Splicing factor 45

Overview
NameSplicing factor 45
Smed IDSMED30012275
Length (bp)1435
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Splicing factor 45 (SMED30012275) t-SNE clustered cells

Violin plots show distribution of expression levels for Splicing factor 45 (SMED30012275) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Splicing factor 45 (SMED30012275) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Splicing factor 45 (SMED30012275) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012275

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30012275SMESG000038359.1 dd_Smed_v4_4530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012275SMESG000038359.1 dd_Smed_v4_4530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012275SMESG000038359.1 dd_Smed_v4_4530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30012275SMESG000038359.1 dd_Smed_v4_4530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30012275SMESG000038359.1 dd_Smed_v4_4530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012275SMESG000038359.1 dd_Smed_v4_4530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Splicing factor 45 vs. Ensembl Human
Match: RBM17 (RNA binding motif protein 17 [Source:HGNC Symbol;Acc:HGNC:16944])

HSP 1 Score: 154.451 bits (389), Expect = 1.405e-41
Identity = 127/308 (41.23%), Postives = 170/308 (55.19%), Query Frame = 3
Query:  366 DEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXADSKYLK----YDGVEETNDDDIASRVEKRTSDKSR-LVGTAIAPPPSLLE-------------DCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKII----HEKDXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCE 1223
            DEY+P+ PNDYE++ K  R++R+   + +  +  +   K  K      G     D D     +     + R + G AIAPP SL+E             D    S +       P  +E D        + +       + A KIM K GF+EG+GLGK  QG+STAL VE+TS+RGGKII     EKD  ++  +           I    + V+LLRNMVG GEVD+DL+ ET EEC KYGKV  C+IFE+   PDD+AVRIF+EF  VESA +AVVD NGRYFGGR+V A +Y+ +KF+ L+L E
Sbjct:   98 DEYDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRPRSQSSKAAIPPPVYEEQDRPRSPTGPSNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVGDATEKDASKKSDSNPLTE------ILKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAE 399          
BLAST of Splicing factor 45 vs. Ensembl Human
Match: RBM17 (RNA binding motif protein 17 [Source:HGNC Symbol;Acc:HGNC:16944])

HSP 1 Score: 154.451 bits (389), Expect = 1.405e-41
Identity = 127/308 (41.23%), Postives = 170/308 (55.19%), Query Frame = 3
Query:  366 DEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXADSKYLK----YDGVEETNDDDIASRVEKRTSDKSR-LVGTAIAPPPSLLE-------------DCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKII----HEKDXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCE 1223
            DEY+P+ PNDYE++ K  R++R+   + +  +  +   K  K      G     D D     +     + R + G AIAPP SL+E             D    S +       P  +E D        + +       + A KIM K GF+EG+GLGK  QG+STAL VE+TS+RGGKII     EKD  ++  +           I    + V+LLRNMVG GEVD+DL+ ET EEC KYGKV  C+IFE+   PDD+AVRIF+EF  VESA +AVVD NGRYFGGR+V A +Y+ +KF+ L+L E
Sbjct:   98 DEYDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRPRSQSSKAAIPPPVYEEQDRPRSPTGPSNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVGDATEKDASKKSDSNPLTE------ILKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAE 399          
BLAST of Splicing factor 45 vs. Ensembl Human
Match: PUF60 (poly(U) binding splicing factor 60 [Source:HGNC Symbol;Acc:HGNC:17042])

HSP 1 Score: 88.1965 bits (217), Expect = 5.505e-18
Identity = 44/107 (41.12%), Postives = 66/107 (61.68%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELC 1220
            +Q L+  + S V++LRNMV P ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF      ++A+   NGR+F GR V A  YD E+F N +L 
Sbjct:  427 MQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLS 533          
BLAST of Splicing factor 45 vs. Ensembl Human
Match: PUF60 (poly(U) binding splicing factor 60 [Source:HGNC Symbol;Acc:HGNC:17042])

HSP 1 Score: 87.8113 bits (216), Expect = 5.802e-18
Identity = 44/107 (41.12%), Postives = 66/107 (61.68%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELC 1220
            +Q L+  + S V++LRNMV P ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF      ++A+   NGR+F GR V A  YD E+F N +L 
Sbjct:  398 MQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLS 504          
BLAST of Splicing factor 45 vs. Ensembl Human
Match: PUF60 (poly(U) binding splicing factor 60 [Source:HGNC Symbol;Acc:HGNC:17042])

HSP 1 Score: 88.1965 bits (217), Expect = 5.834e-18
Identity = 44/107 (41.12%), Postives = 66/107 (61.68%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELC 1220
            +Q L+  + S V++LRNMV P ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF      ++A+   NGR+F GR V A  YD E+F N +L 
Sbjct:  435 MQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLS 541          
BLAST of Splicing factor 45 vs. Ensembl Celegans
Match: rbm-17 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:Q20966])

HSP 1 Score: 90.8929 bits (224), Expect = 1.176e-19
Identity = 106/363 (29.20%), Postives = 155/363 (42.70%), Query Frame = 3
Query:  198 TSKLPPVVDLKK-----TIGEGEYRFNHLTGKMEKFNPVSNESQEFVDIAFDDPILRLG---VKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXADSKYLKYDGVEETNDDDIASRV--EKRTSDKSRLVGTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQA---KYGTTSA-----AAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVD-----DDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            +S  PPV+DL       T       F  +     + NPVS+        A D+ ++  G   VK EY P+ PN+YE ++                       K +      E    ++A R+  E    DK R  G AIAPP  L+E          E  V+   +EN       +     +    +G  ++     AA IM + G+KEG GLGK  QGMSTAL +E+T  RGG I+ E             A++         + ++ L N+    EV       +   E  EE  K G+VV  ++   +   +D+ VR+FVEF +   A +A V  NGR+FGGR VSAG+ +   + N E 
Sbjct:   53 SSAPPPVIDLSTRNRTITTAVTSKSFQPI-----RANPVSDNISFLPKAATDESVMLFGEEHVKCEYYPMTPNNYEVVA-----------------------KEINDRKQREKTAREVAKRLQREHEEEDKKRSKGAAIAPPTMLMEP---------EPEVIKNTNENQDEKPHSSFMPPPSFLPAFGKATSRGLGIAANIMKRHGYKEGAGLGKSEQGMSTALSIEKTGVRGGNIVAEAPKAPTFATNSMEAVQ-------NATKILQLWNLTDLSEVSGEEGKKEFADEIKEEMEKCGQVVNVIVHVDESQEEDRQVRVFVEFTNNAQAIKAFVMMNGRFFGGRSVSAGFQNVSDYNNREF 371          
BLAST of Splicing factor 45 vs. Ensembl Celegans
Match: rnp-6 (RNP (RRM RNA binding domain) containing [Source:UniProtKB/TrEMBL;Acc:Q9N3S4])

HSP 1 Score: 70.8626 bits (172), Expect = 8.291e-13
Identity = 39/98 (39.80%), Postives = 54/98 (55.10%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKF 1202
            +  L+    SNVI+LRNMV P ++D+ L+ E  EEC KYG V+  +I    +      V+IFV++ D     RA    +GR+FGG  V A  YD   F
Sbjct:  648 MTKLMRTNRSNVIVLRNMVTPQDIDEFLEGEIREECGKYGNVIDVVI---ANFASSGLVKIFVKYSDSMQVDRAKAALDGRFFGGNTVKAEAYDQILF 742          
BLAST of Splicing factor 45 vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 51.9878 bits (123), Expect = 6.590e-8
Identity = 34/102 (33.33%), Postives = 47/102 (46.08%), Query Frame = 3
Query:  930 RVSNVILLRNMVGPGEVDDDLQSE-----TAEECSKYGKVVTCMIFE-LQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            R + ++ L NMV   E+  D + E       +ECSKYG V +  I    +D P     ++FVEF       RA     GR F  R V   YYD +K+ N + 
Sbjct:   42 RATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPYEDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 143          
BLAST of Splicing factor 45 vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 51.9878 bits (123), Expect = 6.590e-8
Identity = 34/102 (33.33%), Postives = 47/102 (46.08%), Query Frame = 3
Query:  930 RVSNVILLRNMVGPGEVDDDLQSE-----TAEECSKYGKVVTCMIFE-LQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            R + ++ L NMV   E+  D + E       +ECSKYG V +  I    +D P     ++FVEF       RA     GR F  R V   YYD +K+ N + 
Sbjct:   42 RATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPYEDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 143          
BLAST of Splicing factor 45 vs. Ensembl Celegans
Match: uaf-1 (Splicing factor U2AF 65 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:P90978])

HSP 1 Score: 51.9878 bits (123), Expect = 6.590e-8
Identity = 34/102 (33.33%), Postives = 47/102 (46.08%), Query Frame = 3
Query:  930 RVSNVILLRNMVGPGEVDDDLQSE-----TAEECSKYGKVVTCMIFE-LQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            R + ++ L NMV   E+  D + E       +ECSKYG V +  I    +D P     ++FVEF       RA     GR F  R V   YYD +K+ N + 
Sbjct:   42 RATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPYEDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF 143          
BLAST of Splicing factor 45 vs. Ensembl Fly
Match: Spf45 (gene:FBgn0086683 transcript:FBtr0111241)

HSP 1 Score: 134.806 bits (338), Expect = 5.165e-35
Identity = 128/338 (37.87%), Postives = 174/338 (51.48%), Query Frame = 3
Query:  360 VKDEYNPLMPNDYEQI---SXXXXXXXXXXXXXXXXXXXXADSKY-----------------LKYDGV-EETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQ-----------------------------SLISDRVSNVILLRNMVGPGEVDDDLQSETAEEC-SKYGKVVTCMIFE-LQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            V DEY+P  PN+YE++   S      R     +++ + ++ D K                  LK  G     NDDD+        + +    G  IAPPPSL E  +I SG          C+           A     Y  +S AAKIM K GFK+G+GLGK  QGM+ ALQVE+TS+RGG+IIHEKD+    LA+   ++  Q                             + I    S V+LLRNMVGPG+VD++L+ E  +EC +KYG+V + +I E    VP+D AV+IFVEF  +ESA +AVVD NGR+FGGR V AG+Y+ +KFK  +L
Sbjct:   51 VADEYDPQRPNEYEKLKEKSNGSDKNRAGVSDREDRDDKEKDRKRGRVGRREFYRDEVSAPNLKLSGFGHRQNDDDMYLPSPGLVAKQG---GATIAPPPSLQE-MSIDSG----------CE-----------ATNTMPYSASSVAAKIMAKYGFKDGQGLGKSEQGMAIALQVEKTSKRGGRIIHEKDVFLPPLALSPPSIGSQIGTSPSHKAMPPPQMVDTAAESGDIGYSITEIMKSPSKVVLLRNMVGPGDVDEELEPEVKDECNTKYGEVNSVIIHESFGTVPED-AVKIFVEFRRIESAIKAVVDLNGRFFGGRQVRAGFYNYDKFKCFQL 362          
BLAST of Splicing factor 45 vs. Ensembl Fly
Match: Spf45 (gene:FBgn0086683 transcript:FBtr0111240)

HSP 1 Score: 134.42 bits (337), Expect = 6.998e-35
Identity = 128/338 (37.87%), Postives = 174/338 (51.48%), Query Frame = 3
Query:  360 VKDEYNPLMPNDYEQI---SXXXXXXXXXXXXXXXXXXXXADSKY-----------------LKYDGV-EETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQ-----------------------------SLISDRVSNVILLRNMVGPGEVDDDLQSETAEEC-SKYGKVVTCMIFE-LQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            V DEY+P  PN+YE++   S      R     +++ + ++ D K                  LK  G     NDDD+        + +    G  IAPPPSL E  +I SG          C+           A     Y  +S AAKIM K GFK+G+GLGK  QGM+ ALQVE+TS+RGG+IIHEKD+    LA+   ++  Q                             + I    S V+LLRNMVGPG+VD++L+ E  +EC +KYG+V + +I E    VP+D AV+IFVEF  +ESA +AVVD NGR+FGGR V AG+Y+ +KFK  +L
Sbjct:   59 VADEYDPQRPNEYEKLKEKSNGSDKNRAGVSDREDRDDKEKDRKRGRVGRREFYRDEVSAPNLKLSGFGHRQNDDDMYLPSPGLVAKQG---GATIAPPPSLQE-MSIDSG----------CE-----------ATNTMPYSASSVAAKIMAKYGFKDGQGLGKSEQGMAIALQVEKTSKRGGRIIHEKDVFLPPLALSPPSIGSQIGTSPSHKAMPPPQMVDTAAESGDIGYSITEIMKSPSKVVLLRNMVGPGDVDEELEPEVKDECNTKYGEVNSVIIHESFGTVPED-AVKIFVEFRRIESAIKAVVDLNGRFFGGRQVRAGFYNYDKFKCFQL 370          
BLAST of Splicing factor 45 vs. Ensembl Fly
Match: Spf45 (gene:FBgn0086683 transcript:FBtr0111239)

HSP 1 Score: 134.42 bits (337), Expect = 1.444e-34
Identity = 128/338 (37.87%), Postives = 174/338 (51.48%), Query Frame = 3
Query:  360 VKDEYNPLMPNDYEQI---SXXXXXXXXXXXXXXXXXXXXADSKY-----------------LKYDGV-EETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQ-----------------------------SLISDRVSNVILLRNMVGPGEVDDDLQSETAEEC-SKYGKVVTCMIFE-LQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            V DEY+P  PN+YE++   S      R     +++ + ++ D K                  LK  G     NDDD+        + +    G  IAPPPSL E  +I SG          C+           A     Y  +S AAKIM K GFK+G+GLGK  QGM+ ALQVE+TS+RGG+IIHEKD+    LA+   ++  Q                             + I    S V+LLRNMVGPG+VD++L+ E  +EC +KYG+V + +I E    VP+D AV+IFVEF  +ESA +AVVD NGR+FGGR V AG+Y+ +KFK  +L
Sbjct:   91 VADEYDPQRPNEYEKLKEKSNGSDKNRAGVSDREDRDDKEKDRKRGRVGRREFYRDEVSAPNLKLSGFGHRQNDDDMYLPSPGLVAKQG---GATIAPPPSLQE-MSIDSG----------CE-----------ATNTMPYSASSVAAKIMAKYGFKDGQGLGKSEQGMAIALQVEKTSKRGGRIIHEKDVFLPPLALSPPSIGSQIGTSPSHKAMPPPQMVDTAAESGDIGYSITEIMKSPSKVVLLRNMVGPGDVDEELEPEVKDECNTKYGEVNSVIIHESFGTVPED-AVKIFVEFRRIESAIKAVVDLNGRFFGGRQVRAGFYNYDKFKCFQL 402          
BLAST of Splicing factor 45 vs. Ensembl Fly
Match: hfp (gene:FBgn0028577 transcript:FBtr0072709)

HSP 1 Score: 81.2629 bits (199), Expect = 5.181e-16
Identity = 48/104 (46.15%), Postives = 62/104 (59.62%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIF---ELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKF 1202
            +Q L+    S VI+LRNMVGP +VD+ LQ E  EECSK+G V   +IF   + ++  DD+A   V+IFVEF     A R     +GR+FGGR V A  YD   F
Sbjct:  527 MQRLMRPVDSRVIILRNMVGPEDVDETLQEEIQEECSKFGTVSRVIIFNEKQTENEDDDEAEIIVKIFVEFSAGAEAMRGKEALDGRFFGGRRVVAELYDQGIF 630          
BLAST of Splicing factor 45 vs. Ensembl Fly
Match: hfp (gene:FBgn0028577 transcript:FBtr0300416)

HSP 1 Score: 80.8777 bits (198), Expect = 5.667e-16
Identity = 48/104 (46.15%), Postives = 62/104 (59.62%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIF---ELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKF 1202
            +Q L+    S VI+LRNMVGP +VD+ LQ E  EECSK+G V   +IF   + ++  DD+A   V+IFVEF     A R     +GR+FGGR V A  YD   F
Sbjct:  435 MQRLMRPVDSRVIILRNMVGPEDVDETLQEEIQEECSKFGTVSRVIIFNEKQTENEDDDEAEIIVKIFVEFSAGAEAMRGKEALDGRFFGGRRVVAELYDQGIF 538          
BLAST of Splicing factor 45 vs. Ensembl Zebrafish
Match: rbm17 (RNA binding motif protein 17 [Source:ZFIN;Acc:ZDB-GENE-040426-817])

HSP 1 Score: 152.14 bits (383), Expect = 8.299e-41
Identity = 131/327 (40.06%), Postives = 183/327 (55.96%), Query Frame = 3
Query:  360 VKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXX-----------------ADSKYLKYDGVEETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLE-DCTIMSGND--------IEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKII----HEK-----------DXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            + DEY+P+ PNDYE++ K  R++R+   +++  +  +                 A S + ++    E+++++   R EKR   K    G AIAPP SL+E D +     D        I  PV  + D            +  A  G T  A KIM K GF+EG+GLGK  QG+STAL VE+TS+RGGKII     EK           D      + +     +  ++    + V+LLRNMVG GEVD+DL++ET EEC KYGKVV C+IFE+  V DD+AVRIF+EF  VESA +AVVD NGRYFGGR+V A +Y+ ++F+ L+L
Sbjct:   96 LADEYDPMFPNDYEKVLKRHREERQKQREQERQKEIEEREKKRKERHEGGGGGGAPSGFSRFPTEGESDEEEDYER-EKR---KRTAGGAAIAPPTSLVERDSSFTYDEDGRQRTKAAIPPPVFEDSDRP--RSPPGPANSFLANMGGT-VAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIIGDSTEKTTGPSQNVANPDGSNSDASKKNETNPLTEILKC-PTKVVLLRNMVGRGEVDEDLEAETKEECEKYGKVVRCVIFEISGVTDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDRFRVLDL 414          
BLAST of Splicing factor 45 vs. Ensembl Zebrafish
Match: rbm17 (RNA binding motif protein 17 [Source:ZFIN;Acc:ZDB-GENE-040426-817])

HSP 1 Score: 152.14 bits (383), Expect = 8.299e-41
Identity = 131/327 (40.06%), Postives = 183/327 (55.96%), Query Frame = 3
Query:  360 VKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXX-----------------ADSKYLKYDGVEETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLE-DCTIMSGND--------IEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKII----HEK-----------DXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            + DEY+P+ PNDYE++ K  R++R+   +++  +  +                 A S + ++    E+++++   R EKR   K    G AIAPP SL+E D +     D        I  PV  + D            +  A  G T  A KIM K GF+EG+GLGK  QG+STAL VE+TS+RGGKII     EK           D      + +     +  ++    + V+LLRNMVG GEVD+DL++ET EEC KYGKVV C+IFE+  V DD+AVRIF+EF  VESA +AVVD NGRYFGGR+V A +Y+ ++F+ L+L
Sbjct:   96 LADEYDPMFPNDYEKVLKRHREERQKQREQERQKEIEEREKKRKERHEGGGGGGAPSGFSRFPTEGESDEEEDYER-EKR---KRTAGGAAIAPPTSLVERDSSFTYDEDGRQRTKAAIPPPVFEDSDRP--RSPPGPANSFLANMGGT-VAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIIGDSTEKTTGPSQNVANPDGSNSDASKKNETNPLTEILKC-PTKVVLLRNMVGRGEVDEDLEAETKEECEKYGKVVRCVIFEISGVTDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDRFRVLDL 414          
BLAST of Splicing factor 45 vs. Ensembl Zebrafish
Match: puf60a (poly-U binding splicing factor a [Source:ZFIN;Acc:ZDB-GENE-030131-2891])

HSP 1 Score: 88.5817 bits (218), Expect = 2.365e-18
Identity = 45/106 (42.45%), Postives = 66/106 (62.26%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            +Q L+  + S V++LRNMVGP ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF       +A+   N R+FGGR V A  YD E+F N +L
Sbjct:  431 MQKLLRKQESTVMVLRNMVGPEDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEVIVKIFVEFSAASEMNKAIQALNNRWFGGRKVIAEVYDQERFDNSDL 536          
BLAST of Splicing factor 45 vs. Ensembl Zebrafish
Match: puf60a (poly-U binding splicing factor a [Source:ZFIN;Acc:ZDB-GENE-030131-2891])

HSP 1 Score: 88.5817 bits (218), Expect = 2.365e-18
Identity = 45/106 (42.45%), Postives = 66/106 (62.26%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            +Q L+  + S V++LRNMVGP ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF       +A+   N R+FGGR V A  YD E+F N +L
Sbjct:  431 MQKLLRKQESTVMVLRNMVGPEDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEVIVKIFVEFSAASEMNKAIQALNNRWFGGRKVIAEVYDQERFDNSDL 536          
BLAST of Splicing factor 45 vs. Ensembl Zebrafish
Match: puf60a (poly-U binding splicing factor a [Source:ZFIN;Acc:ZDB-GENE-030131-2891])

HSP 1 Score: 88.5817 bits (218), Expect = 2.534e-18
Identity = 45/107 (42.06%), Postives = 66/107 (61.68%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELC 1220
            +Q L+  + S V++LRNMVGP ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF       +A+   N R+FGGR V A  YD E+F N +L 
Sbjct:  412 MQKLLRKQESTVMVLRNMVGPEDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEVIVKIFVEFSAASEMNKAIQALNNRWFGGRKVIAEVYDQERFDNSDLS 518          
BLAST of Splicing factor 45 vs. Ensembl Xenopus
Match: rbm17 (RNA binding motif protein 17 [Source:NCBI gene;Acc:448396])

HSP 1 Score: 160.614 bits (405), Expect = 5.413e-44
Identity = 142/360 (39.44%), Postives = 200/360 (55.56%), Query Frame = 3
Query:  207 LPPVVDLKKTIGEGEYRFNHLTGKMEKFNPVSNESQEFVDIAFDDPILRLGVKDEYNPLMPNDYEQI----------SXXXXXXXXXXXXXXXXXXXXADSKYLKYDGVEETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLED--CTIMSGNDIE-----------IPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            L PV+DLK+     E +    +        V    +E V   F    + + + DEY+P+ PN+YE++           + L  +++++E++K  + R   S + +    E   D+D      KRT     + G AIAPP SL+E    +I+   D E           IP  P  DE +        + +       + A KIM K GF+EG+GLGK  QG+STAL VE+TS+RGGKII   DL  +  A ++A     + I    + V+LL+NMVG GEVD+DL++ET EEC KYGKV  C+IFE+   PDD+AVRIF+EF  VESA +AVVD NGRYFGGRIV A +Y+ +KF+ L+L
Sbjct:   51 LAPVIDLKRASAAEERQIADPSPH------VGAGIKESVPSGFSAGEVLVPLADEYDPMFPNEYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFSRRPDPESDEDEDYERERRKRT-----MGGAAIAPPTSLMEKDRESIVPAYDDEPRPRPPMAKAAIPP-PMYDEPERPRSPTGPSNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIII-GDLADKVEAAKKADPNPLTEILKNPTKVVLLQNMVGAGEVDEDLEAETKEECEKYGKVGKCVIFEIPGTPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRIVKACFYNLDKFRTLDL 397          
BLAST of Splicing factor 45 vs. Ensembl Xenopus
Match: rbm17 (RNA binding motif protein 17 [Source:NCBI gene;Acc:448396])

HSP 1 Score: 150.214 bits (378), Expect = 2.434e-40
Identity = 138/355 (38.87%), Postives = 193/355 (54.37%), Query Frame = 3
Query:  207 LPPVVDLKKTIGEGEYRFNHLTGKMEKFNPVSNESQEFVDIAFDDPILRLGVKDEYNPLMPNDYEQI----------SXXXXXXXXXXXXXXXXXXXXADSKYLKYDGVEETNDDDIASRVEKRT-----SDKSRL---VGTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            L PV+DLK+     E +    +        V    +E V   F    + + + DEY+P+ PN+YE++           + L  +++++E++K  + R   S + +    E   D+D      KRT      D+ R    +  A  PPP           ++ E P  P    N          +  A  G T  A KIM K GF+EG+GLGK  QG+STAL VE+TS+RGGKII   DL  +  A ++A     + I    + V+LL+NMVG GEVD+DL++ET EEC KYGKV  C+IFE+   PDD+AVRIF+EF  VESA +AVVD NGRYFGGRIV A +Y+ +KF+ L+L
Sbjct:   51 LAPVIDLKRASAAEERQIADPSPH------VGAGIKESVPSGFSAGEVLVPLADEYDPMFPNEYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFSRRPDPESDEDEDYERERRKRTIVPAYDDEPRPRPPMAKAAIPPPMY---------DEPERPRSPTGPSN----------SFLANMGGT-VAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIII-GDLADKVEAAKKADPNPLTEILKNPTKVVLLQNMVGAGEVDEDLEAETKEECEKYGKVGKCVIFEIPGTPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRIVKACFYNLDKFRTLDL 378          
BLAST of Splicing factor 45 vs. Ensembl Xenopus
Match: puf60 (poly(U) binding splicing factor 60KDa [Source:NCBI gene;Acc:100145091])

HSP 1 Score: 84.3445 bits (207), Expect = 6.257e-17
Identity = 44/106 (41.51%), Postives = 65/106 (61.32%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            +Q L+  + S V++LRNMV P ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF       +A+   NGR+F GR V A  YD E+F N +L
Sbjct:  354 MQKLMRKQESTVMVLRNMVDPRDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSMSSETQKAIQALNGRWFAGRKVVAEVYDQERFDNSDL 459          
BLAST of Splicing factor 45 vs. Ensembl Xenopus
Match: puf60 (poly(U) binding splicing factor 60KDa [Source:NCBI gene;Acc:100145091])

HSP 1 Score: 83.5741 bits (205), Expect = 1.417e-16
Identity = 44/106 (41.51%), Postives = 65/106 (61.32%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            +Q L+  + S V++LRNMV P ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF       +A+   NGR+F GR V A  YD E+F N +L
Sbjct:  413 MQKLMRKQESTVMVLRNMVDPRDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSMSSETQKAIQALNGRWFAGRKVVAEVYDQERFDNSDL 518          
BLAST of Splicing factor 45 vs. Ensembl Mouse
Match: Rbm17 (RNA binding motif protein 17 [Source:MGI Symbol;Acc:MGI:1924188])

HSP 1 Score: 152.91 bits (385), Expect = 3.628e-41
Identity = 127/310 (40.97%), Postives = 170/310 (54.84%), Query Frame = 3
Query:  360 VKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXADSKYLK----YDGVEETNDDDIASRVEKRTSDKSR-LVGTAIAPPPSLLE-------------DCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKII----HEKDXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCE 1223
            + DEY+P+ PNDYE++ K  R++R+   + +  +  +   K  K      G     D D     +     + R + G AIAPP SL+E             D    S +       P  +E D        + +       + A KIM K GF+EG+GLGK  QG+STAL VE+TS+RGGKII     EK   Q       +    + L     + V+LLRNMVG GEVD+DL+ ET EEC KYGKV  C+IFE+   PDD+AVRIF+EF  VESA +AVVD NGRYFGGR+V A +Y+ +KF+ L+L E
Sbjct:   96 LADEYDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFSRRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRPRSQSSKAAIPPPVYEEPDRPRSPTGPSNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVGDATEKGEAQDASKKSDSNPLTEILKCP--TKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAE 403          
BLAST of Splicing factor 45 vs. Ensembl Mouse
Match: Puf60 (poly-U binding splicing factor 60 [Source:MGI Symbol;Acc:MGI:1915209])

HSP 1 Score: 90.8929 bits (224), Expect = 5.891e-19
Identity = 45/107 (42.06%), Postives = 67/107 (62.62%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELC 1220
            +Q L+  + S V++LRNMV P ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF      ++A+   NGR+FGGR V A  YD E+F N +L 
Sbjct:  440 MQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSMASETHKAIQALNGRWFGGRKVVAEVYDQERFDNSDLS 546          
BLAST of Splicing factor 45 vs. Ensembl Mouse
Match: Puf60 (poly-U binding splicing factor 60 [Source:MGI Symbol;Acc:MGI:1915209])

HSP 1 Score: 90.5077 bits (223), Expect = 6.617e-19
Identity = 45/107 (42.06%), Postives = 67/107 (62.62%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELC 1220
            +Q L+  + S V++LRNMV P ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF      ++A+   NGR+FGGR V A  YD E+F N +L 
Sbjct:  457 MQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSMASETHKAIQALNGRWFGGRKVVAEVYDQERFDNSDLS 563          
BLAST of Splicing factor 45 vs. Ensembl Mouse
Match: Htatsf1 (HIV TAT specific factor 1 [Source:MGI Symbol;Acc:MGI:1919709])

HSP 1 Score: 50.447 bits (119), Expect = 3.896e-6
Identity = 29/93 (31.18%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  930 RVSNVILLRNMVGPGEVDDD------LQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYD 1190
            R   V++L+NM  P + +DD      ++ +   ECSK+G++   ++F+    PD  A    V F + E A   +   +GR+FGGR ++A  +D
Sbjct:  262 RHERVVILKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRH--PDGVAS---VSFREPEEADHCIQTLDGRWFGGRQITAQAWD 349          
BLAST of Splicing factor 45 vs. UniProt/SwissProt
Match: sp|Q96I25|SPF45_HUMAN (Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 6.748e-41
Identity = 127/308 (41.23%), Postives = 170/308 (55.19%), Query Frame = 3
Query:  366 DEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXADSKYLK----YDGVEETNDDDIASRVEKRTSDKSR-LVGTAIAPPPSLLE-------------DCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKII----HEKDXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCE 1223
            DEY+P+ PNDYE++ K  R++R+   + +  +  +   K  K      G     D D     +     + R + G AIAPP SL+E             D    S +       P  +E D        + +       + A KIM K GF+EG+GLGK  QG+STAL VE+TS+RGGKII     EKD  ++  +           I    + V+LLRNMVG GEVD+DL+ ET EEC KYGKV  C+IFE+   PDD+AVRIF+EF  VESA +AVVD NGRYFGGR+V A +Y+ +KF+ L+L E
Sbjct:   98 DEYDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRPRSQSSKAAIPPPVYEEQDRPRSPTGPSNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVGDATEKDASKKSDSNPLTE------ILKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAE 399          
BLAST of Splicing factor 45 vs. UniProt/SwissProt
Match: sp|Q8JZX4|SPF45_MOUSE (Splicing factor 45 OS=Mus musculus OX=10090 GN=Rbm17 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.538e-40
Identity = 127/310 (40.97%), Postives = 170/310 (54.84%), Query Frame = 3
Query:  360 VKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXADSKYLK----YDGVEETNDDDIASRVEKRTSDKSR-LVGTAIAPPPSLLE-------------DCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKII----HEKDXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCE 1223
            + DEY+P+ PNDYE++ K  R++R+   + +  +  +   K  K      G     D D     +     + R + G AIAPP SL+E             D    S +       P  +E D        + +       + A KIM K GF+EG+GLGK  QG+STAL VE+TS+RGGKII     EK   Q       +    + L     + V+LLRNMVG GEVD+DL+ ET EEC KYGKV  C+IFE+   PDD+AVRIF+EF  VESA +AVVD NGRYFGGR+V A +Y+ +KF+ L+L E
Sbjct:   96 LADEYDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFSRRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRPRSQSSKAAIPPPVYEEPDRPRSPTGPSNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVGDATEKGEAQDASKKSDSNPLTEILKCP--TKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAE 403          
BLAST of Splicing factor 45 vs. UniProt/SwissProt
Match: sp|P42698|DR111_ARATH (DNA-damage-repair/toleration protein DRT111, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DRT111 PE=1 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 5.953e-29
Identity = 81/194 (41.75%), Postives = 116/194 (59.79%), Query Frame = 3
Query:  675 GNWDAVAIAATQ------AKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQSL-ISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQD--VPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCEDP 1229
            GN D  +I  ++         G  +AA ++M KMG+K+G+GLGK  QG++T L  ++T RR G I++  +        +     ++S+ I+   + V+LLRNMVGPG+VDD+L+ E   EC KYG V   +IFE+ +   P  +AVRIFV+F   E   +A+VD +GRYFGGR V A +YD EKF   EL   P
Sbjct:  192 GNVDGFSIGKSETSGLGVGAGGQMTAAQRMMAKMGWKQGQGLGKSEQGITTPLMAKKTDRRAGVIVNASENKSSSAEKKV----VKSVNINGEPTRVLLLRNMVGPGQVDDELEDEVGGECGKYGTVTRVLIFEITEPNFPVHEAVRIFVQFSRPEETTKALVDLDGRYFGGRTVRATFYDEEKFSKNELAPVP 381          
BLAST of Splicing factor 45 vs. UniProt/SwissProt
Match: sp|Q9WV25|PUF60_RAT (Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus OX=10116 GN=Puf60 PE=2 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 4.628e-18
Identity = 45/107 (42.06%), Postives = 67/107 (62.62%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELC 1220
            +Q L+  + S V++LRNMV P ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF      ++A+   NGR+FGGR V A  YD E+F N +L 
Sbjct:  457 MQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSMASETHKAIQALNGRWFGGRKVVAEVYDQERFDNSDLS 563          
BLAST of Splicing factor 45 vs. UniProt/SwissProt
Match: sp|Q3UEB3|PUF60_MOUSE (Poly(U)-binding-splicing factor PUF60 OS=Mus musculus OX=10090 GN=Puf60 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 4.628e-18
Identity = 45/107 (42.06%), Postives = 67/107 (62.62%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELC 1220
            +Q L+  + S V++LRNMV P ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF      ++A+   NGR+FGGR V A  YD E+F N +L 
Sbjct:  457 MQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSMASETHKAIQALNGRWFGGRKVVAEVYDQERFDNSDLS 563          
BLAST of Splicing factor 45 vs. TrEMBL
Match: A0A5K4ETW5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 8.482e-74
Identity = 176/402 (43.78%), Postives = 243/402 (60.45%), Query Frame = 3
Query:  129 INLMQSHVNKLQRNSKK------QIQQPVTSKLPPVVDLKKTIG--EGEYRFNHLTGKMEKFNPVSNESQEFVD-IAFDDPILRLGVKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXAD-------SKYLKYDGVEETNDDDIASRVEKRTSDKSRLV-GTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQSLIS----------------DRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCEDPWT 1235
            + LMQSH+   +   ++        Q    + L PVVDLK+ +   +G YRFN LTG++E+   VS  S    + + F +P L LGV DEYNP++PN+YE++++I R++R+ +E    D   + D       S   +     +  DD+          + S+   G AIAPP  LLED T+ SG++       +  E+  N D   ++   +K+G    AAK+M +MG++EG+GLG+E QGMSTAL VE+TSRRGGKIIHEKD  +QQ+    +A    SL S                +  S VILLRNM GPGEVDDDL+ ETAEEC+KYGKVV CMI+EL + PDD+ VRIFVEF   E+A +AV+D NGR+F GR+V AG+YD+EKF+NLEL + P +
Sbjct:   66 LKLMQSHMAVKRAQGRRPATDSSNAQWSSRTTLAPVVDLKQRVPHVDGSYRFNQLTGRLERC--VSGSSGAMTNGLLFGEPNLPLGVMDEYNPMIPNEYEELARIKRERRRAEESALADRHHRLDPFGMNDPSGMCRRYEYSDEEDDEDNEYTAASGRNSSQPTKGAAIAPPSVLLEDVTVTSGSNAS-----QNSESSVNDDDPGVSTASSKFGINVVAAKMMARMGYREGQGLGRESQGMSTALVVEKTSRRGGKIIHEKDQQRQQIHANASATTNNSLPSYLSANVEETFNNLPLPENRSCVILLRNMCGPGEVDDDLEPETAEECAKYGKVVMCMIYELPEAPDDEVVRIFVEFESEEAATKAVLDLNGRFFAGRVVKAGFYDAEKFRNLELADAPLS 460          
BLAST of Splicing factor 45 vs. TrEMBL
Match: A0A1S8X6M0 (G-patch domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_01736 PE=4 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 1.486e-73
Identity = 175/391 (44.76%), Postives = 238/391 (60.87%), Query Frame = 3
Query:  126 SINLMQSHVNKLQRNSKKQIQQPVTSKLPPVVDLK-KTIGEGEYRFNHLTGKMEKFNPV----SNESQEFVDIAFDDPILRLGVKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXADSKYLK-----------YDGVEETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXX------XXXXXKIQSL-ISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCEDP 1229
            S+  MQSH+   +R   ++        + PVVDLK +   EG +RFNH TG++E+        S+ +     + F +P L LGV DEYNPL+PND+E++ +I R++R+ +E        + D   L             D  +E ++   AS   +         G AIAPP SLLE  T+  G+  E P+  E +E++       + AT  K+G  + AAK+M +MG++EG+GLG+E QGM+TAL VE+TSRRGGKIIHE+D  +QQ               I +L + +  S VILLRNM GPGEVDDDLQ ETAEEC+KYGKVV+CMIFEL D PDD+AVRIFVEF   + A +AV+D NGR+F GR+V AG+YD+EKF+NLEL + P
Sbjct:   62 SMKFMQSHM-AAKRAQGRRDNFSARPSIAPVVDLKQRNNAEGSFRFNHQTGRLERVGSRGVLGSSPAMMTGGLLFGEPALPLGVTDEYNPLVPNDFEELVRIKRERRRAEEAAIAAAAHRHDGSDLSGMCKRPDFSDYEDDDDEFDEPTAASGGRRSRQAAPPPKGAAIAPPSSLLEGTTVDPGSTSEGPM--ETEESE------TVGAT-TKFGINAVAAKMMARMGYREGQGLGRESQGMATALVVEKTSRRGGKIIHERDQQRQQATQQNPLPDSTVEETINNLPLPENRSCVILLRNMCGPGEVDDDLQPETAEECAKYGKVVSCMIFELADTPDDEAVRIFVEFESEDGATKAVLDLNGRFFAGRVVKAGFYDAEKFRNLELADAP 442          
BLAST of Splicing factor 45 vs. TrEMBL
Match: A0A074ZT79 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_02973 PE=4 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 2.204e-73
Identity = 175/391 (44.76%), Postives = 238/391 (60.87%), Query Frame = 3
Query:  126 SINLMQSHVNKLQRNSKKQIQQPVTSKLPPVVDLK-KTIGEGEYRFNHLTGKMEKFNPV----SNESQEFVDIAFDDPILRLGVKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXADSKYLK-----------YDGVEETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXX------XXXXXKIQSL-ISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCEDP 1229
            S+  MQSH+   +R   ++        + PVVDLK +   EG +RFNH TG++E+        S+ +     + F +P L LGV DEYNPL+PND+E++ +I R++R+ +E        + D   L             D  +E ++   AS   +         G AIAPP SLLE  T+  G+  E P+  E +E++       + AT  K+G  + AAK+M +MG++EG+GLG+E QGM+TAL VE+TSRRGGKIIHE+D  +QQ               I +L + +  S VILLRNM GPGEVDDDLQ ETAEEC+KYGKVV+CMIFEL D PDD+AVRIFVEF   + A +AV+D NGR+F GR+V AG+YD+EKF+NLEL + P
Sbjct:   62 SMKFMQSHM-AAKRAQGRRDNFSARPSIAPVVDLKQRNNAEGSFRFNHQTGRLERVGSRGVLGSSPAMMTGGLLFGEPALPLGVTDEYNPLVPNDFEELVRIKRERRRAEEAAIAAAAHRHDGSDLSGMCKRPDFSDYEDDDDEFDEPTAASGGRRGRQAAPPPKGAAIAPPSSLLEGTTVDPGSTSEGPM--ETEESE------TVGAT-TKFGINAVAAKMMARMGYREGQGLGRESQGMATALVVEKTSRRGGKIIHERDQQRQQATQQNPLPDSTVEETINNLPLPENRSCVILLRNMCGPGEVDDDLQPETAEECAKYGKVVSCMIFELADTPDDEAVRIFVEFESEDGATKAVLDLNGRFFAGRVVKAGFYDAEKFRNLELADAP 442          
BLAST of Splicing factor 45 vs. TrEMBL
Match: A0A4Z2DBI9 (Splicing factor 45 OS=Schistosoma japonicum OX=6182 GN=EWB00_002582 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 3.630e-72
Identity = 177/409 (43.28%), Postives = 246/409 (60.15%), Query Frame = 3
Query:  129 INLMQSHVNKLQRNSKKQIQQPVT----------SKLPPVVDLKKTIG--EGEYRFNHLTGKMEKFNPVSNESQEFVD-IAFDDPILRLGVKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXAD----------SKYLKYDGVEETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXX----XXXXXKIQSLISDRV-------------SNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCEDPWT 1235
            + LMQSH+       + Q ++PVT          + L PVVDLK+ +   +G YRFN LTG++E+   VS  S    + + F +P L LGV DEYNP++PN+YE++++I R++R+ +E    D   + D           +  +Y   +E  D +  +   +  S  S+  G AIAPP  LLED T+  G++       + +E   N D   ++   +K+G    AAK+M +MG++EG+GLG+E QGMSTAL VE+TSRRGGKIIHEKD  +QQ             + S ++  V             S VILLRNM GPGEVDDDL+ ETAEEC+KYGKVV CMI+EL + PDD+ VRIFVEF   E+A +AV+D NGR+F GR+V AG+YD+EKF+NLEL + P +
Sbjct:   67 LKLMQSHMAV----KRAQGRRPVTDSSNSQWSSRTTLAPVVDLKQRVSHVDGSYRFNQLTGRLERC--VSGSSGAMTNGLLFGEPNLPLGVMDEYNPMIPNEYEELARIKRERRRAEESALADRHHRLDPFGMNDPSGMCRRYEYSDEDEDEDTEYTAASGRNYSQPSK--GAAIAPPSVLLEDVTVTPGSNAS-----QNNEASTNDDDPGVSTASSKFGINVVAAKMMARMGYREGQGLGRESQGMSTALMVEKTSRRGGKIIHEKDQQRQQTQANTTSTNNNNNLPSYLNANVEETFNNLPLPENRSCVILLRNMCGPGEVDDDLEPETAEECAKYGKVVMCMIYELPEAPDDEVVRIFVEFDSEEAATKAVLDLNGRFFAGRVVKAGFYDAEKFRNLELADAPLS 462          
BLAST of Splicing factor 45 vs. TrEMBL
Match: A0A3Q0KRQ7 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 6.418e-72
Identity = 176/412 (42.72%), Postives = 244/412 (59.22%), Query Frame = 3
Query:  129 INLMQSHVNKLQRNSKK------QIQQPVTSKLPPVVDLKKTIG--EGEYRFNHLTGKMEKF-----NPVSNESQEFVDIA------FDDPILRLGVKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXAD-------SKYLKYDGVEETNDDDIASRVEKRTSDKSRLV-GTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQSLIS----------------DRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCEDPWT 1235
            + LMQSH+   +   ++        Q    + L PVVDLK+ +   +G YRFN LTG++E+         S  S ++ + A      F +P L LGV DEYNP++PN+YE++++I R++R+ +E    D   + D       S   +     +  DD+          + S+   G AIAPP  LLED T+ SG++       +  E+  N D   ++   +K+G    AAK+M +MG++EG+GLG+E QGMSTAL VE+TSRRGGKIIHEKD  +QQ+    +A    SL S                +  S VILLRNM GPGEVDDDL+ ETAEEC+KYGKVV CMI+EL + PDD+ VRIFVEF   E+A +AV+D NGR+F GR+V AG+YD+EKF+NLEL + P +
Sbjct:   66 LKLMQSHMAVKRAQGRRPATDSSNAQWSSRTTLAPVVDLKQRVPHVDGSYRFNQLTGRLERCVSGSSGGKSKRSLKYSNTAMTNGLLFGEPNLPLGVMDEYNPMIPNEYEELARIKRERRRAEESALADRHHRLDPFGMNDPSGMCRRYEYSDEEDDEDNEYTAASGRNSSQPTKGAAIAPPSVLLEDVTVTSGSNAS-----QNSESSVNDDDPGVSTASSKFGINVVAAKMMARMGYREGQGLGRESQGMSTALVVEKTSRRGGKIIHEKDQQRQQIHANASATTNNSLPSYLSANVEETFNNLPLPENRSCVILLRNMCGPGEVDDDLEPETAEECAKYGKVVMCMIYELPEAPDDEVVRIFVEFESEEAATKAVLDLNGRFFAGRVVKAGFYDAEKFRNLELADAPLS 472          
BLAST of Splicing factor 45 vs. Ensembl Cavefish
Match: rbm17 (RNA binding motif protein 17 [Source:NCBI gene;Acc:103040370])

HSP 1 Score: 159.073 bits (401), Expect = 9.803e-44
Identity = 142/397 (35.77%), Postives = 214/397 (53.90%), Query Frame = 3
Query:   72 FDDVGKSKNVSWSGGLTPSINLMQSH--VNKLQRNSKKQIQQPVTSKLPPVVDLKKTIGEGEYRFNHLTGKMEKFNPVSNESQEFVDIAFDDPILRLGVKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXADSKYLKYDGVEETNDDDIASRVEKRTSD--------KSRLVG---TAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCE 1223
            +DD+G + + + + G + +  L+QS   V K      K  +   ++ L PVVDLK+   E +         +    P      + V   F    + + + DEY+P+ PNDYE++ K  R++R+   +++  +  +   KY +++G   +      +  +    +        +S LV    + +  P S   D      +   IP     D           ++  A  G T  A KIM K GF+EG+GLGK  QG+STAL VE+TS+RGGKII   D  ++  + +     +  ++    + V+LLRNMVG GEVD+DL++ET EEC KYGKVV C+IFE+ DV DD+AVRIF+EF  VESA +AVVD NGRYFGGR+V A +Y+ +KF+ L+L E
Sbjct:    4 YDDLGVATSDAKTEGWSKNFKLLQSQLKVKKAALTQAKTQRMRQSTVLAPVVDLKRGSDERQ---------IPDTPPHVAAGLKDVPGGFSAGDVLIPLPDEYDPMFPNDYEKVVKRHREERQRQREQERQKEIEEREKYERHEGSAPSGFSRFPTEADSDEDEEYEKEKRKRSGLVMFGVSCVLTPASYSYDEEGRQRSKAAIPPPVYDDSERPRSPPGPTSSFLANMGGT-VAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIII-GDSTEKNPSKKNEVNPLTEILKC-PTKVVLLRNMVGRGEVDEDLEAETKEECEKYGKVVKCVIFEISDVTDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLGE 388          
BLAST of Splicing factor 45 vs. Ensembl Cavefish
Match: rbm17 (RNA binding motif protein 17 [Source:NCBI gene;Acc:103040370])

HSP 1 Score: 152.91 bits (385), Expect = 3.499e-41
Identity = 134/326 (41.10%), Postives = 179/326 (54.91%), Query Frame = 3
Query:  360 VKDEYNPLMPNDYEQI-------------SXXXXXXXXXXXXXXXXXXXXADSKYLKYDGVEETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLEDCTIMS----GNDIEIPVLPECDENDGNWDAVAIAATQ---AKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKII----HEKDXXXXXXXX------------XXXXXKIQSL--ISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCE 1223
            + DEY+P+ PNDYE++              +  ++  + ++K+KE     A S + ++     T  D       ++   K  + G AIAPP SL+E  T  S    G       +P    +D          T    A  G T  A KIM K GF+EG+GLGK  QG+STAL VE+TS+RGGKII     EK+    Q A                  ++  L  I    + V+LLRNMVG GEVD+DL++ET EEC KYGKVV C+IFE+ DV DD+AVRIF+EF  VESA +AVVD NGRYFGGR+V A +Y+ +KF+ L+L E
Sbjct:   93 LPDEYDPMFPNDYEKVVKRHREERQRQREQERQKEIEEREKKRKERHEGSAPSGFSRF----PTEADSDEDEEYEKEKRKRSMGGAAIAPPTSLVERDTSYSYDEEGRQRSKAAIPPPVYDDSERPRSPPGPTSSFLANMGGT-VAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIIGDSTEKNSGSSQSAADTPGSNSGASADPSKKNEVNPLTEILKCPTKVVLLRNMVGRGEVDEDLEAETKEECEKYGKVVKCVIFEISDVTDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLGE 413          
BLAST of Splicing factor 45 vs. Ensembl Cavefish
Match: rbm17 (RNA binding motif protein 17 [Source:NCBI gene;Acc:103040370])

HSP 1 Score: 109.768 bits (273), Expect = 1.301e-25
Identity = 114/295 (38.64%), Postives = 153/295 (51.86%), Query Frame = 3
Query:  360 VKDEYNPLMPNDYEQI-------------SXXXXXXXXXXXXXXXXXXXXADSKYLKYDGVEETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLEDCTIMS----GNDIEIPVLPECDENDGNWDAVAIAATQ---AKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKII----HEKDXXXXXXXX------------XXXXXKIQSL--ISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRA 1130
            + DEY+P+ PNDYE++              +  ++  + ++K+KE     A S + ++     T  D       ++   K  + G AIAPP SL+E  T  S    G       +P    +D          T    A  G T  A KIM K GF+EG+GLGK  QG+STAL VE+TS+RGGKII     EK+    Q A                  ++  L  I    + V+LLRNMVG GEVD+DL++ET EEC KYGKVV C+IFE+ DV DD+AVRIF+EF  VESA + 
Sbjct:   93 LPDEYDPMFPNDYEKVVKRHREERQRQREQERQKEIEEREKKRKERHEGSAPSGFSRFP----TEADSDEDEEYEKEKRKRSMGGAAIAPPTSLVERDTSYSYDEEGRQRSKAAIPPPVYDDSERPRSPPGPTSSFLANMGGT-VAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIIGDSTEKNSGSSQSAADTPGSNSGASADPSKKNEVNPLTEILKCPTKVVLLRNMVGRGEVDEDLEAETKEECEKYGKVVKCVIFEISDVTDDEAVRIFLEFERVESAIKG 382          
BLAST of Splicing factor 45 vs. Ensembl Cavefish
Match: puf60a (poly(U)-binding-splicing factor PUF60 [Source:NCBI gene;Acc:103042138])

HSP 1 Score: 88.5817 bits (218), Expect = 2.120e-18
Identity = 45/107 (42.06%), Postives = 66/107 (61.68%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELC 1220
            +Q L+  + S V++LRNMVGP ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF       +A+   N R+FGGR V A  YD E+F N +L 
Sbjct:  408 MQKLLRKQESTVMVLRNMVGPEDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEVIVKIFVEFSAASEMNKAIQALNNRWFGGRKVIAEVYDQERFDNSDLS 514          
BLAST of Splicing factor 45 vs. Ensembl Cavefish
Match: puf60a (poly(U)-binding-splicing factor PUF60 [Source:NCBI gene;Acc:103042138])

HSP 1 Score: 88.5817 bits (218), Expect = 2.133e-18
Identity = 45/106 (42.45%), Postives = 66/106 (62.26%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            +Q L+  + S V++LRNMVGP ++DDDL+ E  EEC K+G V   +I++ +   ++ A   V+IFVEF       +A+   N R+FGGR V A  YD E+F N +L
Sbjct:  434 MQKLLRKQESTVMVLRNMVGPEDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEVIVKIFVEFSAASEMNKAIQALNNRWFGGRKVIAEVYDQERFDNSDL 539          
BLAST of Splicing factor 45 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001053.1 (pep scaffold:Pmarinus_7.0:GL478206:26457:39057:1 gene:ENSPMAG00000000940.1 transcript:ENSPMAT00000001053.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.696 bits (413), Expect = 5.452e-46
Identity = 138/409 (33.74%), Postives = 207/409 (50.61%), Query Frame = 3
Query:   72 FDDVGKSKNVSWSGGLTPSINLMQSH--VNKLQRNSKKQIQQPVTSKLPPVVDLKKTIGEGEYRFNHLTGKMEKFNPVSNESQEFVDIAFDDPILRLGVKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXADSKYLK----YDGVEET--NDDDIASRVEKRTSDKSRLVGTAIAPPPSLLE---DCTIMSGNDIEI--------PVLPECDENDGNWDAVAIAATQAKYGTT---SAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQ----SLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELC 1220
            +DD+   ++ S + G + +  L+QS   V K      K  +   ++ L PVVDLK+  G  E R +           V+   +    +AF   +L + V DEY+P+ PNDY+++ K  R+ R+   + +  +      K  K      G+     +DD+     EKR   K   +G AIAPP SL+E   D +     D EI          +P  +  D      +     + + +         I++ +                 AL VE+TS+RGGK +   ++ ++ L    +A K +    + I    + V+LLRNMVGPGEVD+DL+SET EEC KYGKV+ C+IFE+   P+D AVRIF+EF  +ESA +AVVD NGRYFGGRIV AG+Y+ +KF+ L+L 
Sbjct:    4 YDDLRVERSDSKTEGWSKNFKLLQSQLQVKKAALTQAKNQRGKQSTVLAPVVDLKRNSGP-EERTSFPEPPPPPP--VATTPKVVPPMAFMGEML-IPVADEYDPMYPNDYDKVVKRQREDRQRQREHERQKEIDDREKRRKERHEASGMSRRPESDDEEEYEAEKR---KRGTMGAAIAPPSSLMERDKDYSYTVAPDDEIKRGRMSGKAAIPPPNYEDSGERPRSPPGGSSSFISNMGFLILFLILLYLILHLQVLFSHSLLPDPLALSVEKTSKRGGKTLIGDNVPKEGLHANTSAKKQEPNPLTEILKNPTKVVLLRNMVGPGEVDEDLESETKEECEKYGKVIKCVIFEMPGAPEDDAVRIFLEFERMESAIKAVVDLNGRYFGGRIVKAGFYNLDKFRRLDLA 405          
BLAST of Splicing factor 45 vs. Ensembl Sea Lamprey
Match: u2af2a (U2 small nuclear RNA auxiliary factor 2a [Source:ZFIN;Acc:ZDB-GENE-050706-131])

HSP 1 Score: 51.9878 bits (123), Expect = 2.048e-7
Identity = 38/105 (36.19%), Postives = 50/105 (47.62%), Query Frame = 3
Query:  936 SNVILLRNMVGPGEVDDDLQSE-----TAEECSKYGKVVTCMI---FELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCED 1226
            + V+ L NMV P E+ DD + E       EEC KYG V +  I       D+P     +IFVEF  +    RA    +GR F  R+V   YY+ EK+     C D
Sbjct:  361 TEVLCLMNMVTPEELVDDEEYEDILEDIREECGKYGSVRSVEIPRPVNGLDIPG--CGKIFVEFASLLDCQRAQQALSGRKFANRVVVTQYYNLEKYH----CHD 459          
BLAST of Splicing factor 45 vs. Ensembl Nematostella
Match: EDO39985 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H1])

HSP 1 Score: 166.777 bits (421), Expect = 5.581e-47
Identity = 111/228 (48.68%), Postives = 148/228 (64.91%), Query Frame = 3
Query:  564 RLVGTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAA-----TQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIH-EKDXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQ-DVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCED 1226
            R VG AIAPP SLLE            P++P+  E D + D   +       T   +   + A+ IM K G+K+G+GLGK  QG++T LQVE+TS+RGGKII+ EK+  + Q         +++      S V+LLRNMVGPGEVDDDLQ ETAEEC+KYG+VV  +I+E+    PDD+AVRIFVEF  +ESA +AVVD NGRYFGGR V A +++ +KF+ L+L +D
Sbjct:  184 RSVGAAIAPPSSLLESE----------PIVPQ-KEPDPSIDGRPLVTGDKEKTDLGFAVNAVASSIMAKYGWKDGQGLGKSEQGINTCLQVEKTSKRGGKIINQEKEAAKSQAEGDSLVGAMKN-----PSKVVLLRNMVGPGEVDDDLQPETAEECAKYGEVVKVIIYEIPVGAPDDEAVRIFVEFTRMESAIKAVVDLNGRYFGGRTVKANFFNLDKFRRLDLADD 395          
BLAST of Splicing factor 45 vs. Ensembl Nematostella
Match: EDO25346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWR4])

HSP 1 Score: 150.599 bits (379), Expect = 1.166e-43
Identity = 80/144 (55.56%), Postives = 104/144 (72.22%), Query Frame = 3
Query:  804 STALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQSLIS--DRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQ-DVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCED 1226
            +T LQVE+TS+RGGKII+++    +  A         SL+      S V+LLRNMVGPGEVDDDLQ ETAEEC+KYG+VV  +I+E+    PDD+AVRIFVEF  +ESA +AVVD NGRYFGGR V A +++ +KF+ L+L +D
Sbjct:   20 NTCLQVEKTSKRGGKIINQEKEAAKLQAEG------DSLVGAMKNPSKVVLLRNMVGPGEVDDDLQPETAEECAKYGEVVKVIIYEIPVGAPDDEAVRIFVEFTRMESAIKAVVDLNGRYFGGRTVKANFFNLDKFRRLDLADD 157          
BLAST of Splicing factor 45 vs. Ensembl Nematostella
Match: EDO46306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQK4])

HSP 1 Score: 80.8777 bits (198), Expect = 2.081e-16
Identity = 47/138 (34.06%), Postives = 78/138 (56.52%), Query Frame = 3
Query:  816 QVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELC 1220
            + +R    GG I HE+++       +     +Q L     S V++LRNMVG  ++D+DL+ E  +ECSK+G V   +I++ +   ++ A   V+IFVEF   +   +A  + +GR+FGGR V A  Y+ +KF + +L 
Sbjct:  368 ETQRKMAEGGSISHEENMSISGSNARYMV--MQKLSRKSESKVMVLRNMVGVEDLDEDLEHEVTDECSKFGTVSRVVIYKEKQGEEEDAEVIVKIFVEFTSPDETDKATSNLDGRWFGGRAVKAEAYNEDKFLSADLS 503          
BLAST of Splicing factor 45 vs. Ensembl Nematostella
Match: EDO48329 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJT7])

HSP 1 Score: 50.447 bits (119), Expect = 7.364e-7
Identity = 35/97 (36.08%), Postives = 52/97 (53.61%), Query Frame = 3
Query:  936 SNVILLRNMVGPGEVDDDLQSE-----TAEECSKYGKVVTCMIFE-LQDVPDDQAV-RIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFK 1205
            + V+ L NMV P E+ DD + E       EECSKYG+V +  I   ++ + +   V +IFVEF  ++ A +A     GR F  R+V   YY  E++ 
Sbjct:  231 TEVLALMNMVTPDELGDDEEFEEIYDDVREECSKYGRVKSMEIPRPMEGLMEPPGVGKIFVEFSSIDDAKKAAAALGGRKFANRVVVTSYYPPEEYH 327          
BLAST of Splicing factor 45 vs. Ensembl Medaka
Match: rbm17 (RNA binding motif protein 17 [Source:NCBI gene;Acc:101158922])

HSP 1 Score: 169.088 bits (427), Expect = 4.233e-47
Identity = 153/425 (36.00%), Postives = 222/425 (52.24%), Query Frame = 3
Query:   72 FDDVGKSKNVSWSGGLTPSINLMQSHVN----KLQRNSKKQIQQPVTSKLPPVVDLKKTIGEGEYRFNHLTGKMEKFNPVSNESQEFVDIAFDDPILRLGVKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXADSKYLK--YDGVEETNDDDIAS--------RVEKRTSDKSRLVGTAIAPPPSLLE-----------DCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKII----HEKDXXXXXXXXXXXXXKIQSLISDRV------------SNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCE 1223
            +DD+G   + + + G + +  L+QS +      L +   ++++Q  T+ L PV+DLK        R   +  +     P      + V  AF    + + + DEY+P+ PNDYE++ K  R++R+   +++  +  +   K  K  +DG   +      +           +R   K  + G AIAPP SL++           +     G  + IP     D +         ++  A  G T  A KIM K GFKEG+GLGK  QG+STAL VE+TS+RGGKII     EK    Q  A +       +  S +             + V+LLRNMVG GEVD+DL+ ET EEC KYGKVV C+IFE+ +VPDD+AVRIF+EF  VESA +AVVD NGRYFGGR+V A +Y+ +KF+ L+L E
Sbjct:    4 YDDLGVGASDTKTEGWSKNFKLLQSQLKVKKAALTQAKTQRVKQ--TTVLAPVIDLK--------RGGSIDERQSTDTPPHAGLMDAVPSAFSAGDVLIPLADEYDPMFPNDYEKVMKRHREERQRQREQERQKEIEEREKRRKDRHDGGAPSGFSRFPAAEEDSDEDEEYERERRKRSMGGAAIAPPSSLVDRDGSSSFSYEDEGRPSRGPKVAIPPPMYEDSDRPRSPPGPTSSFLANMGGT-VAHKIMQKYGFKEGQGLGKHEQGLSTALSVEKTSKRGGKIIIGDAAEKPGSSQAGAAEIPGGGAAADASKKSESNPLTEILKNPTKVVLLRNMVGRGEVDEDLEGETKEECEKYGKVVKCVIFEIAEVPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLGE 417          
BLAST of Splicing factor 45 vs. Ensembl Medaka
Match: rbm17 (RNA binding motif protein 17 [Source:NCBI gene;Acc:101158922])

HSP 1 Score: 155.221 bits (391), Expect = 3.125e-42
Identity = 78/140 (55.71%), Postives = 104/140 (74.29%), Query Frame = 3
Query:  804 STALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCE 1223
            STAL VE+TS+RGGKII      +   + +  +  +  ++ +  + V+LLRNMVG GEVD+DL+ ET EEC KYGKVV C+IFE+ +VPDD+AVRIF+EF  VESA +AVVD NGRYFGGR+V A +Y+ +KF+ L+L E
Sbjct:  254 STALSVEKTSKRGGKIIIGDAAEKPDASKKSESNPLTEILKN-PTKVVLLRNMVGRGEVDEDLEGETKEECEKYGKVVKCVIFEIAEVPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLGE 392          
BLAST of Splicing factor 45 vs. Ensembl Medaka
Match: ENSORLT00000038235.1 (poly(U)-binding-splicing factor PUF60-like [Source:NCBI gene;Acc:101171279])

HSP 1 Score: 95.9005 bits (237), Expect = 8.940e-21
Identity = 48/106 (45.28%), Postives = 69/106 (65.09%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            ++ L+  R S V++LRNMVGP ++DDDL+ E  EEC KYG+V   +I++ +   +D A   V+IFVEF +     RA+   N R+FGGR V A  YD E+F+N +L
Sbjct:  408 MRKLLRKRESTVMVLRNMVGPEDIDDDLEGEVTEECGKYGQVKRVIIYQERQGEEDDADIIVKIFVEFCEAMEMNRAIQALNNRWFGGRKVVAEVYDQERFENSDL 513          
BLAST of Splicing factor 45 vs. Ensembl Medaka
Match: ENSORLT00000045704.1 (poly(U)-binding-splicing factor PUF60-like [Source:NCBI gene;Acc:101171279])

HSP 1 Score: 95.5153 bits (236), Expect = 1.041e-20
Identity = 48/106 (45.28%), Postives = 69/106 (65.09%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
            ++ L+  R S V++LRNMVGP ++DDDL+ E  EEC KYG+V   +I++ +   +D A   V+IFVEF +     RA+   N R+FGGR V A  YD E+F+N +L
Sbjct:  412 MRKLLRKRESTVMVLRNMVGPEDIDDDLEGEVTEECGKYGQVKRVIIYQERQGEEDDADIIVKIFVEFCEAMEMNRAIQALNNRWFGGRKVVAEVYDQERFENSDL 517          
BLAST of Splicing factor 45 vs. Ensembl Medaka
Match: ENSORLT00000038253.1 (poly(U)-binding-splicing factor PUF60-like [Source:NCBI gene;Acc:101171279])

HSP 1 Score: 92.4337 bits (228), Expect = 9.415e-20
Identity = 46/99 (46.46%), Postives = 65/99 (65.66%), Query Frame = 3
Query:  930 RVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLEL 1217
             +S V++LRNMVGP ++DDDL+ E  EEC KYG+V   +I++ +   +D A   V+IFVEF +     RA+   N R+FGGR V A  YD E+F+N +L
Sbjct:  380 HMSTVMVLRNMVGPEDIDDDLEGEVTEECGKYGQVKRVIIYQERQGEEDDADIIVKIFVEFCEAMEMNRAIQALNNRWFGGRKVVAEVYDQERFENSDL 478          
BLAST of Splicing factor 45 vs. Planmine SMEST
Match: SMESG000038359.1 (SMESG000038359.1)

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 393/393 (100.00%), Postives = 393/393 (100.00%), Query Frame = 3
Query:   66 YDFDDVGKSKNVSWSGGLTPSINLMQSHVNKLQRNSKKQIQQPVTSKLPPVVDLKKTIGEGEYRFNHLTGKMEKFNPVSNESQEFVDIAFDDPILRLGVKDEYNPLMPNDYEQISXXXXXXXXXXXXXXXXXXXXADSKYLKYDGVEETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVXXXXXXXXXXXXXXXXXSTALQVERTSRRGGKIIHEKDXXXXXXXXXXXXXKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCEDPWTFHE 1244
            YDFDDVGKSKNVSWSGGLTPSINLMQSHVNKLQRNSKKQIQQPVTSKLPPVVDLKKTIGEGEYRFNHLTGKMEKFNPVSNESQEFVDIAFDDPILRLGVKDEYNPLMPNDYEQISKILRDKRKLDEKKKEDEIRKADSKYLKYDGVEETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVKMGFKEGKGLGKEGQGMSTALQVERTSRRGGKIIHEKDLLQQQLAVQQAALKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCEDPWTFHE
Sbjct:    4 YDFDDVGKSKNVSWSGGLTPSINLMQSHVNKLQRNSKKQIQQPVTSKLPPVVDLKKTIGEGEYRFNHLTGKMEKFNPVSNESQEFVDIAFDDPILRLGVKDEYNPLMPNDYEQISKILRDKRKLDEKKKEDEIRKADSKYLKYDGVEETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLEDCTIMSGNDIEIPVLPECDENDGNWDAVAIAATQAKYGTTSAAAKIMVKMGFKEGKGLGKEGQGMSTALQVERTSRRGGKIIHEKDLLQQQLAVQQAALKIQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCEDPWTFHE 396          
BLAST of Splicing factor 45 vs. Planmine SMEST
Match: SMESG000046155.1 (SMESG000046155.1)

HSP 1 Score: 73.559 bits (179), Expect = 9.276e-14
Identity = 42/102 (41.18%), Postives = 62/102 (60.78%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTC-MIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKF 1202
            +Q L+   V  V++LRNM+   ++DD ++ E  EEC+K+G+V    ++ E +D  +D A   V+IFV F   +S   A+   NGR+FGGRIV A  YD E F
Sbjct:  384 MQKLLRPTVHKVMVLRNMIDQNDIDDQIEEEVYEECAKFGEVQEVKIVVESRD--NDNANGEVKIFVVFKSTDSINIAINSMNGRFFGGRIVIADKYDQELF 483          
BLAST of Splicing factor 45 vs. Planmine SMEST
Match: SMESG000046155.1 (SMESG000046155.1)

HSP 1 Score: 73.559 bits (179), Expect = 9.382e-14
Identity = 42/102 (41.18%), Postives = 62/102 (60.78%), Query Frame = 3
Query:  909 IQSLISDRVSNVILLRNMVGPGEVDDDLQSETAEECSKYGKVVTC-MIFELQDVPDDQA---VRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKF 1202
            +Q L+   V  V++LRNM+   ++DD ++ E  EEC+K+G+V    ++ E +D  +D A   V+IFV F   +S   A+   NGR+FGGRIV A  YD E F
Sbjct:  392 MQKLLRPTVHKVMVLRNMIDQNDIDDQIEEEVYEECAKFGEVQEVKIVVESRD--NDNANGEVKIFVVFKSTDSINIAINSMNGRFFGGRIVIADKYDQELF 491          
BLAST of Splicing factor 45 vs. Planmine SMEST
Match: SMESG000078029.1 (SMESG000078029.1)

HSP 1 Score: 58.151 bits (139), Expect = 8.086e-9
Identity = 33/99 (33.33%), Postives = 51/99 (51.52%), Query Frame = 3
Query:  936 SNVILLRNMVGPGEVDDDLQSE-----TAEECSKYGKVVTCMIFELQDVPDDQ---AVRIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKN 1208
            + ++ L NM+ P E+ DD + E       EECSKYG V +  I       +D      +I+VEF +     +A+    GR F GR+V   +YD E+++N
Sbjct:  399 TEILCLHNMITPEELTDDEEYEEIVEDVKEECSKYGSVNSLQIPRPTGSEEDSRNGVGKIYVEFSNKSETVKAMKALAGRTFSGRVVVTSFYDPERYRN 497          
BLAST of Splicing factor 45 vs. Planmine SMEST
Match: SMESG000018652.1 (SMESG000018652.1)

HSP 1 Score: 54.299 bits (129), Expect = 1.355e-7
Identity = 32/98 (32.65%), Postives = 53/98 (54.08%), Query Frame = 3
Query:  936 SNVILLRNMVGPGEVDDD-----LQSETAEECSKYGKVVTCMIFELQDVPDDQAV--RIFVEFVDVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKN 1208
            + V+ L NMV   ++ DD     +  +  EECSK+G V++  I       D+ +   +IFVEF +     +A+   +GR F G++V   +YD EK++N
Sbjct:  376 TEVLCLHNMVMIDDLRDDEEYEEIMEDVKEECSKFGTVLSVQIPRPTGADDNVSGVGKIFVEFYNKSETVKAMKALSGRTFSGKVVVTSFYDLEKYRN 473          
The following BLAST results are available for this feature:
BLAST of Splicing factor 45 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBM171.405e-4141.23RNA binding motif protein 17 [Source:HGNC Symbol;A... [more]
RBM171.405e-4141.23RNA binding motif protein 17 [Source:HGNC Symbol;A... [more]
PUF605.505e-1841.12poly(U) binding splicing factor 60 [Source:HGNC Sy... [more]
PUF605.802e-1841.12poly(U) binding splicing factor 60 [Source:HGNC Sy... [more]
PUF605.834e-1841.12poly(U) binding splicing factor 60 [Source:HGNC Sy... [more]
back to top
BLAST of Splicing factor 45 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm-171.176e-1929.20RNA Binding Motif protein homolog [Source:UniProt... [more]
rnp-68.291e-1339.80RNP (RRM RNA binding domain) containing [Source:U... [more]
uaf-16.590e-833.33Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
uaf-16.590e-833.33Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
uaf-16.590e-833.33Splicing factor U2AF 65 kDa subunit [Source:UniPr... [more]
back to top
BLAST of Splicing factor 45 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spf455.165e-3537.87gene:FBgn0086683 transcript:FBtr0111241[more]
Spf456.998e-3537.87gene:FBgn0086683 transcript:FBtr0111240[more]
Spf451.444e-3437.87gene:FBgn0086683 transcript:FBtr0111239[more]
hfp5.181e-1646.15gene:FBgn0028577 transcript:FBtr0072709[more]
hfp5.667e-1646.15gene:FBgn0028577 transcript:FBtr0300416[more]
back to top
BLAST of Splicing factor 45 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm178.299e-4140.06RNA binding motif protein 17 [Source:ZFIN;Acc:ZDB-... [more]
rbm178.299e-4140.06RNA binding motif protein 17 [Source:ZFIN;Acc:ZDB-... [more]
puf60a2.365e-1842.45poly-U binding splicing factor a [Source:ZFIN;Acc:... [more]
puf60a2.365e-1842.45poly-U binding splicing factor a [Source:ZFIN;Acc:... [more]
puf60a2.534e-1842.06poly-U binding splicing factor a [Source:ZFIN;Acc:... [more]
back to top
BLAST of Splicing factor 45 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rbm175.413e-4439.44RNA binding motif protein 17 [Source:NCBI gene;Acc... [more]
rbm172.434e-4038.87RNA binding motif protein 17 [Source:NCBI gene;Acc... [more]
puf606.257e-1741.51poly(U) binding splicing factor 60KDa [Source:NCBI... [more]
puf601.417e-1641.51poly(U) binding splicing factor 60KDa [Source:NCBI... [more]
back to top
BLAST of Splicing factor 45 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rbm173.628e-4140.97RNA binding motif protein 17 [Source:MGI Symbol;Ac... [more]
Puf605.891e-1942.06poly-U binding splicing factor 60 [Source:MGI Symb... [more]
Puf606.617e-1942.06poly-U binding splicing factor 60 [Source:MGI Symb... [more]
Htatsf13.896e-631.18HIV TAT specific factor 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Splicing factor 45 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96I25|SPF45_HUMAN6.748e-4141.23Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM1... [more]
sp|Q8JZX4|SPF45_MOUSE2.538e-4040.97Splicing factor 45 OS=Mus musculus OX=10090 GN=Rbm... [more]
sp|P42698|DR111_ARATH5.953e-2941.75DNA-damage-repair/toleration protein DRT111, chlor... [more]
sp|Q9WV25|PUF60_RAT4.628e-1842.06Poly(U)-binding-splicing factor PUF60 OS=Rattus no... [more]
sp|Q3UEB3|PUF60_MOUSE4.628e-1842.06Poly(U)-binding-splicing factor PUF60 OS=Mus muscu... [more]
back to top
BLAST of Splicing factor 45 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4ETW58.482e-7443.78Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A1S8X6M01.486e-7344.76G-patch domain protein OS=Opisthorchis viverrini O... [more]
A0A074ZT792.204e-7344.76Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4Z2DBI93.630e-7243.28Splicing factor 45 OS=Schistosoma japonicum OX=618... [more]
A0A3Q0KRQ76.418e-7242.72Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Splicing factor 45 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm179.803e-4435.77RNA binding motif protein 17 [Source:NCBI gene;Acc... [more]
rbm173.499e-4141.10RNA binding motif protein 17 [Source:NCBI gene;Acc... [more]
rbm171.301e-2538.64RNA binding motif protein 17 [Source:NCBI gene;Acc... [more]
puf60a2.120e-1842.06poly(U)-binding-splicing factor PUF60 [Source:NCBI... [more]
puf60a2.133e-1842.45poly(U)-binding-splicing factor PUF60 [Source:NCBI... [more]
back to top
BLAST of Splicing factor 45 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001053.15.452e-4633.74pep scaffold:Pmarinus_7.0:GL478206:26457:39057:1 g... [more]
u2af2a2.048e-736.19U2 small nuclear RNA auxiliary factor 2a [Source:Z... [more]
back to top
BLAST of Splicing factor 45 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Splicing factor 45 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO399855.581e-4748.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO253461.166e-4355.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO463062.081e-1634.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483297.364e-736.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Splicing factor 45 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm174.233e-4736.00RNA binding motif protein 17 [Source:NCBI gene;Acc... [more]
rbm173.125e-4255.71RNA binding motif protein 17 [Source:NCBI gene;Acc... [more]
ENSORLT00000038235.18.940e-2145.28poly(U)-binding-splicing factor PUF60-like [Source... [more]
ENSORLT00000045704.11.041e-2045.28poly(U)-binding-splicing factor PUF60-like [Source... [more]
ENSORLT00000038253.19.415e-2046.46poly(U)-binding-splicing factor PUF60-like [Source... [more]
back to top
BLAST of Splicing factor 45 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038359.10.000e+0100.00SMESG000038359.1[more]
SMESG000046155.19.276e-1441.18SMESG000046155.1[more]
SMESG000046155.19.382e-1441.18SMESG000046155.1[more]
SMESG000078029.18.086e-933.33SMESG000078029.1[more]
SMESG000018652.11.355e-732.65SMESG000018652.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012275 ID=SMED30012275|Name=Splicing factor 45|organism=Schmidtea mediterranea sexual|type=transcript|length=1435bp
AATATATTATTTTAAAAGTAAAAATTGCTTGATTGAACTTTTAATTTTCA
TTTCTTATGTCCTTGTATGATTTTGACGATGTTGGTAAATCGAAAAATGT
TTCATGGAGTGGTGGATTAACACCATCTATTAACCTTATGCAATCACATG
TAAATAAACTTCAAAGAAATTCTAAAAAGCAAATACAACAGCCAGTAACT
TCTAAACTGCCTCCAGTAGTTGATTTGAAGAAAACCATAGGAGAAGGTGA
ATATAGATTTAATCATTTAACTGGTAAAATGGAAAAATTTAATCCAGTTT
CTAATGAATCTCAAGAATTTGTTGATATAGCATTTGATGATCCTATACTT
CGATTGGGGGTTAAGGATGAGTATAATCCTCTTATGCCTAATGATTATGA
ACAAATATCTAAAATTTTAAGAGATAAAAGAAAATTAGATGAAAAAAAAA
AAGAAGATGAAATTAGAAAAGCTGATTCTAAATATTTAAAATATGATGGT
GTTGAAGAAACTAATGATGACGATATTGCTTCACGAGTTGAAAAACGCAC
CTCGGATAAATCCAGATTAGTTGGGACTGCAATTGCGCCTCCGCCGAGTT
TGTTAGAGGATTGTACAATTATGTCTGGAAATGATATTGAAATACCAGTT
TTGCCAGAATGTGACGAAAATGATGGAAATTGGGATGCAGTTGCAATAGC
AGCTACTCAGGCGAAATACGGAACAACAAGTGCAGCAGCAAAGATAATGG
TTAAAATGGGTTTTAAAGAAGGTAAAGGCCTTGGCAAAGAAGGTCAAGGA
ATGTCAACTGCTTTACAAGTTGAAAGAACTAGTCGCCGTGGGGGGAAAAT
TATTCACGAAAAGGATCTTCTACAACAGCAATTAGCTGTGCAACAAGCCG
CGTTAAAAATCCAATCTCTTATTTCCGATCGTGTGAGCAATGTAATTTTA
TTGCGAAATATGGTTGGCCCAGGAGAAGTGGACGATGATTTGCAGTCAGA
AACTGCCGAGGAGTGCAGTAAATATGGCAAGGTGGTCACCTGTATGATAT
TTGAACTACAAGATGTACCGGATGATCAAGCCGTGAGAATTTTTGTCGAG
TTTGTTGATGTTGAATCTGCCTATCGGGCCGTTGTTGATACTAATGGCCG
ATATTTTGGTGGCAGGATTGTTTCGGCCGGTTATTATGATTCGGAAAAAT
TCAAAAATCTTGAGCTTTGTGAAGATCCGTGGACTTTTCATGAATGATTA
TTTGTTGAATTTTACTGTATTTGCTTGTCGTTCCACTTCGGTTTCTGGCA
ATTAAAGAAGCAACGCAATGACGATATCTGGAGGAATTTGTTTATTTATT
TAGATTGATAAATTTGAAATGTGCTTTTTAATTTTTATATATCGCAAAAT
GGATTTTTGATTGCAAATAAAATTACTGTCTTGTC
back to top

protein sequence of SMED30012275-orf-1

>SMED30012275-orf-1 ID=SMED30012275-orf-1|Name=SMED30012275-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=397bp
MSLYDFDDVGKSKNVSWSGGLTPSINLMQSHVNKLQRNSKKQIQQPVTSK
LPPVVDLKKTIGEGEYRFNHLTGKMEKFNPVSNESQEFVDIAFDDPILRL
GVKDEYNPLMPNDYEQISKILRDKRKLDEKKKEDEIRKADSKYLKYDGVE
ETNDDDIASRVEKRTSDKSRLVGTAIAPPPSLLEDCTIMSGNDIEIPVLP
ECDENDGNWDAVAIAATQAKYGTTSAAAKIMVKMGFKEGKGLGKEGQGMS
TALQVERTSRRGGKIIHEKDLLQQQLAVQQAALKIQSLISDRVSNVILLR
NMVGPGEVDDDLQSETAEECSKYGKVVTCMIFELQDVPDDQAVRIFVEFV
DVESAYRAVVDTNGRYFGGRIVSAGYYDSEKFKNLELCEDPWTFHE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0043484regulation of RNA splicing
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR040052RBM17
IPR034653SPF45_RRM
IPR035979RBD_domain_sf
IPR000467G_patch_dom
IPR003954RRM_dom_euk
IPR016967Splicing_factor_SPF45
IPR012677Nucleotide-bd_a/b_plait_sf
IPR000504RRM_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003954RNA recognition motif domain, eukaryoteSMARTSM00361rrm2_1coord: 108..187
e-value: 7.6E-19
score: 78.6
IPR000467G-patch domainSMARTSM00443G-patch_5coord: 33..79
e-value: 1.5E-10
score: 51.1
IPR000467G-patch domainPFAMPF01585G-patchcoord: 36..76
e-value: 1.7E-12
score: 47.0
IPR000467G-patch domainPROSITEPS50174G_PATCHcoord: 35..75
score: 12.442
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 106..190
e-value: 4.7E-25
score: 89.4
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 132..184
e-value: 9.8E-5
score: 22.1
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 107..191
score: 8.962
IPR040052Splicing factor 45PIRSFPIRSF031066SPF45coord: 6..205
e-value: 2.8E-80
score: 268.3
IPR040052Splicing factor 45PANTHERPTHR13288SPLICING FACTOR 45 SPF45coord: 27..199
IPR034653SPF45, RNA recognition motifCDDcd12647RRM_UHM_SPF45coord: 106..199
e-value: 1.12699E-53
score: 165.138
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 111..194