dTTP/UTP pyrophosphatase

Overview
NamedTTP/UTP pyrophosphatase
Smed IDSMED30012280
Length (bp)885
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of dTTP/UTP pyrophosphatase (SMED30012280) t-SNE clustered cells

Violin plots show distribution of expression levels for dTTP/UTP pyrophosphatase (SMED30012280) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of dTTP/UTP pyrophosphatase (SMED30012280) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for dTTP/UTP pyrophosphatase (SMED30012280) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012280

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012280h1SMcG0005755 Contig2758GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30012280h1SMcG0005755 dd_Smed_v4_4785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Human
Match: ASMTL (acetylserotonin O-methyltransferase like [Source:HGNC Symbol;Acc:HGNC:751])

HSP 1 Score: 149.058 bits (375), Expect = 4.217e-40
Identity = 85/214 (39.72%), Postives = 126/214 (58.88%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYC----KQLAIEKANAIVKQVLSFKDNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCIL--VFKNKNIDS-YEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRI 652
            +L P+  +L  K ++LAS SPRR E+L+  G+ FEV PS + E  L+ + F     Y     KQ A+E AN + ++ L   D    +I ADTIV   G +  KP   +DA +ML+ LSG++H V + V I+    K+  +D+    F+EET V F++LS E++  YV +GEP+ KAG Y IQ LG   V  + GD+ NV+G P++  CK L ++
Sbjct:    2 VLCPVIGKLLHKRVVLASASPRRQEILSNAGLRFEVVPSKFKEK-LDKASFATPYGYAMETAKQKALEVANRLYQKDLRAPD---VVIGADTIVTVGGLILEKPVDKQDAYRMLSRLSGREHSVFTGVAIVHCSSKDHQLDTRVSEFYEETKVKFSELSEELLWEYVHSGEPMDKAGGYGIQALGGMLVESVHGDFLNVVGFPLNHFCKQLVKL 211          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Human
Match: ASMTL (acetylserotonin O-methyltransferase like [Source:HGNC Symbol;Acc:HGNC:751])

HSP 1 Score: 131.339 bits (329), Expect = 7.783e-34
Identity = 78/214 (36.45%), Postives = 117/214 (54.67%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYC----KQLAIEKANAIVKQVLSFKDNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCIL--VFKNKNIDS-YEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRI 652
            +L P+  +L  K ++LAS SPRR E+L+  G+ FEV PS + E  L+ + F     Y     KQ A+E AN + + V                    G +  KP   +DA +ML+ LSG++H V + V I+    K+  +D+    F+EET V F++LS E++  YV +GEP+ KAG Y IQ LG   V  + GD+ NV+G P++  CK L ++
Sbjct:    2 VLCPVIGKLLHKRVVLASASPRRQEILSNAGLRFEVVPSKFKEK-LDKASFATPYGYAMETAKQKALEVANRLYQTV-------------------GGLILEKPVDKQDAYRMLSRLSGREHSVFTGVAIVHCSSKDHQLDTRVSEFYEETKVKFSELSEELLWEYVHSGEPMDKAGGYGIQALGGMLVESVHGDFLNVVGFPLNHFCKQLVKL 195          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Human
Match: ASMTL (acetylserotonin O-methyltransferase like [Source:HGNC Symbol;Acc:HGNC:751])

HSP 1 Score: 114.005 bits (284), Expect = 9.049e-28
Identity = 62/152 (40.79%), Postives = 92/152 (60.53%), Query Frame = 2
Query:  206 KQLAIEKANAIVKQVLSFKDNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCIL--VFKNKNIDSY-EVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRI 652
            KQ A+E AN + ++ L   D    +I ADTIV   G +  KP   +DA +ML+ LSG++H V + V I+    K+  +D+    F+EET V F++LS E++  YV +GEP+ KAG Y IQ LG   V  + GD+ NV+G P++  CK L ++
Sbjct:    5 KQKALEVANRLYQKDLRAPD---VVIGADTIVTVGGLILEKPVDKQDAYRMLSRLSGREHSVFTGVAIVHCSSKDHQLDTRVSEFYEETKVKFSELSEELLWEYVHSGEPMDKAGGYGIQALGGMLVESVHGDFLNVVGFPLNHFCKQLVKL 153          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Celegans
Match: dod-18 (Downstream Of DAF-16 (Regulated by DAF-16) [Source:UniProtKB/TrEMBL;Acc:Q18851])

HSP 1 Score: 110.153 bits (274), Expect = 4.651e-29
Identity = 65/192 (33.85%), Postives = 107/192 (55.73%), Query Frame = 2
Query:   71 IILASTSPRRSEMLNKLGIEFEVFP-SNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKDNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYL 643
            I+LAS SP R ++L ++G+E  +   SN++E +  +   K    +  + A  K   IV+++   ++    II+ DT++E+ G++ GKP    DA + L  L    H V + + +   +    D YE   E+T V F D+   ++  YV++GEP+ KAG+Y I   G+ FV  IEG   NV+GLP+H+L + L
Sbjct:    6 IVLASQSPNRLKLLQQIGLENVIVKVSNFEENLPKTLPVKQ---FVIETAKGKLTTIVEEMKRKEEPYSVIIACDTVIEFNGEIIGKPTDANDAKETLKRLRNNTHNVYTGMALHYHET---DQYEEIIEKTIVHFGDIPDRVIDEYVKSGEPLKKAGSYGIGDFGAVFVRGIEGCMPNVVGLPLHRLHQAL 191          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Fly
Match: CG9515 (gene:FBgn0032077 transcript:FBtr0340262)

HSP 1 Score: 165.236 bits (417), Expect = 5.109e-50
Identity = 85/208 (40.87%), Postives = 130/208 (62.50%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKDNVDFI-ISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRI 652
            ML PIKH L    I+LAS SPRR E++  LG+  E+ PS ++E  LN  DFK+  DY +  A+ KA  +  ++ S  D+ + I I+ADT+V    +++GKP    DA +MLT LSG  ++V + V +     K+ +    F +  +V+F DL PE ++ YV++G+P+ KAGAY +QG     + RI+GD++ VMGLP+H+LC  L ++
Sbjct:    1 MLAPIKHLLGNYRIVLASGSPRRQELVKMLGLNAELCPSTFEEN-LNLEDFKEFSDYIEATALGKAEEVYSRLRSTGDSKNLIVIAADTMVTLGKEIYGKPKDPADAIRMLTNLSGTSNRVFTGVVL-----KHANGIRKFTDTADVYFGDLLPEQIQSYVDSGDPLDKAGAYGVQGPAGALIHRIDGDFYCVMGLPLHRLCCELNKL 202          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Fly
Match: CG9515 (gene:FBgn0032077 transcript:FBtr0079791)

HSP 1 Score: 165.236 bits (417), Expect = 5.109e-50
Identity = 85/208 (40.87%), Postives = 130/208 (62.50%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKDNVDFI-ISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRI 652
            ML PIKH L    I+LAS SPRR E++  LG+  E+ PS ++E  LN  DFK+  DY +  A+ KA  +  ++ S  D+ + I I+ADT+V    +++GKP    DA +MLT LSG  ++V + V +     K+ +    F +  +V+F DL PE ++ YV++G+P+ KAGAY +QG     + RI+GD++ VMGLP+H+LC  L ++
Sbjct:    1 MLAPIKHLLGNYRIVLASGSPRRQELVKMLGLNAELCPSTFEEN-LNLEDFKEFSDYIEATALGKAEEVYSRLRSTGDSKNLIVIAADTMVTLGKEIYGKPKDPADAIRMLTNLSGTSNRVFTGVVL-----KHANGIRKFTDTADVYFGDLLPEQIQSYVDSGDPLDKAGAYGVQGPAGALIHRIDGDFYCVMGLPLHRLCCELNKL 202          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Zebrafish
Match: asmtl (acetylserotonin O-methyltransferase-like [Source:ZFIN;Acc:ZDB-GENE-030131-2854])

HSP 1 Score: 160.999 bits (406), Expect = 1.225e-44
Identity = 91/212 (42.92%), Postives = 130/212 (61.32%), Query Frame = 2
Query:   35 LEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKD--NVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKN--IDSYEV--FHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRI 652
            L P+  +L  K ++LAS SPRR E+L+  G+ FEV PS + ET L+ S FK   +Y  + A +KA   V Q + FK     D +I ADT+V  +G +  KP   +DA +ML+ LSGK+H V + V I++ ++KN  +  Y+V  F+EET V F +LS EM+  Y+ +GEP+ KAG Y IQ LG   V  + GD+ NV+G P++  CK L  I
Sbjct:    3 LNPVISKLSGKLVVLASASPRRLEILSNAGLRFEVVPSWFKET-LDKSLFKHPCEYAVETAKQKALE-VAQRMPFKHLKTPDIVIGADTVVTVDGLILEKPTDKQDAYRMLSRLSGKEHSVFTGVAIVICRDKNSSVTDYKVVDFYEETKVKFAELSEEMLWEYINSGEPMDKAGGYGIQALGGMLVEYVRGDFLNVVGFPLNHFCKQLGSI 212          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Zebrafish
Match: asmtl (acetylserotonin O-methyltransferase-like [Source:ZFIN;Acc:ZDB-GENE-030131-2854])

HSP 1 Score: 160.999 bits (406), Expect = 1.262e-44
Identity = 91/212 (42.92%), Postives = 130/212 (61.32%), Query Frame = 2
Query:   35 LEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKD--NVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKN--IDSYEV--FHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRI 652
            L P+  +L  K ++LAS SPRR E+L+  G+ FEV PS + ET L+ S FK   +Y  + A +KA   V Q + FK     D +I ADT+V  +G +  KP   +DA +ML+ LSGK+H V + V I++ ++KN  +  Y+V  F+EET V F +LS EM+  Y+ +GEP+ KAG Y IQ LG   V  + GD+ NV+G P++  CK L  I
Sbjct:    3 LNPVISKLSGKLVVLASASPRRLEILSNAGLRFEVVPSWFKET-LDKSLFKHPCEYAVETAKQKALE-VAQRMPFKHLKTPDIVIGADTVVTVDGLILEKPTDKQDAYRMLSRLSGKEHSVFTGVAIVICRDKNSSVTDYKVVDFYEETKVKFAELSEEMLWEYINSGEPMDKAGGYGIQALGGMLVEYVRGDFLNVVGFPLNHFCKQLGSI 212          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Xenopus
Match: asmtl (vomeronasal receptor A-1 [Source:Xenbase;Acc:XB-GENE-5823944])

HSP 1 Score: 156.377 bits (394), Expect = 9.364e-43
Identity = 85/214 (39.72%), Postives = 126/214 (58.88%), Query Frame = 2
Query:   26 SQMLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQV-LSFKDNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEV----FHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRI 652
            + +L P+  +L  K ++LAS SPRR ++L  +G+ FEV PS + ET L+ S F    +Y  + A +KA  + +++ +      D +I ADTIV  E  +  KP   +DA  ML+ LSGK+H V + V I+  K++  +  E     F+EET V F DLS +++  YV +GEP+ KAG Y IQ LG   V R+ GD+ NV+G P++  CK L  I
Sbjct:    8 TMLLNPVISKLAGKRVVLASASPRRQDILTNVGLRFEVVPSWFKET-LDKSVFSAPYEYAVETAKQKALEVARRMHMKHLKTPDIVIGADTIVTLEDAILEKPVDKQDAYNMLSRLSGKEHSVFTGVAIVHCKSQEDNQLETDVFDFYEETKVKFADLSEDLLWEYVHSGEPMDKAGGYGIQSLGGMLVERVHGDFLNVVGFPLNHFCKKLAEI 220          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Xenopus
Match: asmtl (vomeronasal receptor A-1 [Source:Xenbase;Acc:XB-GENE-5823944])

HSP 1 Score: 155.606 bits (392), Expect = 1.381e-42
Identity = 85/212 (40.09%), Postives = 125/212 (58.96%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQV-LSFKDNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEV----FHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRI 652
            +L P+  +L  K ++LAS SPRR ++L  +G+ FEV PS + ET L+ S F    +Y  + A +KA  + +++ +      D +I ADTIV  E  +  KP   +DA  ML+ LSGK+H V + V I+  K++  +  E     F+EET V F DLS +++  YV +GEP+ KAG Y IQ LG   V R+ GD+ NV+G P++  CK L  I
Sbjct:    2 LLNPVISKLAGKRVVLASASPRRQDILTNVGLRFEVVPSWFKET-LDKSVFSAPYEYAVETAKQKALEVARRMHMKHLKTPDIVIGADTIVTLEDAILEKPVDKQDAYNMLSRLSGKEHSVFTGVAIVHCKSQEDNQLETDVFDFYEETKVKFADLSEDLLWEYVHSGEPMDKAGGYGIQSLGGMLVERVHGDFLNVVGFPLNHFCKKLAEI 212          
BLAST of dTTP/UTP pyrophosphatase vs. UniProt/SwissProt
Match: sp|Q0SR36|NTPPA_CLOPS (dTTP/UTP pyrophosphatase OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=CPR_2112 PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 4.541e-46
Identity = 92/192 (47.92%), Postives = 122/192 (63.54%), Query Frame = 2
Query:   71 IILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFK-DNRDYCKQLAIEKANAIVKQVLSFKDNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYL 643
            +ILAS SPRR E+L K+  EFEV  SN+DE   N+ DFK D   Y K L+  KA  + K++    +    +I+ADT+V   GKV  KP S EDA  ML+ LSG  HKV S +C++   N   D+     + T V F++L+P  ++ Y+ +GEP+ KAGAY IQGLG  FV RIEG Y+NVMGLP++KL K L
Sbjct:    3 VILASKSPRRVEILEKIVKEFEVVQSNFDE---NTIDFKGDVEKYVKDLSRNKAIEVSKRL----NEPSIVIAADTVVFQNGKVLEKPKSEEDAFSMLSSLSGNTHKVYSGICLI---NTYDDTVVTDCDCTEVKFSELNPRQIRNYINSGEPMDKAGAYGIQGLGGAFVERIEGCYYNVMGLPLNKLYKAL 184          
BLAST of dTTP/UTP pyrophosphatase vs. UniProt/SwissProt
Match: sp|Q6HD71|NTPPA_BACHK (dTTP/UTP pyrophosphatase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=maf PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 5.586e-46
Identity = 83/194 (42.78%), Postives = 122/194 (62.89%), Query Frame = 2
Query:   65 KNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKDNVDFII-SADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYL 643
            + IILAS SPRR E+L   G+ FE+  S  +ETI     +    D    LA++KA+A+ +      +N D+I+  ADTIV YE ++ GKP++  +A +ML LLSGK H+V + V I+  K+K +     F+E T V F +L+ E +  YV + EP+ KAG+Y IQG GS FV  I+GDY++V+GLP+ +L + L
Sbjct:    2 RKIILASGSPRRKELLELAGVPFEIIVSEVEETI---GAYSSPSDIVMSLALQKASAVAE------NNSDYIVLGADTIVTYESRILGKPSNEAEAKEMLQLLSGKTHEVYTGVAIIA-KDKTV----TFYERTEVTFWELTEEEIDAYVASKEPLDKAGSYGIQGKGSIFVQHIQGDYYSVVGLPISRLVREL 181          
BLAST of dTTP/UTP pyrophosphatase vs. UniProt/SwissProt
Match: sp|C1ETQ1|NTPPA_BACC3 (dTTP/UTP pyrophosphatase OS=Bacillus cereus (strain 03BB102) OX=572264 GN=maf PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.147e-45
Identity = 83/194 (42.78%), Postives = 121/194 (62.37%), Query Frame = 2
Query:   65 KNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKDNVDFII-SADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYL 643
            + IILAS SPRR E+L   G+ FE+  S  +ETI     +    D    LA++KA+A+ +      +N D I+  ADTIV YE ++ GKP++  +A +ML LLSGK H+V + V I+  K+K +     F+E T V F +L+ E +  YV + EP+ KAG+Y IQG GS FV  I+GDY++V+GLP+ +L + L
Sbjct:    2 RKIILASGSPRRKELLELAGVPFEIIVSEVEETI---GAYSSPSDIVMSLALQKASAVAE------NNSDHIVLGADTIVTYESRILGKPSNEAEAKEMLQLLSGKTHEVYTGVAIIA-KDKTV----TFYERTEVTFWELTEEEIDAYVASKEPLDKAGSYGIQGKGSIFVQHIQGDYYSVVGLPISRLVREL 181          
BLAST of dTTP/UTP pyrophosphatase vs. UniProt/SwissProt
Match: sp|B7JQ48|NTPPA_BACC0 (dTTP/UTP pyrophosphatase OS=Bacillus cereus (strain AH820) OX=405535 GN=maf PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.147e-45
Identity = 83/194 (42.78%), Postives = 121/194 (62.37%), Query Frame = 2
Query:   65 KNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKDNVDFII-SADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYL 643
            + IILAS SPRR E+L   G+ FE+  S  +ETI     +    D    LA++KA+A+ +      +N D I+  ADTIV YE ++ GKP++  +A +ML LLSGK H+V + V I+  K+K +     F+E T V F +L+ E +  YV + EP+ KAG+Y IQG GS FV  I+GDY++V+GLP+ +L + L
Sbjct:    2 RKIILASGSPRRKELLELAGVPFEIIVSEVEETI---GAYSSPSDIVMSLALQKASAVAE------NNSDHIVLGADTIVTYESRILGKPSNEAEAKEMLQLLSGKTHEVYTGVAIIA-KDKTV----TFYERTEVTFWELTEEEIDAYVASKEPLDKAGSYGIQGKGSIFVQHIQGDYYSVVGLPISRLVREL 181          
BLAST of dTTP/UTP pyrophosphatase vs. UniProt/SwissProt
Match: sp|Q81LD6|NTPPA_BACAN (dTTP/UTP pyrophosphatase OS=Bacillus anthracis OX=1392 GN=maf PE=3 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 2.750e-45
Identity = 83/194 (42.78%), Postives = 121/194 (62.37%), Query Frame = 2
Query:   65 KNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKDNVDFII-SADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYL 643
            + IILAS SPRR E+L   G+ FE+  S  +ETI     +    D    LA++KA+A+ +      +N D I+  ADTIV YE ++ GKP++  +A +ML LLSGK H+V + V I+  K+K +     F+E T V F +L+ E +  YV + EP+ KAG+Y IQG GS FV  I+GDY++V+GLP+ +L + L
Sbjct:    2 RKIILASGSPRRKELLELAGVPFEIIVSEVEETI---GAYSSPSDIVMSLALQKASAVAE------NNSDHIVLGADTIVTYESRILGKPSNKAEAKEMLQLLSGKTHEVYTGVAIIA-KDKTV----TFYERTEVTFWELTEEEIDAYVASKEPLDKAGSYGIQGKGSIFVQHIQGDYYSVVGLPISRLVREL 181          
BLAST of dTTP/UTP pyrophosphatase vs. TrEMBL
Match: A0A3R7D3L4 (Maf-like protein OS=Clonorchis sinensis OX=79923 GN=STH370 PE=3 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 2.532e-56
Identity = 99/211 (46.92%), Postives = 138/211 (65.40%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSF--KDNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRIVR 658
            ML   +  +   +++LASTSPRR E++N LGI F V  +  DE  +  SDF     Y + LA++KA A    V S    D  D I+SADT+V +EGK+FGKP+S+EDA   L+ LSGK H VI+ VC+ V K  + DS+  FHE T V    L   +++ YV +GEP+ KAGAY IQGLG + V +I+GDYFNV+GLP++KLCK+++ ++ 
Sbjct:    1 MLLSTRQLIPSIHLLLASTSPRRKELMNNLGIPFTVLAAPIDEQ-MPVSDFDSIPQYVEALAMKKAIAAANLVASNNETDKYDIIVSADTVVVFEGKIFGKPSSSEDAINTLSKLSGKTHSVITGVCLRVRKPSSGDSFITFHEVTTVKMARLERCVIEAYVNSGEPLDKAGAYGIQGLGCSLVEKIDGDYFNVVGLPIYKLCKHIHDLLH 210          
BLAST of dTTP/UTP pyrophosphatase vs. TrEMBL
Match: A0A4S2MKZ9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000638 PE=3 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 6.933e-56
Identity = 97/207 (46.86%), Postives = 137/207 (66.18%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFK--DNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLY 646
            ML   +  +   +++LASTSPRR E++N +G+ F V  +  DE  +  SDF     Y + LA++KA A    V S    D  D I+SADT+V +EGK+FGKP+S+EDA  +L+ LSG+ H VI+ VC+ V K  + DS+  FHE T V    L   +++ YV +GEP+ KAGAY IQGLG + V RI+GDYFNV+GLP++KLCK+++
Sbjct:    1 MLLSTRQRVPSIHLLLASTSPRRKELMNNIGVPFTVLAAPIDEH-MPVSDFDSIPQYVEALAMKKAIAAANLVASNNETDKYDIIVSADTVVVFEGKIFGKPSSSEDAINILSKLSGETHSVITGVCLRVRKPSSGDSFITFHEVTTVKMARLERCVIEAYVNSGEPLDKAGAYGIQGLGCSLVERIDGDYFNVVGLPIYKLCKHIH 206          
BLAST of dTTP/UTP pyrophosphatase vs. TrEMBL
Match: A0A1S8X6D1 (Septum formation protein Maf (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01815 PE=3 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 2.070e-55
Identity = 97/213 (45.54%), Postives = 137/213 (64.32%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFK--DNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRIVRQM 664
            ML   +  +    ++LASTSPRR E++N +GI F V  +  DE  +  SDF     Y + LA++KA A    V S    D  D I+SADT+V +EGK+FGKP+S EDA   L+ LSGK H VI+ VC+ V K  + DS+  FHE T V    L   +++ YV +GEP+ KAGAY IQGLG + V +I+GDYFN++GLP++KLCK+++ ++  +
Sbjct:    1 MLLSTRQLIPSLRLLLASTSPRRKELMNNIGIPFAVLAAPIDEQ-MPVSDFDSIPQYVEALAMKKAIAAANLVASNNEADKYDIIVSADTVVVFEGKIFGKPSSPEDAINTLSKLSGKTHNVITGVCLRVRKPSSGDSFITFHEVTTVKMAHLERCVIEAYVNSGEPLDKAGAYGIQGLGCSLVEKIDGDYFNIVGLPIYKLCKHIHDLLHDV 212          
BLAST of dTTP/UTP pyrophosphatase vs. TrEMBL
Match: A0A1B6IDR8 (Uncharacterized protein OS=Homalodisca liturata OX=320908 GN=g.22034 PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.860e-53
Identity = 91/210 (43.33%), Postives = 133/210 (63.33%), Query Frame = 2
Query:   32 MLEPIKHE-LRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKDNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRIVR 658
            MLEPI+   L  K IILASTSPRR+E+L  +G+ FEV PS Y+E  L+  D++++ D+    A+ K   + K++ + +   D II ADT+V Y+G+VFGKP   E+A K L +LSGK+H V + V I     K   +   F+E T V    +    ++ Y+ T EP+ KAGAY IQG G + + +I+GDYF VMGLP+H LCK++  +++
Sbjct:    1 MLEPIRASILSGKRIILASTSPRRAEILQNIGLRFEVVPSTYEED-LDPKDYQNHGDFAIATALNKVLEVDKRLSNDRVKPDIIIGADTVVSYDGRVFGKPRDKEEAFKHLQVLSGKQHTVFTGVVI-----KTPTNISKFYEHTKVLMAKMDQRTIQAYIATNEPMDKAGAYGIQGFGGSIIEKIDGDYFTVMGLPLHSLCKHMLELLQ 204          
BLAST of dTTP/UTP pyrophosphatase vs. TrEMBL
Match: A0A131X8S3 (Putative nucleic acid-binding protein asmtl OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.189e-52
Identity = 95/213 (44.60%), Postives = 135/213 (63.38%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKDNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRIVRQMDS 670
            MLEP+   L +K IILAS SPRR E+LN LG  ++V  SN++E+ L+ + F    +YC + A  KA  + + +    + VDF+I ADTIV    K++ KP    DA++ML  LSG+ H V + V  L+++ K+      FHE T VF   +S E++K YV TGEP+ KAGAYAIQG G + V +I GD++NVMG P+H+ CK L  +  ++DS
Sbjct:    1 MLEPLLCALDKKRIILASASPRRKEILNMLGFRYDVVASNFEES-LDRNAFTTPTEYCVRTAEGKARDVARILQEKNEVVDFVIGADTIVVKGNKLYEKPKDKSDAERMLNELSGEGHIVQTGVA-LIYRCKDDLRCMSFHETTEVFMAPMSQEIIKAYVHTGEPLDKAGAYAIQGKGGSLVEKIVGDFYNVMGFPLHRFCKELGDLCARLDS 211          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Cavefish
Match: asmtl (acetylserotonin O-methyltransferase like [Source:NCBI gene;Acc:103043619])

HSP 1 Score: 154.066 bits (388), Expect = 3.835e-42
Identity = 88/213 (41.31%), Postives = 126/213 (59.15%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKD--NVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEV----FHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRI 652
            +L P+  +L  K ++LAS SPRR E+L  +G+ FEV PS + ET L+ + FK   +Y  + A +KA   V Q + FK     D +I ADT+V  +G +  KP   +DA +ML+ LSGK+H V + V I++   K     E     F+EET V F DLS +M+  Y+ +GEP+ KAG Y IQ LG   V  ++GD+ NV+G P++  CK L  I
Sbjct:    2 VLNPVISKLSGKLVVLASASPRRLEILTNIGLRFEVVPSWFKET-LDKTLFKTPYEYAVETAKQKALE-VAQRMPFKHLKAPDIVIGADTVVTVDGLILEKPADKQDAYRMLSRLSGKEHSVFTGVAIVLCNEKEGGEIEYNVVDFYEETKVKFADLSEDMLWEYINSGEPMDKAGGYGIQALGGMLVEYVKGDFLNVVGFPLNHFCKQLGMI 212          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010424.1 (pep scaffold:Pmarinus_7.0:GL479172:2130:14103:1 gene:ENSPMAG00000009436.1 transcript:ENSPMAT00000010424.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 1.484e-26
Identity = 50/115 (43.48%), Postives = 72/115 (62.61%), Query Frame = 2
Query:  308 EGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCIL---VFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYL 643
            +G +  KP    DA +ML+ LSG++H V + V ++   V + K   S   FHEET V F +LS E++  Y+++GEP+ KAG Y IQ LG  FV  I GD+ NV+GLP+H + + L
Sbjct:    2 DGDILEKPADKPDAYRMLSRLSGREHSVFTGVALVECCVCEGKLQTSVVQFHEETRVKFAELSEELLWDYIDSGEPMDKAGGYGIQALGGMFVESIHGDFLNVVGLPLHHIFRKL 116          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Yeast
Match: YOR111W_mRNA (Putative protein of unknown function [Source:SGD;Acc:S000005637])

HSP 1 Score: 94.7449 bits (234), Expect = 1.065e-23
Identity = 67/209 (32.06%), Postives = 116/209 (55.50%), Query Frame = 2
Query:   62 RKNIILASTSPRRSEMLNK-LGI-EFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKDN----VD---FIISADTIV-EYEGKVFGKPNSNEDADKMLTLLSGKKHK---VISAVCILVFKNKNIDSYEVFHEETNVFFTDLSP-EMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLY 646
            + +IILASTSPRR E+L+  +GI + +   S ++E +   +   D   Y    +  KA  I++ +  ++D     +D    II ADTI+ +  G+++ KP + E   K L     +  +   V++AV ++ +  +       F +ET V+F +  P  +++ YVE+G+ +   G + IQG G+  + +IEGDY+NV+GLP++K  K LY
Sbjct:   18 KYDIILASTSPRRYEILHDIMGITDLKTMVSTFEENLDKMNYSTDPIGYVCDTSWHKAQNIIEILTDYEDENPNEIDKPKLIICADTIIIDKSGRIYEKPKTKEVQKKFLMKFCYEDDEPVNVVTAVTLIKWYGRENFELVPFRDETKVYFDNKIPLRILEEYVESGDGLEVGGGFKIQGQGAILIEKIEGDYYNVVGLPLNKTFKGLY 226          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Nematostella
Match: EDO33325 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSI3])

HSP 1 Score: 168.318 bits (425), Expect = 1.429e-51
Identity = 89/207 (43.00%), Postives = 132/207 (63.77%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKDN--VDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNID----SYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLC 634
            MLEPI   L  K +ILAS+SPRRSE+L ++G++F+  PS ++E  L+ S F+  +DY  + A +KA  + +++   K N   D +I +DTIV  E ++  KP S E+A KML  LSG++H+V S V ++   +  +     S   F+E T V F +L+ +++  Y++T EP+ KAGAY IQG+G + VS I GDYFNVMG P+H  C
Sbjct:    1 MLEPILESLNTKTVILASSSPRRSEILRRIGLKFQTIPSVFEEN-LDKSSFEHPKDYVLENAKQKALEVAQRMRDDKQNNIPDLVIGSDTIVVLENEILEKPKSKENAFKMLKSLSGREHEVYSGVTLVSHSHSAVGLDKPSLTQFYERTFVPFGELTDDVINGYIKTEEPMDKAGAYGIQGIGGSLVSGIRGDYFNVMGFPLHHFC 206          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Nematostella
Match: EDO28856 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5A8])

HSP 1 Score: 118.627 bits (296), Expect = 5.714e-33
Identity = 67/170 (39.41%), Postives = 107/170 (62.94%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKDN--VDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNID--SYEVFHEETNVFFTDLSPEMVKCYVETGEPI 529
            MLEPI   L  K +ILAS+SPRRSE+L ++G++F+  PS ++E  L+ S F+  +DY  + A +KA  + +++   K N   D +I +DTIV  E ++  KP S E+A KML  LSG++H+V S V ++   +  +D  S   F+E T V F +L+ +++  Y++T EP+
Sbjct:    1 MLEPILESLNTKTVILASSSPRRSEILRRIGLKFQTIPSVFEEN-LDKSSFEHPKDYVLENAKQKALEVAQRMRDDKQNNIPDLVIGSDTIVVLENEILEKPKSKENAFKMLKSLSGREHEVYSGVTLVSHSHSGLDKPSLTQFYERTFVTFGELTDDVINGYIKTEEPM 169          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Medaka
Match: asmtl (acetylserotonin O-methyltransferase like [Source:NCBI gene;Acc:101167082])

HSP 1 Score: 150.984 bits (380), Expect = 5.199e-41
Identity = 87/212 (41.04%), Postives = 124/212 (58.49%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKD--NVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEV------FHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYL 643
            +L P+  +L  K ++LAS SPRR E+L   G+ FEV PS + ET L+   FK   +Y  + A +KA  + ++ + FK     D +I ADTIV     +  KP   +DA +ML+ LSGK+H V + V I++   K  D+ EV      F+EET V F DLS +M+  Y+ +GEP+ KAG Y IQ LG   V  + GD+ NV+G P++  CK L
Sbjct:    2 VLNPVISKLAGKLVVLASASPRRQEILRNAGLRFEVVPSWFKET-LDKGLFKAPHEYAVETAKQKALEVARR-MPFKHLKTPDIVIGADTIVTVNSMILEKPVDKQDAYRMLSSLSGKEHSVFTGVAIVLCHEK--DNQEVDYQMIAFYEETKVKFADLSEDMLWEYINSGEPMDKAGGYGIQALGGMLVEYVHGDFLNVVGFPLNHFCKQL 209          
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Medaka
Match: asmtl (acetylserotonin O-methyltransferase like [Source:NCBI gene;Acc:101167082])

HSP 1 Score: 138.658 bits (348), Expect = 1.156e-36
Identity = 82/200 (41.00%), Postives = 116/200 (58.00%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKD--NVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEV------FHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNV 607
            +L P+  +L  K ++LAS SPRR E+L   G+ FEV PS + ET L+   FK   +Y  + A +KA  + ++ + FK     D +I ADTIV     +  KP   +DA +ML+ LSGK+H V + V I++   K  D+ EV      F+EET V F DLS +M+  Y+ +GEP+ KAG Y IQ LG   V  + GD+ NV
Sbjct:    2 VLNPVISKLAGKLVVLASASPRRQEILRNAGLRFEVVPSWFKET-LDKGLFKAPHEYAVETAKQKALEVARR-MPFKHLKTPDIVIGADTIVTVNSMILEKPVDKQDAYRMLSSLSGKEHSVFTGVAIVLCHEK--DNQEVDYQMIAFYEETKVKFADLSEDMLWEYINSGEPMDKAGGYGIQALGGMLVEYVHGDFLNV 197          
BLAST of dTTP/UTP pyrophosphatase vs. Planmine SMEST
Match: SMESG000072046.1 (SMESG000072046.1)

HSP 1 Score: 438.728 bits (1127), Expect = 9.082e-158
Identity = 213/214 (99.53%), Postives = 213/214 (99.53%), Query Frame = 2
Query:   32 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSDFKDNRDYCKQLAIEKANAIVKQVLSFKDNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRIVRQMDSN 673
            MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNS DFKDNRDYCKQLAIEKANAIVKQVLSFKDNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRIVRQMDSN
Sbjct:    1 MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSCDFKDNRDYCKQLAIEKANAIVKQVLSFKDNVDFIISADTIVEYEGKVFGKPNSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTDLSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKLCKYLYRIVRQMDSN 214          
The following BLAST results are available for this feature:
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ASMTL4.217e-4039.72acetylserotonin O-methyltransferase like [Source:H... [more]
ASMTL7.783e-3436.45acetylserotonin O-methyltransferase like [Source:H... [more]
ASMTL9.049e-2840.79acetylserotonin O-methyltransferase like [Source:H... [more]
back to top
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dod-184.651e-2933.85Downstream Of DAF-16 (Regulated by DAF-16) [Sourc... [more]
back to top
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG95155.109e-5040.87gene:FBgn0032077 transcript:FBtr0340262[more]
CG95155.109e-5040.87gene:FBgn0032077 transcript:FBtr0079791[more]
back to top
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
asmtl1.225e-4442.92acetylserotonin O-methyltransferase-like [Source:Z... [more]
asmtl1.262e-4442.92acetylserotonin O-methyltransferase-like [Source:Z... [more]
back to top
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
asmtl9.364e-4339.72vomeronasal receptor A-1 [Source:Xenbase;Acc:XB-GE... [more]
asmtl1.381e-4240.09vomeronasal receptor A-1 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of dTTP/UTP pyrophosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0SR36|NTPPA_CLOPS4.541e-4647.92dTTP/UTP pyrophosphatase OS=Clostridium perfringen... [more]
sp|Q6HD71|NTPPA_BACHK5.586e-4642.78dTTP/UTP pyrophosphatase OS=Bacillus thuringiensis... [more]
sp|C1ETQ1|NTPPA_BACC32.147e-4542.78dTTP/UTP pyrophosphatase OS=Bacillus cereus (strai... [more]
sp|B7JQ48|NTPPA_BACC02.147e-4542.78dTTP/UTP pyrophosphatase OS=Bacillus cereus (strai... [more]
sp|Q81LD6|NTPPA_BACAN2.750e-4542.78dTTP/UTP pyrophosphatase OS=Bacillus anthracis OX=... [more]
back to top
BLAST of dTTP/UTP pyrophosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7D3L42.532e-5646.92Maf-like protein OS=Clonorchis sinensis OX=79923 G... [more]
A0A4S2MKZ96.933e-5646.86Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S8X6D12.070e-5545.54Septum formation protein Maf (Fragment) OS=Opistho... [more]
A0A1B6IDR82.860e-5343.33Uncharacterized protein OS=Homalodisca liturata OX... [more]
A0A131X8S31.189e-5244.60Putative nucleic acid-binding protein asmtl OS=Hya... [more]
back to top
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asmtl3.835e-4241.31acetylserotonin O-methyltransferase like [Source:N... [more]
back to top
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010424.11.484e-2643.48pep scaffold:Pmarinus_7.0:GL479172:2130:14103:1 ge... [more]
back to top
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YOR111W_mRNA1.065e-2332.06Putative protein of unknown function [Source:SGD;A... [more]
back to top
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO333251.429e-5143.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288565.714e-3339.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of dTTP/UTP pyrophosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
asmtl5.199e-4141.04acetylserotonin O-methyltransferase like [Source:N... [more]
asmtl1.156e-3641.00acetylserotonin O-methyltransferase like [Source:N... [more]
back to top
BLAST of dTTP/UTP pyrophosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000072046.19.082e-15899.53SMESG000072046.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012280 ID=SMED30012280|Name=dTTP/UTP pyrophosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=885bp
GCTTTGTTTAAATTAGTGAAATTCATCTCAAATGTTGGAACCAATAAAAC
ATGAATTGAGAAGAAAGAATATTATTTTGGCTAGCACATCTCCTAGAAGA
AGTGAAATGCTCAACAAACTAGGGATTGAGTTTGAAGTGTTTCCATCTAA
TTACGATGAAACAATTTTAAATTCATCTGATTTTAAAGATAACAGAGATT
ATTGTAAGCAATTAGCAATTGAAAAAGCCAATGCTATTGTTAAGCAAGTT
TTATCCTTTAAAGATAATGTGGATTTCATCATCAGTGCTGACACAATTGT
TGAATACGAAGGAAAAGTGTTTGGGAAGCCAAATAGCAATGAGGACGCGG
ATAAAATGTTGACGCTGTTGAGTGGAAAAAAGCATAAAGTTATTTCAGCC
GTTTGTATCTTGGTTTTCAAAAACAAAAATATTGATAGCTATGAAGTTTT
CCATGAAGAAACGAATGTTTTTTTTACCGATTTGAGTCCGGAAATGGTGA
AATGTTATGTGGAAACCGGTGAACCGATTGGCAAAGCTGGCGCTTATGCT
ATTCAGGGGCTCGGATCTACCTTTGTCAGTCGCATAGAAGGAGACTATTT
CAATGTGATGGGGCTACCGGTGCACAAGTTGTGCAAATATCTTTATCGAA
TCGTTAGACAAATGGATTCCAACTAGATTTATCAAACGAATATTTAAAGA
TTTATTCTGTGTGTACAATATCGATTTTATGATTTTCTTGTCGACTTCAT
TTGTTTGAATTATTGACTTTTATCGTATGGATATTTGAAAATACTATTGA
TATGCTGCCATCCCGTAAAAAGTTTTATGTTTTACTCGTCAACTGAATGT
TCCACGACCTGATGTTGTCATGGAGTTTGATAGCT
back to top

protein sequence of SMED30012280-orf-1

>SMED30012280-orf-1 ID=SMED30012280-orf-1|Name=SMED30012280-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=215bp
MLEPIKHELRRKNIILASTSPRRSEMLNKLGIEFEVFPSNYDETILNSSD
FKDNRDYCKQLAIEKANAIVKQVLSFKDNVDFIISADTIVEYEGKVFGKP
NSNEDADKMLTLLSGKKHKVISAVCILVFKNKNIDSYEVFHEETNVFFTD
LSPEMVKCYVETGEPIGKAGAYAIQGLGSTFVSRIEGDYFNVMGLPVHKL
CKYLYRIVRQMDSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004551nucleotide diphosphatase activity
GO:0016462pyrophosphatase activity
GO:0016787hydrolase activity
GO:0035529NADH pyrophosphatase activity
GO:0047429nucleoside-triphosphate diphosphatase activity
Vocabulary: biological process
TermDefinition
GO:0009117nucleotide metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR029001ITPase-like_fam
IPR003697Maf-like
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029001Inosine triphosphate pyrophosphatase-likeGENE3DG3DSA:3.90.950.10coord: 9..209
e-value: 3.4E-69
score: 234.2
IPR029001Inosine triphosphate pyrophosphatase-likeSUPERFAMILYSSF52972ITPase-likecoord: 11..206
IPR003697Nucleoside triphosphate pyrophosphatase Maf-like proteinPFAMPF02545Mafcoord: 14..205
e-value: 9.5E-55
score: 185.0
IPR003697Nucleoside triphosphate pyrophosphatase Maf-like proteinPIRSFPIRSF006305Mafcoord: 5..213
e-value: 1.3E-62
score: 208.4
IPR003697Nucleoside triphosphate pyrophosphatase Maf-like proteinTIGRFAMTIGR00172TIGR00172coord: 12..205
e-value: 3.2E-50
score: 168.2
IPR003697Nucleoside triphosphate pyrophosphatase Maf-like proteinPANTHERPTHR43213FAMILY NOT NAMEDcoord: 6..211
IPR003697Nucleoside triphosphate pyrophosphatase Maf-like proteinCDDcd00555Mafcoord: 14..204
e-value: 9.14141E-79
score: 231.597
NoneNo IPR availablePANTHERPTHR43213:SF5N-ACETYLSEROTONIN O-METHYLTRANSFERASE-LIKE PROTEINcoord: 6..211