285          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Human
Match: SSR1 (signal sequence receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:11323])

HSP 1 Score: 122.094 bits (305), Expect = 7.709e-32
Identity = 63/167 (37.72%), Postives = 95/167 (56.89%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTK---QVMELGTSNKADLDLQWIPAEHL 881
            FTN      +D+ ++ ++   RYP DY +Y+QNFT+  L+  + P+R+AT  YSF PA+ + GRPFGL + + Y +  G +F    FN TV VIE E+G D E++F+YM               L  +  L +  +S   K   Q +E+GTS++ D+D+ WIP E L
Sbjct:  107 FTNK---GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYM---------FLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETL 261          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Celegans
Match: trap-1 (TRanslocon-Associated Protein [Source:UniProtKB/TrEMBL;Acc:Q95XT5])

HSP 1 Score: 111.694 bits (278), Expect = 1.875e-28
Identity = 64/179 (35.75%), Postives = 106/179 (59.22%), Query Frame = 3
Query:  417 KDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTK-QVMELGTSNKADLDLQWIPAEHLKVRQ--SP-TISPRKRKSRRHED 941
            KD+ + Y E   R+P+D+SY+LQNFT    +  + PK E T+ Y F   +  AGRP GL + V Y + +G +F +  +N T+ ++E + GF  E+ FL++        +  G  +L   +  K  +KSG++K +V+E GTS  +++D +WIP + +K ++  SP T+SP+ RKS +  D
Sbjct:   85 KDFVVKYAETSFRFPTDHSYHLQNFTRGEYNRRVAPKEEVTLDYGFYAHETFAGRPVGLVVNVHYQDADGNVFVNNVYNQTINIMEDDSGFSGETGFLFI----FFVALSIGGLYLSNQFLSKLSRKSGLSKRRVVEQGTS--SEVDFEWIPRDAVKNKEKRSPATVSPKARKSAKKAD 257          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Fly
Match: l(1)G0320 (gene:FBgn0028327 transcript:FBtr0343412)

HSP 1 Score: 113.62 bits (283), Expect = 1.112e-28
Identity = 64/181 (35.36%), Postives = 106/181 (58.56%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKVRQSPTISPRKRKSRR 932
            FTN      +++ ++ VE   RYP D++Y++QNF++   +  ++P  E+TV Y+F P+ Q AGRPFGL + + Y +  G  +    FN+TV + E++EG D E+ FLY+L+A ++ L+L          + K  +K    K+V+E GT+N + +D  W+P E L+  Q    SP K K+ +
Sbjct:   99 FTNK---GAEEFVIETVEASFRYPMDFNYFIQNFSAVAYNREVKPGFESTVSYTFLPSDQFAGRPFGLNIALAYRDANGIQYNEAVFNETVLISEVDEGLDGETFFLYVLLAGIVVLLLVIGQQYLLGSSGK--RKRAAAKKVIETGTANDSTIDYDWVPQETLRALQK---SPPKSKTPK 271          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Fly
Match: l(1)G0320 (gene:FBgn0028327 transcript:FBtr0071372)

HSP 1 Score: 113.62 bits (283), Expect = 1.112e-28
Identity = 64/181 (35.36%), Postives = 106/181 (58.56%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKVRQSPTISPRKRKSRR 932
            FTN      +++ ++ VE   RYP D++Y++QNF++   +  ++P  E+TV Y+F P+ Q AGRPFGL + + Y +  G  +    FN+TV + E++EG D E+ FLY+L+A ++ L+L          + K  +K    K+V+E GT+N + +D  W+P E L+  Q    SP K K+ +
Sbjct:   99 FTNK---GAEEFVIETVEASFRYPMDFNYFIQNFSAVAYNREVKPGFESTVSYTFLPSDQFAGRPFGLNIALAYRDANGIQYNEAVFNETVLISEVDEGLDGETFFLYVLLAGIVVLLLVIGQQYLLGSSGK--RKRAAAKKVIETGTANDSTIDYDWVPQETLRALQK---SPPKSKTPK 271          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Zebrafish
Match: ssr1 (signal sequence receptor, alpha [Source:ZFIN;Acc:ZDB-GENE-030826-28])

HSP 1 Score: 113.235 bits (282), Expect = 1.015e-28
Identity = 53/157 (33.76%), Postives = 95/157 (60.51%), Query Frame = 3
Query:  414 NKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLK 884
            ++++ ++ ++   RYP D+ +Y+QNFT+  L   + P+R+AT  YSF PA+ + GRPFGL + + Y ++ G +F    FN TV + E E+G D E++F+Y+ ++ +  L++ G++ L     +++          +E+ TSN  D+D+ WIP E L 
Sbjct:  116 SENFVVESLDASFRYPQDFQFYIQNFTALQLGTLVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYRDDSGNVFQDAVFNQTVTITEREDGLDGETIFMYVFLSGLGLLLVIGLHQLLESRKMRR------PAAKVEMDTSNHNDVDMSWIPQETLN 266          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Xenopus
Match: ssr1 (signal sequence receptor, alpha (translocon-associated protein alpha) [Source:NCBI gene;Acc:549666])

HSP 1 Score: 128.642 bits (322), Expect = 3.519e-34
Identity = 69/183 (37.70%), Postives = 107/183 (58.47%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSRR 932
            FTN   +N   + ++ ++   RYP DY +Y+QNFT+  L+  + P+++AT  YSF PA+ + GRPFGL + + Y +  G  F    FN TV + E E+G D E++F+Y+ +  +  LV+ G++ L      K+        Q +E+GTSN+ D+D+ WIP E L    + SP  SPRKR  +R
Sbjct:  107 FTNKGPEN---FIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQKQATFEYSFIPAEPMGGRPFGLVINLNYKDANGNAFQDAVFNQTVTITEKEDGLDGETIFMYLFLGGLGLLVIVGLHQLLESRKRKR------PAQKVEMGTSNQNDVDMSWIPPETLSQINKASPRRSPRKRGPKR 280          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Xenopus
Match: ssr1 (signal sequence receptor, alpha (translocon-associated protein alpha) [Source:NCBI gene;Acc:549666])

HSP 1 Score: 128.257 bits (321), Expect = 4.814e-34
Identity = 69/183 (37.70%), Postives = 107/183 (58.47%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSRR 932
            FTN   +N   + ++ ++   RYP DY +Y+QNFT+  L+  + P+++AT  YSF PA+ + GRPFGL + + Y +  G  F    FN TV + E E+G D E++F+Y+ +  +  LV+ G++ L      K+        Q +E+GTSN+ D+D+ WIP E L    + SP  SPRKR  +R
Sbjct:   98 FTNKGPEN---FIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQKQATFEYSFIPAEPMGGRPFGLVINLNYKDANGNAFQDAVFNQTVTITEKEDGLDGETIFMYLFLGGLGLLVIVGLHQLLESRKRKR------PAQKVEMGTSNQNDVDMSWIPPETLSQINKASPRRSPRKRGPKR 271          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Xenopus
Match: ssr1 (signal sequence receptor, alpha (translocon-associated protein alpha) [Source:NCBI gene;Acc:549666])

HSP 1 Score: 127.102 bits (318), Expect = 1.303e-33
Identity = 69/188 (36.70%), Postives = 108/188 (57.45%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHL-------KVRQSPTISPRKRKSRR 932
            FTN   +N   + ++ ++   RYP DY +Y+QNFT+  L+  + P+++AT  YSF PA+ + GRPFGL + + Y +  G  F    FN TV + E E+G D E++F+Y+ +  +  LV+ G++ L      K+        Q +E+GTSN+ D+D+ WIP E L       + + SP  SPRKR  +R
Sbjct:  107 FTNKGPEN---FIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQKQATFEYSFIPAEPMGGRPFGLVINLNYKDANGNAFQDAVFNQTVTITEKEDGLDGETIFMYLFLGGLGLLVIVGLHQLLESRKRKR------PAQKVEMGTSNQNDVDMSWIPPETLSQIMQSRRDKASPRRSPRKRGPKR 285          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Mouse
Match: Ssr1 (signal sequence receptor, alpha [Source:MGI Symbol;Acc:MGI:105082])

HSP 1 Score: 130.954 bits (328), Expect = 3.718e-35
Identity = 72/183 (39.34%), Postives = 109/183 (59.56%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSRR 932
            FTN      +D+ ++ ++   RYP DY +Y+QNFT+  L+  + P+R+AT  YSF PA+ + GRPFGL + + Y +  G +F    FN TV VIE E+G D E++F+YM +A +  LV+ G++ L      K+        Q +E+GTS++ D+D+ WIP E L    + SP   PRKR  +R
Sbjct:  107 FTNK---GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVVVGLHQLLESRKRKR------PIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRQPRKRAQKR 280          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Mouse
Match: Ssr1 (signal sequence receptor, alpha [Source:MGI Symbol;Acc:MGI:105082])

HSP 1 Score: 129.798 bits (325), Expect = 1.314e-34
Identity = 72/188 (38.30%), Postives = 110/188 (58.51%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHL-------KVRQSPTISPRKRKSRR 932
            FTN      +D+ ++ ++   RYP DY +Y+QNFT+  L+  + P+R+AT  YSF PA+ + GRPFGL + + Y +  G +F    FN TV VIE E+G D E++F+YM +A +  LV+ G++ L      K+        Q +E+GTS++ D+D+ WIP E L       + + SP   PRKR  +R
Sbjct:  107 FTNK---GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVVVGLHQLLESRKRKR------PIQKVEMGTSSQNDVDMSWIPQETLNQIMQSRRDKASPRRQPRKRAQKR 285          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Mouse
Match: Ssr1 (signal sequence receptor, alpha [Source:MGI Symbol;Acc:MGI:105082])

HSP 1 Score: 123.25 bits (308), Expect = 6.337e-32
Identity = 71/193 (36.79%), Postives = 111/193 (57.51%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKVRQSPTISPRKRKSRRHEDNHVTGH*II 968
            FTN      +D+ ++ ++   RYP DY +Y+QNFT+  L+  + P+R+AT  YSF PA+ + GRPFGL + + Y +  G +F    FN TV VIE E+G D E++F+YM +A +  LV+ G++ L       + +K     Q +E+GTS++ D+D+ WIP E L       IS    + RR E+     H ++
Sbjct:  107 FTNK---GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVVVGLHQLL------ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLN-----QIS--AERERRAEETLQLSHPVV 283          
BLAST of Translocon-associated protein subunit alpha vs. UniProt/SwissProt
Match: sp|P45433|SSRA_ONCMY (Translocon-associated protein subunit alpha OS=Oncorhynchus mykiss OX=8022 GN=ssr1 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 9.497e-35
Identity = 69/184 (37.50%), Postives = 108/184 (58.70%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHL----KVRQSPTISPRKRKSR 929
            FTN     ++D+ +  +E   RYP D+ +Y+QNFT+  L   ++P+++A+  YSF PAQ +AGRPFGL + + Y ++EG  F +  +N TV ++E+EEG D E++F+Y+ +  ++ L +FG+Y +      K+F         +E GT     +D+ WIP E L    K   SP  SPRKR  R
Sbjct:  108 FTNK---GSQDFTVHSLEASFRYPQDFQFYIQNFTALPLSTVVQPQKQASFEYSFIPAQPMAGRPFGLVILLNYQDSEGNGFQTAIYNQTVTIVELEEGLDGETIFMYIFLTGLVVLAVFGMYQVLESRTRKRFPVK------VETGTGGMNGVDISWIPQETLNIMSKASASPKASPRKRTKR 282          
BLAST of Translocon-associated protein subunit alpha vs. UniProt/SwissProt
Match: sp|Q9CY50|SSRA_MOUSE (Translocon-associated protein subunit alpha OS=Mus musculus OX=10090 GN=Ssr1 PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 2.601e-34
Identity = 72/183 (39.34%), Postives = 109/183 (59.56%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSRR 932
            FTN      +D+ ++ ++   RYP DY +Y+QNFT+  L+  + P+R+AT  YSF PA+ + GRPFGL + + Y +  G +F    FN TV VIE E+G D E++F+YM +A +  LV+ G++ L      K+        Q +E+GTS++ D+D+ WIP E L    + SP   PRKR  +R
Sbjct:  107 FTNK---GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVVVGLHQLLESRKRKR------PIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRQPRKRAQKR 280          
BLAST of Translocon-associated protein subunit alpha vs. UniProt/SwissProt
Match: sp|P43307|SSRA_HUMAN (Translocon-associated protein subunit alpha OS=Homo sapiens OX=9606 GN=SSR1 PE=1 SV=3)

HSP 1 Score: 130.568 bits (327), Expect = 4.031e-34
Identity = 70/186 (37.63%), Postives = 104/186 (55.91%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTK---QVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSRR 932
            FTN      +D+ ++ ++   RYP DY +Y+QNFT+  L+  + P+R+AT  YSF PA+ + GRPFGL + + Y +  G +F    FN TV VIE E+G D E++F+YM               L  +  L +  +S   K   Q +E+GTS++ D+D+ WIP E L    + SP   PRKR  +R
Sbjct:  107 FTNK---GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYM---------FLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKR 280          
BLAST of Translocon-associated protein subunit alpha vs. UniProt/SwissProt
Match: sp|A6QLP7|SSRA_BOVIN (Translocon-associated protein subunit alpha OS=Bos taurus OX=9913 GN=SSR1 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 9.573e-34
Identity = 71/183 (38.80%), Postives = 110/183 (60.11%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSRR 932
            FTN      +D+ ++ ++   RYP DY +Y+QNFT+  L+  + P+R+AT  YSF PA+ + GRPFGL + + Y +  G +F    FN TV +IE E+G D E++F+YM +A +  LV+ G++ L       + +K     Q +E+GTS++ D+D+ WIP E L    + SP   PRKR  +R
Sbjct:  107 FTNK---GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTIIEREDGLDGETIFMYMFLAGLGLLVVVGLHQLL------ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKR 280          
BLAST of Translocon-associated protein subunit alpha vs. UniProt/SwissProt
Match: sp|P16967|SSRA_CANLF (Translocon-associated protein subunit alpha OS=Canis lupus familiaris OX=9615 GN=SSR1 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 9.877e-34
Identity = 71/183 (38.80%), Postives = 109/183 (59.56%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSRR 932
            FTN      +D+ ++ ++   RYP DY +Y+QNFT+  L+  + P+R+AT  YSF PA+ + GRPFGL + + Y +  G +F    FN TV +IE E+G D E++F+YM +A +  LV+ G++ L      K+        Q +E+GTS++ D+D+ WIP E L    + SP   PRKR  +R
Sbjct:  107 FTNK---GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTIIEREDGLDGETIFMYMFLAGLGLLVVVGLHQLLESRKRKR------PIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKR 280          
BLAST of Translocon-associated protein subunit alpha vs. TrEMBL
Match: A0A0P4WHD0 (Uncharacterized protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 2.420e-38
Identity = 74/182 (40.66%), Postives = 117/182 (64.29%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHL-KVRQSPTISPRKRKSRR 932
            FTN+    +KD+ LD ++   RYP D+++Y+QNFT+   +  ++P++EATV YSF PA+  A RP GLT+ + YH+ +G  F    FN TV ++E++EG D E+ FLY+ + A   L+L   +H  + +  KK    G  K V+E+GTS + D+D  W+P E L +++++P  SPR RK++R
Sbjct:  113 FTNN---GDKDFILDAIDASFRYPMDFNFYIQNFTAIPYNRAVKPRQEATVMYSFYPAEAFAARPLGLTVNLAYHDADGNSFLEAVFNQTVSIVELDEGMDGETFFLYVFLLAFSVLLLVAGHHFLSSFGRKK----GSKKAVVEVGTSKRDDVDYDWLPKEVLNEIKKTPRQSPRTRKAKR 287          
BLAST of Translocon-associated protein subunit alpha vs. TrEMBL
Match: A0A423TZN8 (Translocon-associated protein subunit alpha OS=Penaeus vannamei OX=6689 GN=C7M84_024914 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 7.736e-38
Identity = 70/186 (37.63%), Postives = 117/186 (62.90%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHL-KVRQSPTISPRKRKSRRHEDN 944
            FTN+    +KD+ LD ++   RYP D+++Y+QNFT+   +  ++P++EATV YSF PA+  AGRP GLT+ + YH+ +G +F    FN TV ++E++EG D E+ FLY+ + A   L+L   +H  + +     ++ G  +  +E+GT     +D  W+P E L ++++SP  SPR+RK+ R  ++
Sbjct:   37 FTNN---GDKDFILDAIDASFRYPMDFNFYIQNFTAIPYNRAVKPRQEATVMYSFYPAEAFAGRPLGLTVNLAYHDADGNVFVDPVFNQTVNIVEVDEGMDGETFFLYIFMLAFAVLLLVAGHHFLSSFG----RRRGGKRHTVEMGTKKSNSVDYDWLPKELLSEIKKSPRQSPRQRKAARETNS 215          
BLAST of Translocon-associated protein subunit alpha vs. TrEMBL
Match: A0A2D0PN21 (translocon-associated protein subunit alpha-like OS=Ictalurus punctatus OX=7998 GN=LOC108255209 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 9.557e-37
Identity = 72/182 (39.56%), Postives = 112/182 (61.54%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSR 929
            FTN     ++D+ +  +E   RYP DY +Y+QNFT+  LD  ++P+ +A+  YSF PAQ +AGRPFGL + + YH++EG +F S  FN TV + E++EG D E++F+Y+ +  ++ L+      LF +Y + + +        +E+GT    D+D+ WIP E L V  + SP  SPRKR +R
Sbjct:  110 FTNK---GSQDFTVRSLEASFRYPQDYQFYIQNFTALQLDAVVQPENQASFEYSFIPAQPMAGRPFGLVILLNYHDSEGNIFQSAIFNQTVTITELDEGLDGETMFMYIFLGGLVFLI------LFGMYQVLESRTRKRVPVKVEMGTGGMNDVDISWIPQETLNVMNKASPRASPRKRATR 282          
BLAST of Translocon-associated protein subunit alpha vs. TrEMBL
Match: A0A5N5J6Q9 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00248800 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 8.781e-35
Identity = 70/182 (38.46%), Postives = 106/182 (58.24%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSR 929
            FTN     ++D+ +  +E   RYP DY +Y+QNFT+  L+  ++P+++A+  YSF PAQ +AGRPFGL + + YH++EG +F S  FN TV + E++EG D E++F+Y+       L       LF +Y + + +        +E GT    D+D+ WIP E L    + SP  SPRKR  R
Sbjct:  111 FTNK---GSQDFTVRSLEASFRYPQDYQFYIQNFTALQLEAVVQPEKQASFEYSFIPAQPMAGRPFGLVILLNYHDSEGNVFQSAIFNQTVTITELDEGLDGETMFMYI------FLGGLVFLMLFGLYQVLESRTRKRVPVKVETGTGGMNDVDISWIPQETLNAMNKASPRASPRKRARR 283          
BLAST of Translocon-associated protein subunit alpha vs. TrEMBL
Match: A0A0P7URY9 (Translocon-associated protein subunit alpha-like OS=Scleropages formosus OX=113540 GN=Z043_108944 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.100e-34
Identity = 71/182 (39.01%), Postives = 110/182 (60.44%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSR 929
            FTN      +D+ +  +E   RYP D+ +Y+QNFT+  L+  ++P+R+A+  YSF PAQ +AGRPFGL + + Y ++EG  F ST +N TV + E+EEG D E++F+Y+ ++ ++ L+      LF +Y + + +        +E GT    D+D+ WIP E LK   + SP  SPRKR  R
Sbjct:   92 FTNK---GEQDFAVRSLEASFRYPQDFQFYIQNFTALPLNTVVQPQRQASFEYSFIPAQPMAGRPFGLVILLNYQDSEGNTFQSTIYNQTVTITELEEGLDGETMFMYVFLSGLVVLL------LFGIYQVLESRTRKRLPAKVETGTGGLRDVDISWIPQETLKAMNKTSPRASPRKRAKR 264          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Cavefish
Match: ssr1 (signal sequence receptor subunit 1 [Source:NCBI gene;Acc:103036917])

HSP 1 Score: 129.413 bits (324), Expect = 7.533e-35
Identity = 71/183 (38.80%), Postives = 111/183 (60.66%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSRR 932
            FTN   +N   + ++ ++   RYP D+ +Y+QNFT+  L + + P+R+AT  YSF PA+ + GRPFGL + + Y +N G +F    FN TV + E E+G D E++F+Y+ ++ +  LV+ G++ L     L+  K+     +V E+GTSN  D+D+ WIP E L    + SP  SPRKR  +R
Sbjct:   94 FTNKGSEN---FVVESLDASFRYPQDFQFYIQNFTALQLGLVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDNNGNVFQDAVFNQTVTITEKEDGLDGETIFMYVFLSGLGLLVVVGLHQL-----LESRKRRRPAAKV-EMGTSNHNDVDMSWIPQETLNQINKASPRRSPRKRTQKR 267          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Cavefish
Match: ssr1 (signal sequence receptor subunit 1 [Source:NCBI gene;Acc:103036917])

HSP 1 Score: 128.257 bits (321), Expect = 3.587e-34
Identity = 71/188 (37.77%), Postives = 112/188 (59.57%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHL-------KVRQSPTISPRKRKSRR 932
            FTN   +N   + ++ ++   RYP D+ +Y+QNFT+  L + + P+R+AT  YSF PA+ + GRPFGL + + Y +N G +F    FN TV + E E+G D E++F+Y+ ++ +  LV+ G++ L     L+  K+     +V E+GTSN  D+D+ WIP E L       + + SP  SPRKR  +R
Sbjct:  113 FTNKGSEN---FVVESLDASFRYPQDFQFYIQNFTALQLGLVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDNNGNVFQDAVFNQTVTITEKEDGLDGETIFMYVFLSGLGLLVVVGLHQL-----LESRKRRRPAAKV-EMGTSNHNDVDMSWIPQETLNQIMQSRRDKASPRRSPRKRTQKR 291          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Sea Lamprey
Match: ssr1 (signal sequence receptor, alpha [Source:ZFIN;Acc:ZDB-GENE-030826-28])

HSP 1 Score: 124.405 bits (311), Expect = 1.118e-33
Identity = 68/179 (37.99%), Postives = 109/179 (60.89%), Query Frame = 3
Query:  408 DNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLK--VRQSPTISPRKRKSRRHE 938
            + ++++ ++ ++   RYP D+ +Y+QNFT+  LD  ++P  +AT  YSF PA+ + GRPFGL + +GY +   + +    FN TV V E +EG D E+ F+YM +A ++ L+L G + L     L+  K+   + + +E+GTSN   +D+ WIP E L    + SP  SPRKR +RR E
Sbjct:   97 NGSEEFVVESLDASFRYPQDFQFYIQNFTALQLDTLVKPHHQATFEYSFIPAEPMGGRPFGLVISLGYRDATAQ-YRDAVFNQTVTVTEPDEGIDGETFFMYMFLAGLVVLLLVGAHQL-----LESRKRKRPSAKPVEMGTSNPNGVDMSWIPQETLNHMNKASPKRSPRKRVTRRSE 269          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Nematostella
Match: EDO46015 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRI8])

HSP 1 Score: 122.094 bits (305), Expect = 2.570e-32
Identity = 60/152 (39.47%), Postives = 96/152 (63.16%), Query Frame = 3
Query:  420 DYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAE 875
            D+ +D +E  LRYP DYSYY+QNFT+   +  ++P  +A+  Y+F P +   GRPFGL++ + Y + +GK++    FN+TVQ++E +EG D E+ FLY+ +AA+  L++   +     Y L   KKS  +K  +E+GT    D+D +W+P E
Sbjct:  119 DFMVDMMEASLRYPQDYSYYIQNFTAFQYNTVVKPGHQASFEYAFRPHESFGGRPFGLSINLLYKDTDGKMYRDAVFNETVQLVESDEGMDGETFFLYLFIAAIALLLVMAAH-----YGLTSIKKSS-SKAPIEMGTQQDGDIDYEWLPKE 264          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Medaka
Match: ssr1 (signal sequence receptor subunit 1 [Source:NCBI gene;Acc:101155969])

HSP 1 Score: 130.183 bits (326), Expect = 6.979e-35
Identity = 70/183 (38.25%), Postives = 107/183 (58.47%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSRR 932
            FTN   +N   + +D ++   RYP DY +Y+QNFT+  L   + P R+AT  YSF PA+ + GRPFGL + + Y ++ G +F    FN TV + E E+G D E++F+Y+ ++ +  LV      +  ++ L + +K     Q +E GTS+  D+D+ WIPAE L    + SP  SPRKR  +R
Sbjct:  113 FTNKGPEN---FVVDSLDASFRYPQDYQFYIQNFTALQLGTVVPPGRQATFEYSFIPAEPMGGRPFGLVINLNYKDSSGNIFQDAVFNQTVTITEREDGLDGETIFMYVFLSGLGLLV------IVGLHQLLESRKRRRPAQKVETGTSSHNDVDMSWIPAETLNQINKASPRRSPRKRNQKR 286          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Medaka
Match: ssr1 (signal sequence receptor subunit 1 [Source:NCBI gene;Acc:101155969])

HSP 1 Score: 129.028 bits (323), Expect = 2.304e-34
Identity = 70/188 (37.23%), Postives = 108/188 (57.45%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHL-------KVRQSPTISPRKRKSRR 932
            FTN   +N   + +D ++   RYP DY +Y+QNFT+  L   + P R+AT  YSF PA+ + GRPFGL + + Y ++ G +F    FN TV + E E+G D E++F+Y+ ++ +  LV      +  ++ L + +K     Q +E GTS+  D+D+ WIPAE L       + + SP  SPRKR  +R
Sbjct:  113 FTNKGPEN---FVVDSLDASFRYPQDYQFYIQNFTALQLGTVVPPGRQATFEYSFIPAEPMGGRPFGLVINLNYKDSSGNIFQDAVFNQTVTITEREDGLDGETIFMYVFLSGLGLLV------IVGLHQLLESRKRRRPAQKVETGTSSHNDVDMSWIPAETLNQIMQSRRDKASPRRSPRKRNQKR 291          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000019560.2 (translocon-associated protein subunit alpha [Source:NCBI gene;Acc:101155508])

HSP 1 Score: 121.709 bits (304), Expect = 8.839e-32
Identity = 65/182 (35.71%), Postives = 107/182 (58.79%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKV--RQSPTISPRKRKSR 929
            FTN     ++ + +  +E   RYP D+ +++QNFT+  L+  ++P+ +A+  YSF PAQ +AGRPFGL + + Y  +EG ++ +  +N TV + E EEG D E++F+Y+ +  ++ L+LFG+Y +      K+          +E GT+   D+D+ WIP E L    + SP  SP+KR  R
Sbjct:  109 FTNK---GSQTFTVQSLEASFRYPQDFQFFIQNFTALPLNTVVQPQAQASFEYSFIPAQPMAGRPFGLVILLSYLGSEGGVYQTAIYNQTVTITEREEGLDGETMFMYVFLFGLVALMLFGMYQVLESRTRKRLPVK------IEKGTAGLNDVDISWIPTETLNAMNKASPKTSPKKRAKR 281          
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Medaka
Match: ssr1 (signal sequence receptor subunit 1 [Source:NCBI gene;Acc:101155969])

HSP 1 Score: 119.013 bits (297), Expect = 1.488e-30
Identity = 62/164 (37.80%), Postives = 97/164 (59.15%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHL 881
            FTN   +N   + +D ++   RYP DY +Y+QNFT+  L   + P R+AT  YSF PA+ + GRPFGL + + Y ++ G +F    FN TV + E E+G D E++F+Y+ ++ +  LV      +  ++ L + +K     Q +E GTS+  D+D+ WIPAE L
Sbjct:  113 FTNKGPEN---FVVDSLDASFRYPQDYQFYIQNFTALQLGTVVPPGRQATFEYSFIPAEPMGGRPFGLVINLNYKDSSGNIFQDAVFNQTVTITEREDGLDGETIFMYVFLSGLGLLV------IVGLHQLLESRKRRRPAQKVETGTSSHNDVDMSWIPAETL 267          
BLAST of Translocon-associated protein subunit alpha vs. Planmine SMEST
Match: SMESG000013803.1 (SMESG000013803.1)

HSP 1 Score: 368.237 bits (944), Expect = 6.499e-150
Identity = 190/190 (100.00%), Postives = 190/190 (100.00%), Query Frame = 3
Query:  390 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMXXXXXXXXXXXXXYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKVRQSPTISPRKRKSRRHEDNHVTGH 959
            FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMLVAAVLGLVLFGVYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKVRQSPTISPRKRKSRRHEDNHVTGH
Sbjct:  118 FTNDEMDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSFTPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESLFLYMLVAAVLGLVLFGVYHLFTVYALKKFKKSGVTKQVMELGTSNKADLDLQWIPAEHLKVRQSPTISPRKRKSRRHEDNHVTGH 307          

HSP 2 Score: 182.185 bits (461), Expect = 6.499e-150
Identity = 115/117 (98.29%), Postives = 116/117 (99.15%), Query Frame = 1
Query:   40 MFYKALFFLFLISAPFIKAQSNEDPIXXXXXXXXXXXXXXXXXXXXXXXXKLNEDKIVTEILDSPQDQTEQAFVDGVPAGSKNVKTELLFTEPPYNKRSNGVGIELPANKPVKILIS 390
            MFYKALFFLFLISAPFIKAQSNEDPISASSVESD+EDVVTDDSAAEEAEDKLNEDKIVTEILDS QDQTEQAFVDGVPAGSKNVKTELLFTEPPYNKRSNGVGIELPANKPVKILIS
Sbjct:    1 MFYKALFFLFLISAPFIKAQSNEDPISASSVESDDEDVVTDDSAAEEAEDKLNEDKIVTEILDSQQDQTEQAFVDGVPAGSKNVKTELLFTEPPYNKRSNGVGIELPANKPVKILIS 117          
The following BLAST results are available for this feature:
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SSR18.393e-3537.63signal sequence receptor subunit 1 [Source:HGNC Sy... [more]
SSR18.881e-3537.43signal sequence receptor subunit 1 [Source:HGNC Sy... [more]
SSR12.639e-3436.65signal sequence receptor subunit 1 [Source:HGNC Sy... [more]
SSR13.921e-3436.65signal sequence receptor subunit 1 [Source:HGNC Sy... [more]
SSR17.709e-3237.72signal sequence receptor subunit 1 [Source:HGNC Sy... [more]
back to top
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trap-11.875e-2835.75TRanslocon-Associated Protein [Source:UniProtKB/T... [more]
back to top
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
l(1)G03201.112e-2835.36gene:FBgn0028327 transcript:FBtr0343412[more]
l(1)G03201.112e-2835.36gene:FBgn0028327 transcript:FBtr0071372[more]
back to top
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ssr11.015e-2833.76signal sequence receptor, alpha [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ssr13.519e-3437.70signal sequence receptor, alpha (translocon-associ... [more]
ssr14.814e-3437.70signal sequence receptor, alpha (translocon-associ... [more]
ssr11.303e-3336.70signal sequence receptor, alpha (translocon-associ... [more]
back to top
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ssr13.718e-3539.34signal sequence receptor, alpha [Source:MGI Symbol... [more]
Ssr11.314e-3438.30signal sequence receptor, alpha [Source:MGI Symbol... [more]
Ssr16.337e-3236.79signal sequence receptor, alpha [Source:MGI Symbol... [more]
back to top
BLAST of Translocon-associated protein subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P45433|SSRA_ONCMY9.497e-3537.50Translocon-associated protein subunit alpha OS=Onc... [more]
sp|Q9CY50|SSRA_MOUSE2.601e-3439.34Translocon-associated protein subunit alpha OS=Mus... [more]
sp|P43307|SSRA_HUMAN4.031e-3437.63Translocon-associated protein subunit alpha OS=Hom... [more]
sp|A6QLP7|SSRA_BOVIN9.573e-3438.80Translocon-associated protein subunit alpha OS=Bos... [more]
sp|P16967|SSRA_CANLF9.877e-3438.80Translocon-associated protein subunit alpha OS=Can... [more]
back to top
BLAST of Translocon-associated protein subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0P4WHD02.420e-3840.66Uncharacterized protein OS=Scylla olivacea OX=8555... [more]
A0A423TZN87.736e-3837.63Translocon-associated protein subunit alpha OS=Pen... [more]
A0A2D0PN219.557e-3739.56translocon-associated protein subunit alpha-like O... [more]
A0A5N5J6Q98.781e-3538.46Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A0P7URY91.100e-3439.01Translocon-associated protein subunit alpha-like O... [more]
back to top
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ssr17.533e-3538.80signal sequence receptor subunit 1 [Source:NCBI ge... [more]
ssr13.587e-3437.77signal sequence receptor subunit 1 [Source:NCBI ge... [more]
back to top
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ssr11.118e-3337.99signal sequence receptor, alpha [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO460152.570e-3239.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Translocon-associated protein subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ssr16.979e-3538.25signal sequence receptor subunit 1 [Source:NCBI ge... [more]
ssr12.304e-3437.23signal sequence receptor subunit 1 [Source:NCBI ge... [more]
ENSORLT00000019560.28.839e-3235.71translocon-associated protein subunit alpha [Sourc... [more]
ssr11.488e-3037.80signal sequence receptor subunit 1 [Source:NCBI ge... [more]
back to top
BLAST of Translocon-associated protein subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000013803.16.499e-150100.00SMESG000013803.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012282 ID=SMED30012282|Name=Translocon-associated protein subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1072bp
TCATTATTTCGTGTTGTCGTAGCTTTAACGTGGTGTATTATGTTTTACAA
AGCTCTATTTTTTCTTTTCTTAATCAGCGCTCCTTTCATTAAAGCTCAGT
CAAATGAGGATCCGATATCTGCATCATCAGTTGAATCAGACGAAGAAGAT
GTAGTAACTGATGATTCTGCGGCTGAAGAGGCTGAAGATAAACTAAATGA
AGACAAGATAGTTACGGAAATACTAGATAGTCCGCAAGATCAAACAGAAC
AGGCTTTTGTTGACGGTGTACCAGCAGGTTCAAAAAATGTAAAAACTGAA
TTATTATTTACTGAACCCCCATATAATAAAAGATCAAATGGAGTTGGGAT
TGAATTGCCAGCTAATAAACCAGTTAAAATCTTAATTAGTTCACAAATGA
CGAAATGGATAATAATAAAGATTACAAATTAGACTATGTTGAAGGTTTCT
TACGTTATCCATCAGACTACTCATATTATTTGCAAAATTTTACATCTCGA
CATCTTGATGTTACAATTGAACCTAAAAGAGAGGCAACAGTGTTTTATTC
GTTTACTCCAGCTCAACAATTAGCTGGTAGACCATTCGGATTAACTTTAA
GAGTTGGTTATCATAACAACGAAGGAAAACTGTTTACAAGCACATTTTTT
AACGACACTGTTCAGGTTATCGAAATAGAAGAAGGATTTGATACGGAATC
TCTATTTTTGTATATGTTGGTTGCTGCTGTCTTAGGTTTAGTGTTATTCG
GAGTTTATCATTTATTTACCGTGTACGCTTTAAAAAAATTCAAGAAAAGT
GGTGTTACTAAGCAAGTAATGGAATTGGGAACATCCAATAAAGCAGATCT
GGATCTACAATGGATTCCTGCTGAACATTTGAAAGTTCGTCAGTCCCCAA
CCATTTCTCCTAGAAAACGAAAGAGTCGACGACATGAAGATAACCATGTT
ACAGGACATTAAATAATTTTGATTGGAATATTTACATACGAAAATTTGTA
TTTAGTTTTACTGATAATTCCTTAGAGTGGTTTGAATTTGAATGATTGAG
GTTGTGCAATAAGTTTGTGTTG
back to top

protein sequence of SMED30012282-orf-1

>SMED30012282-orf-1 ID=SMED30012282-orf-1|Name=SMED30012282-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=186bp
MDNNKDYKLDYVEGFLRYPSDYSYYLQNFTSRHLDVTIEPKREATVFYSF
TPAQQLAGRPFGLTLRVGYHNNEGKLFTSTFFNDTVQVIEIEEGFDTESL
FLYMLVAAVLGLVLFGVYHLFTVYALKKFKKSGVTKQVMELGTSNKADLD
LQWIPAEHLKVRQSPTISPRKRKSRRHEDNHVTGH*
back to top

protein sequence of SMED30012282-orf-2

>SMED30012282-orf-2 ID=SMED30012282-orf-2|Name=SMED30012282-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
SLFRVVVALTWCIMFYKALFFLFLISAPFIKAQSNEDPISASSVESDEED
VVTDDSAAEEAEDKLNEDKIVTEILDSPQDQTEQAFVDGVPAGSKNVKTE
LLFTEPPYNKRSNGVGIELPANKPVKILISSQMTKWIIIKITN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR005595TRAP_alpha
Vocabulary: cellular component
TermDefinition
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005595Translocon-associated protein (TRAP), alpha subunitPFAMPF03896TRAP_alphacoord: 19..134
e-value: 4.7E-10
score: 39.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 42..57
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 38..65
NoneNo IPR availableTMHMMTMhelixcoord: 5..27