Multiple inositol polyphosphate phosphatase 1

Overview
NameMultiple inositol polyphosphate phosphatase 1
Smed IDSMED30012274
Length (bp)1695
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Multiple inositol polyphosphate phosphatase 1 (SMED30012274) t-SNE clustered cells

Violin plots show distribution of expression levels for Multiple inositol polyphosphate phosphatase 1 (SMED30012274) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Multiple inositol polyphosphate phosphatase 1 (SMED30012274) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Multiple inositol polyphosphate phosphatase 1 (SMED30012274) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012274

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30012274h1SMcG0020708 dd_Smed_v4_3347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012274h1SMcG0020708 dd_Smed_v4_3347_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Human
Match: MINPP1 (multiple inositol-polyphosphate phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:7102])

HSP 1 Score: 146.362 bits (368), Expect = 2.071e-37
Identity = 125/478 (26.15%), Postives = 200/478 (41.84%), Query Frame = 2
Query:  158 FSSKTAYR--NSKLIEFKEST----NYLE-KCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKI---------SKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAF-------LNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNGQSHISI-ELLMKHLK 1519
            F +KT Y   N  L+   E+       LE  C  +Q+  + RHGTR+P+ K + K+  +   +         + S G   L  +L +W   ++     +L   G ++M  L  R  +   A+    N   ++++ TSS  R   S+A FL+         L             T ND  +RFFD C  + T V KN  +      +  GPE++ ++K +    ++   +L  D ++  F  C +++A                   G+              SP C + + D   VLEYL DLK YW + YG  IN    C L   I   +  A    Q     + P                      FGHAET+LP+++L+G F    P+TA  Y K++       HR   FR+  I+P++ N+   L+HC + ++     +RVQ+ +NEK +  P++  Q  +S  E L  H K
Sbjct:   47 FGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENY-GRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIK-----------------GV-------------KSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSP------------------VILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQM-------HR--KFRSGLIVPYASNLIFVLYHCEN-AKTPKEQFRVQMLLNEKVL--PLAYSQETVSFYEDLKNHYK 463          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Human
Match: MINPP1 (multiple inositol-polyphosphate phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:7102])

HSP 1 Score: 122.865 bits (307), Expect = 8.989e-31
Identity = 84/302 (27.81%), Postives = 131/302 (43.38%), Query Frame = 2
Query:  617 NDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNGQSHISI-ELLMKHLK 1519
            ND  +RFFD C  + T V KN  +      +  GPE++ ++K +    ++   +L  D ++  F  C +++A                   G+              SP C + + D   VLEYL DLK YW + YG  IN    C L   I   +  A    Q     + P                      FGHAET+LP+++L+G F    P+TA  Y K++       HR   FR+  I+P++ N+   L+HC + ++     +RVQ+ +NEK +  P++  Q  +S  E L  H K
Sbjct:   21 NDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIK-----------------GV-------------KSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSP------------------VILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQM-------HR--KFRSGLIVPYASNLIFVLYHCEN-AKTPKEQFRVQMLLNEKVL--PLAYSQETVSFYEDLKNHYK 262          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Human
Match: MINPP1 (multiple inositol-polyphosphate phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:7102])

HSP 1 Score: 65.855 bits (159), Expect = 4.082e-11
Identity = 56/220 (25.45%), Postives = 93/220 (42.27%), Query Frame = 2
Query:  158 FSSKTAYR--NSKLIEFKEST----NYLEK-CNLLQINTIFRHGTRFPSAKDMDKIDSVMKKI---------SKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAF-------LNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDI 748
            F +KT Y   N  L+   E+       LE  C  +Q+  + RHGTR+P+ K + K+  +   +         + S G   L  +L +W   ++     +L   G ++M  L  R  +   A+    N   ++++ TSS  R   S+A FL+         L             T ND  +RFFD C  + T V KN  +      +  GPE++ ++K +
Sbjct:   47 FGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENY-GRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKV 265          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Fly
Match: Mipp2 (gene:FBgn0026060 transcript:FBtr0070884)

HSP 1 Score: 93.9745 bits (232), Expect = 4.000e-20
Identity = 112/499 (22.44%), Postives = 198/499 (39.68%), Query Frame = 2
Query:   95 VGICKVEDFKEAVLQSSDL-NTFSSKTAYRNSKLIEFKESTNYLEKCNLLQINTIFRHGTRFPSA----KDMDKIDSVMKKISKSHGRSILPLSLQ-----NWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTY-SKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNGQSHISIELLMKHLKFCQADKYDHNAIC 1558
            VG+   E+ +   L  +D+    S+KT YR   +  + E+      C+  +I TI RHGTR PS     +  +++  + K+I       I    L+     +W +  +    K L + G +E++ L  R + R   ++      +      ++  R+  SA +F        +            D  LRF+  C  + T V KN  + +   R+   P+++  ++ ++   +L D++  P+DV+ ++ +C +E A     + RP     S +    V C F    AA E               LE+  DL++YW   YG E+     C  ++ +   I S+  T                      +Q    AT +F H+ T+L ++A LGL   + P+T K + S+RL            +RTS I  F+ N+    + C      D    +V V   E+ V  P       +     ++ +     D  D   +C
Sbjct:   17 VGVTLSEEGECRRLNRADIEGRLSTKTPYR--AIANYDETPPKYAGCHPTRIWTIIRHGTRNPSESVILQAQNRLSEIKKRILDQTKPPICTAELEKLRQWHWMHLNATEDEKLLVAEGEDELIELAERMQRRFPDLLPELYNPEWYYFKYTATQRTLKSAESFATGLFGRHRIHTVRYPPPLHEDPVLRFYKGCGKWKTDVDKNPETLVNARRFLAEPQMQSAVEQVRSSTRLPDLQ--PEDVQLMYTVCAFETA-----WHRPRHDSGSKSSYESVWCNF-FDVAALE--------------ALEFFEDLEYYWNDGYGYELTHRIACPAIADMFAAISSSEET----------------------RQRRANATLYFTHSGTLLKLLAHLGLARDNKPLTHKHFASERL------------WRTSQIDAFATNLAFLRYDC------DKGNPQVLVLHQERVVRLPGCPQDKDLCPLATLRRIYANSVDHCDREKMC 451          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Zebrafish
Match: minpp1b (multiple inositol-polyphosphate phosphatase 1b [Source:ZFIN;Acc:ZDB-GENE-040426-888])

HSP 1 Score: 146.747 bits (369), Expect = 5.181e-38
Identity = 108/418 (25.84%), Postives = 176/418 (42.11%), Query Frame = 2
Query:  230 CNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGRSILPL--SLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNL-LKQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISN 1474
            C  + + ++ RHGTR+P+ K++ KI  +   +     RS       L+ WK  +++     L   G ++   L  R       +I   +L   +I+  TSS  R   S   F    L+    ++++      +D+ +R+FD C  +   V  NK +  E  R+ +  E+  V + I  + ++    +  D   A F +C YE A                                 E SP C LL+     VLEY  DLK YW + YG +IN    C L   I  ++ +AA+ H+      G    T              AT   GH ET+LP+++L+G F    P+T++ ++ +         R   FR+S I+P++ NV   L+ C         G RVQ+ +NEK + +P  N
Sbjct:   68 CRAIHMVSVIRHGTRYPTTKNVRKIAQLFDLVKSDSLRSASSWLNDLKTWKMWYTEDMDGRLVEKGRDDHRHLAMRLAKSFPTLISADHLRANRIEFMTSSKHRCVDSVKAFQEG-LHRLWDVQDMDYQHYVDDSLMRYFDHCEKFVEGVENNKTALKEVQRFKSSSEMDSVRRKISSRLQIPYDRITADMAEAAFFLCSYEFAIK------------------------------SEYSPWCELLDESDAQVLEYKNDLKQYWKRGYGHDINRKSSCPLFHDIFSRLDNAAKDHR-----FGEVKKT--------------ATIQVGHGETLLPLLSLMGFFKDEKPLTSENFALQ---------RKRVFRSSKILPYAANVVFVLYECS-------DGLRVQLFLNEKPMIFPSMN 419          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Zebrafish
Match: minpp1a (multiple inositol-polyphosphate phosphatase 1a [Source:ZFIN;Acc:ZDB-GENE-060929-1194])

HSP 1 Score: 137.117 bits (344), Expect = 1.400e-34
Identity = 113/419 (26.97%), Postives = 182/419 (43.44%), Query Frame = 2
Query:  227 KCNLLQINTIFRHGTRFPSAKDMDKIDSV--MKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNL-LKQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPI---LDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWP 1465
            KC+ + +  I RHGTRFP+ K++ K+     + K++ +   + L      WK  +S      L   G E+   L  R      +++   N+  K++K+ TSS  R   S   F R  L     +  +      ND  +R+FD+C  +   V  NK++  E  R++ GPE++RV++ + ++  +    +  D V A F +C YE A                      +   N        SP C L +     V+EY  DLK YW ++YG  IN    C L   +   LDQI+         + S  P T                 T   GHAET++P++ LL LF    P+ +  +       +  Q+R   FR+  I P++ N+ + L+ CP        G R+ V++NEK++T P
Sbjct:   75 KCSEIHLTAIIRHGTRFPTTKNIQKMREFYDLVKLNATGDLTSLSEIKSQWKMWYSDEMDGRLVEKGREDHKHLAQRLIKWFPSLLNGENVHGKRVKLITSSKHRCVNSTIAF-REGLMTGLKITAVELEPELNDALMRYFDQCERFVKEVENNKSALEEVKRFNEGPEMKRVMEKMADRLDVPYSSINDDSVEAAFYLCAYEFA----------------------ILSVN--------SPWCQLFDEVDAQVMEYSNDLKQYWKRSYGHVINSKSSCILFHDLFHRLDQIVDQ-------INSDVPVTEA--------------VTVQVGHAETLIPLLTLLDLFKDDVPLNSTNF-------NTQQNR--VFRSGRITPYAANLLVVLYRCPE-------GIRIGVRLNEKSLTLP 425          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Zebrafish
Match: minpp1a (multiple inositol-polyphosphate phosphatase 1a [Source:ZFIN;Acc:ZDB-GENE-060929-1194])

HSP 1 Score: 137.117 bits (344), Expect = 1.400e-34
Identity = 113/419 (26.97%), Postives = 182/419 (43.44%), Query Frame = 2
Query:  227 KCNLLQINTIFRHGTRFPSAKDMDKIDSV--MKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNL-LKQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPI---LDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWP 1465
            KC+ + +  I RHGTRFP+ K++ K+     + K++ +   + L      WK  +S      L   G E+   L  R      +++   N+  K++K+ TSS  R   S   F R  L     +  +      ND  +R+FD+C  +   V  NK++  E  R++ GPE++RV++ + ++  +    +  D V A F +C YE A                      +   N        SP C L +     V+EY  DLK YW ++YG  IN    C L   +   LDQI+         + S  P T                 T   GHAET++P++ LL LF    P+ +  +       +  Q+R   FR+  I P++ N+ + L+ CP        G R+ V++NEK++T P
Sbjct:   75 KCSEIHLTAIIRHGTRFPTTKNIQKMREFYDLVKLNATGDLTSLSEIKSQWKMWYSDEMDGRLVEKGREDHKHLAQRLIKWFPSLLNGENVHGKRVKLITSSKHRCVNSTIAF-REGLMTGLKITAVELEPELNDALMRYFDQCERFVKEVENNKSALEEVKRFNEGPEMKRVMEKMADRLDVPYSSINDDSVEAAFYLCAYEFA----------------------ILSVN--------SPWCQLFDEVDAQVMEYSNDLKQYWKRSYGHVINSKSSCILFHDLFHRLDQIVDQ-------INSDVPVTEA--------------VTVQVGHAETLIPLLTLLDLFKDDVPLNSTNF-------NTQQNR--VFRSGRITPYAANLLVVLYRCPE-------GIRIGVRLNEKSLTLP 425          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Zebrafish
Match: minpp1a (multiple inositol-polyphosphate phosphatase 1a [Source:ZFIN;Acc:ZDB-GENE-060929-1194])

HSP 1 Score: 134.035 bits (336), Expect = 1.703e-33
Identity = 112/419 (26.73%), Postives = 181/419 (43.20%), Query Frame = 2
Query:  227 KCNLLQINTIFRHGTRFPSAKDMDKIDSV--MKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNL-LKQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPI---LDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWP 1465
            KC+ + +  I RHGTRFP+ K++ K+     + K++ +   + L      WK  +S      L   G E+   L  R      +++   N+  K++K+ TSS  R   S   F R  L     +  +      ND  +R+FD+C  +   V  NK++  E   ++ GPE++RV++ + ++  +    +  D V A F +C YE A                      +   N        SP C L +     V+EY  DLK YW ++YG  IN    C L   +   LDQI+         + S  P T                 T   GHAET++P++ LL LF    P+ +  +       +  Q+R   FR+  I P++ N+ + L+ CP        G R+ V++NEK++T P
Sbjct:   75 KCSEIHLTAIIRHGTRFPTTKNIQKMREFYDLVKLNATGDLTSLSEIKSQWKMWYSDEMDGRLVEKGREDHKHLAQRLIKWFPSLLNGENVHGKRVKLITSSKHRCVNSTIAF-REGLMTGLKITAVELEPELNDALMRYFDQCERFVKEVENNKSALEEVKLFNEGPEMKRVMEKMADRLDVPYSSINDDSVEAAFYLCAYEFA----------------------ILSVN--------SPWCQLFDEVDAQVMEYSNDLKQYWKRSYGHVINSKSSCILFHDLFHRLDQIVDQ-------INSDVPVTEA--------------VTVQVGHAETLIPLLTLLDLFKDDVPLNSTNF-------NTQQNR--VFRSGRITPYAANLLVVLYRCPE-------GIRIGVRLNEKSLTLP 425          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Zebrafish
Match: minpp1b (multiple inositol-polyphosphate phosphatase 1b [Source:ZFIN;Acc:ZDB-GENE-040426-888])

HSP 1 Score: 122.094 bits (305), Expect = 6.880e-31
Identity = 79/286 (27.62%), Postives = 122/286 (42.66%), Query Frame = 2
Query:  617 NDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISN 1474
            +D+ +R+FD C  +   V  NK +  E  R+ +  E+  V + I  + ++    +  D   A F +C YE A                                 E SP C LL+     VLEY  DLK YW + YG +IN    C L   I  ++ +AA+ H+      G    T              AT   GH ET+LP+++L+G F    P+T++ ++ +         R   FR+S I+P++ NV   L+ C         G RVQ+ +NEK + +P  N
Sbjct:    8 DDSLMRYFDHCEKFVEGVENNKTALKEVQRFKSSSEMDSVRRKISSRLQIPYDRITADMAEAAFFLCSYEFAIK------------------------------SEYSPWCELLDESDAQVLEYKNDLKQYWKRGYGHDINRKSSCPLFHDIFSRLDNAAKDHR-----FGEVKKT--------------ATIQVGHGETLLPLLSLMGFFKDEKPLTSENFALQ---------RKRVFRSSKILPYAANVVFVLYECS-------DGLRVQLFLNEKPMIFPSMN 228          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Xenopus
Match: MINPP1 (multiple inositol-polyphosphate phosphatase 1 [Source:NCBI gene;Acc:100493648])

HSP 1 Score: 134.806 bits (338), Expect = 1.533e-33
Identity = 115/429 (26.81%), Postives = 193/429 (44.99%), Query Frame = 2
Query:  230 CNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHG-RSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQ--IKVYTSSLTRSKMSAATFLRAFLN---------XXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIAT-NLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNG 1477
            C  ++I ++ RHGTR+P+ K + K+  +   I +  G RS L   LQ W   +      +L   G ++M  L  R  A L   +   + LKQ  +   TSS  R   S  +F+   ++         E++           ND+ +RFFD CP +   V  N  +  E  ++   PE+R+VI  I     + +++L+ D ++  F +C +E+A  N++                               SP C L +++   VLEYL DLK YW + +G +IN    C L   I   + +A    +S  + + P                      FGHAET+LP++ALLGLF    P+TA+ +      IS  + +   FR+ +I+P++ N+   L  C  +++     Y+VQ+ +NE+ + +P S+ 
Sbjct:   76 CTPIKIVSVIRHGTRYPTHKQIKKMKKMHDLIVRQEGIRSELVEELQRWDMWYEDWMDGQLVKKGEQDMSNLAYRL-ASLFPSLFTKDRLKQNNMTFTTSSKHRCVDSTKSFISGLVHDYFGFPQAPESELKDLPYMEPVINDHLMRFFDHCPKFLAEVEDNDTALHEVDKFKQSPEMRKVINKIATLLDVPELDLSADLIQMAFFICSFELAIKNITD------------------------------SPWCNLFDQEDARVLEYLNDLKQYWKRGHGYDINSRSSCHLFQHIFQHLEAAVTESKSSQQVSMP------------------VVMQFGHAETLLPLLALLGLFKDETPLTAENF------ISQSERK---FRSGHIVPYASNLAFVLHRC-DMAETPRERYQVQLLLNEQLLHFPHSHN 445          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Mouse
Match: Minpp1 (multiple inositol polyphosphate histidine phosphatase 1 [Source:MGI Symbol;Acc:MGI:1336159])

HSP 1 Score: 142.895 bits (359), Expect = 1.820e-36
Identity = 111/451 (24.61%), Postives = 191/451 (42.35%), Query Frame = 2
Query:  230 CNLLQINTIFRHGTRFPSAKDMDKI---DSVMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAF-------LNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNGQSHISI-ELLMKH----LKFCQADK 1537
            C  +Q+  + RHGTR+P+ K + K+     +++      G S +  +L  W   +      +L   G ++M  L  R  A    +    N   ++++ TSS  R   S+A FL+         L               ND  +RFFD C  + T V +N+ +      +  GPE+++V+K +    ++    L  D ++  F  C +++A                   G+              SP C + + D   VLEYL DLK YW ++YG  IN    C L   I   +  A    Q     + P                      FGHAET+LP+++L+G F    P+TA  + ++++           FR+ +I+P++ N+   L+HC + +Q     +++Q+ +NEK +  P+++ Q  + + E L  H    L+ CQ  K
Sbjct:   78 CTPVQLVALIRHGTRYPTTKQIRKLKQLQGLLQTRESRDGGSQVAAALAEWPLWYGDWMDGQLVEKGRQDMRQLALRLAALFPDLFSRENY-DRLRLITSSKHRCVDSSAAFLQGLWQHYHPGLPPPDVSDMECGPPRINDKLMRFFDHCEKFLTDVERNETALYHVEAFKTGPEMQKVLKKVAATLQVPMNSLNADLIQVAFFTCSFDLAIK-----------------GV-------------HSPWCDVFDVDDARVLEYLNDLKQYWKRSYGYTINSRSSCNLFQDIFLHLDKAVEQKQRSQPVSSP------------------VILQFGHAETLLPLLSLMGYFKDKEPLTAYNFEEQVN---------RKFRSGHIVPYASNLIFVLYHCDN-AQSPEEQFQIQLLLNEKVL--PLAHSQRPVGLYEELKTHYRDILQSCQTSK 467          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. UniProt/SwissProt
Match: sp|F1NPQ2|MINP1_CHICK (Multiple inositol polyphosphate phosphatase 1 OS=Gallus gallus OX=9031 GN=MINPP1 PE=1 SV=3)

HSP 1 Score: 149.443 bits (376), Expect = 3.543e-38
Identity = 111/415 (26.75%), Postives = 175/415 (42.17%), Query Frame = 2
Query:  230 CNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISN 1474
            C  LQ+  + RHGTR+P+A  + ++  +  ++ ++   S    +       + +     LA  G  +M  L  R  AR  A+       +++ + +SS  R   S A F R  L  + +L      I  ND  +RFFD C  +   V  N  +  +   +  GPE+R+V++ +     L   EL  D V+  F+ C YE+A                                  TSP C L   +   VLEYL DLK YW + YG +IN    C L   I  Q+  A    +S    + P                       GHAET+ P++AL+G F  + P+ A  Y ++        HR   FR+  I+P++ N+   L+HC   +  +   Y+VQ+ +NEK + +  SN
Sbjct:   58 CAPLQLRAVLRHGTRYPTAGQIRRLAELHGRLRRAAAPSCPAAAALAAWPMWYEESLDRLAPRGRRDMEHLARRLAARFPALFAAR---RRLALASSSKHRCLQSGAAFRRG-LGPSLSLGADETEIEVNDALMRFFDHCDKFVAFVEDNDTAMYQVNAFKEGPEMRKVLEKVASALCLPASELNADLVQVAFLTCSYELAIK------------------------------NVTSPWCSLFSEEDAKVLEYLNDLKQYWKRGYGYDINSRSSCILFQDIFQQLDKAVDESRSSKPISSP------------------LIVQVGHAETLQPLLALMGYFKDAEPLQANNYIRQ-------AHR--KFRSGRIVPYAANLVFVLYHCEQKTSKE--EYQVQMLLNEKPMLFHHSN 409          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. UniProt/SwissProt
Match: sp|Q9UNW1|MINP1_HUMAN (Multiple inositol polyphosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=MINPP1 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 9.946e-37
Identity = 125/478 (26.15%), Postives = 200/478 (41.84%), Query Frame = 2
Query:  158 FSSKTAYR--NSKLIEFKEST----NYLE-KCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKI---------SKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAF-------LNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNGQSHISI-ELLMKHLK 1519
            F +KT Y   N  L+   E+       LE  C  +Q+  + RHGTR+P+ K + K+  +   +         + S G   L  +L +W   ++     +L   G ++M  L  R  +   A+    N   ++++ TSS  R   S+A FL+         L             T ND  +RFFD C  + T V KN  +      +  GPE++ ++K +    ++   +L  D ++  F  C +++A                   G+              SP C + + D   VLEYL DLK YW + YG  IN    C L   I   +  A    Q     + P                      FGHAET+LP+++L+G F    P+TA  Y K++       HR   FR+  I+P++ N+   L+HC + ++     +RVQ+ +NEK +  P++  Q  +S  E L  H K
Sbjct:   47 FGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENY-GRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIK-----------------GV-------------KSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSP------------------VILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQM-------HR--KFRSGLIVPYASNLIFVLYHCEN-AKTPKEQFRVQMLLNEKVL--PLAYSQETVSFYEDLKNHYK 463          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. UniProt/SwissProt
Match: sp|Q5R890|MINP1_PONAB (Multiple inositol polyphosphate phosphatase 1 OS=Pongo abelii OX=9601 GN=MINPP1 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.373e-36
Identity = 119/468 (25.43%), Postives = 197/468 (42.09%), Query Frame = 2
Query:  167 KTAYRNSKLIEFKESTNYLEKCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKI---------SKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAF-------LNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNGQSHISI-ELLMKHLK 1519
            +  +R+ +L+E          C  +Q+  + RHGTR+P+AK + K+  +   +         + S G   L  +L +W   ++     +L   G ++M  L  R  +   A+    N   ++++ TSS  R   S+A FL+         L             T ND  +RFFD C  + T V KN  +      +  GPE++ ++K +    ++   +L  D ++  F  C +++A                   G+              SP C + + D   VLEYL DLK YW + YG  IN    C L   I   +  A    Q     + P                      FGHAET+LP+++L+G F    P+TA  Y +++       HR   FR+  I+P++ N+   L+HC + ++     +RVQ+ +NEK +  P++  Q  +S  E L  H K
Sbjct:   65 EAPWRDPELLE--------GSCTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQARGSRDGGAGSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENY-GRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLLQVAFFTCSFDLAIK-----------------GV-------------KSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFRHLDKAVEQKQRSQPISSP------------------VILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQM-------HR--KFRSGLIVPYASNLIFVLYHCEN-AKTPKEQFRVQMLLNEKVL--PLAYSQETVSFYEDLRNHYK 463          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. UniProt/SwissProt
Match: sp|Q9Z2L6|MINP1_MOUSE (Multiple inositol polyphosphate phosphatase 1 OS=Mus musculus OX=10090 GN=Minpp1 PE=1 SV=3)

HSP 1 Score: 142.895 bits (359), Expect = 1.273e-35
Identity = 111/451 (24.61%), Postives = 191/451 (42.35%), Query Frame = 2
Query:  230 CNLLQINTIFRHGTRFPSAKDMDKI---DSVMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAF-------LNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNGQSHISI-ELLMKH----LKFCQADK 1537
            C  +Q+  + RHGTR+P+ K + K+     +++      G S +  +L  W   +      +L   G ++M  L  R  A    +    N   ++++ TSS  R   S+A FL+         L               ND  +RFFD C  + T V +N+ +      +  GPE+++V+K +    ++    L  D ++  F  C +++A                   G+              SP C + + D   VLEYL DLK YW ++YG  IN    C L   I   +  A    Q     + P                      FGHAET+LP+++L+G F    P+TA  + ++++           FR+ +I+P++ N+   L+HC + +Q     +++Q+ +NEK +  P+++ Q  + + E L  H    L+ CQ  K
Sbjct:   78 CTPVQLVALIRHGTRYPTTKQIRKLKQLQGLLQTRESRDGGSQVAAALAEWPLWYGDWMDGQLVEKGRQDMRQLALRLAALFPDLFSRENY-DRLRLITSSKHRCVDSSAAFLQGLWQHYHPGLPPPDVSDMECGPPRINDKLMRFFDHCEKFLTDVERNETALYHVEAFKTGPEMQKVLKKVAATLQVPMNSLNADLIQVAFFTCSFDLAIK-----------------GV-------------HSPWCDVFDVDDARVLEYLNDLKQYWKRSYGYTINSRSSCNLFQDIFLHLDKAVEQKQRSQPVSSP------------------VILQFGHAETLLPLLSLMGYFKDKEPLTAYNFEEQVN---------RKFRSGHIVPYASNLIFVLYHCDN-AQSPEEQFQIQLLLNEKVL--PLAHSQRPVGLYEELKTHYRDILQSCQTSK 467          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. UniProt/SwissProt
Match: sp|O35217|MINP1_RAT (Multiple inositol polyphosphate phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Minpp1 PE=1 SV=3)

HSP 1 Score: 141.354 bits (355), Expect = 5.022e-35
Identity = 113/451 (25.06%), Postives = 193/451 (42.79%), Query Frame = 2
Query:  230 CNLLQINTIFRHGTRFPSAKDMDKI---DSVMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAF-------LNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNGQSHISI-ELLMKH----LKFCQADK 1537
            C  +Q+  + RHGTR+P+ K + K+     +++      G S +  +L  W   +      +L   G ++M  L  R  A    +    N   ++++ TSS  R   S+A FL+         L               ND  +RFFD C  + T V +N  +      +  GPE++ V+K +    ++    L  D ++  F  C +++A                   G+              SP C + + D   VLEYL DLK YW ++YG  IN    C L   I   +  A    Q     + P +++                  FGHAET+LP+++L+G F    P+TA  + +++       HR   FR+ +I+P++ N+   L+HC   +Q     +++Q+ +NEK +  P+++ Q  +++ E L  H    L+ CQ  K
Sbjct:   78 CTPVQLVALIRHGTRYPTTKQIRKLRQLQGLLQTRESVDGGSRVAAALDQWPLWYDDWMDGQLVEKGRQDMRQLALRLAALFPDLFCRENY-GRLRLITSSKHRCVDSSAAFLQGLWQHYHPGLPPPDVSDMECDPPRVNDKLMRFFDHCEKFLTEVERNATALYHVEAFKTGPEMQTVLKKVAATLQVPVNNLNADLIQVAFFTCSFDLAIQ-----------------GV-------------HSPWCDVFDVDDAKVLEYLNDLKQYWKRSYGYAINSRSSCNLFQDIFLHLDKAVEQKQ----RSQPVSSS--------------VILQFGHAETLLPLLSLMGYFKDKEPLTAYNFEEQV-------HR--EFRSGHIVPYASNLIFVLYHCED-AQTPQEKFQIQMLLNEKVL--PLAHSQKTVALYEDLKNHYQDILQSCQTSK 467          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. TrEMBL
Match: A0A3R7FR78 (Multiple inositol polyphosphate phosphatase 1 OS=Clonorchis sinensis OX=79923 GN=Minpp1 PE=3 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.372e-77
Identity = 166/525 (31.62%), Postives = 250/525 (47.62%), Query Frame = 2
Query:   83 LCAIVGICKVEDFKEAVLQSSDLNTFSSKTAYRNSKLIEFKEST-NYLEKCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXN-----------DNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAP------MTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPH----LSQDDLSGYRVQVKVNEKAVTWPI----------SNGQSHISIELLMKHLKFCQADKYDHNAICV 1561
            L  ++G+  +E       +  D + F++KTAYR+  L  F + T   L+ C L+ IN I+RHGTR PS+KD+ +I  +  ++  S G +ILP    ++  PF K   K L   G+EE+   G + R       R       I  YTSS +R+ +SA +F     N T       + I  +           DN LRFF  C  Y   + KNK + +EY ++ NG  ++ V+ ++  K  L   + +P DV  +F++CGYE+A                               + + SP C  L   H  V+EYL DLK YWTK+YG ++N++  C L++ I  QI  AA  ++                  L   N +RA+FWFGHAET+LP++A LGLFN S        + A  +   L  I  H    T FRT +I+PF GN+ LEL+HC      LS D L+G+ V  +VN+  + WP+          S G     +  +++HL+ C  + Y+ +  C 
Sbjct:    8 LILLLGVTCMEILDPNEHEKIDPSGFATKTAYRHCGLSSFDDGTLKRLDSCTLVHINAIYRHGTRAPSSKDVRRIIELRDRLISSQG-AILPSGFHDYLVPFEKGTDKALLPRGFEELYSFGRQVRNNNPTWFRRR---PNITFYTSSSSRAVLSARSFYHGLFNLTPITAVDAQGIERHLNSIPEGIQTVDNLLRFFQYCKQYQKEIRKNKTALVEYWKFMNGAVMKGVLDEVVSKHHLPKADFSPADVNVMFLICGYEVAA-----------------------------LSNDQSPWCGFLRAHHQLVMEYLLDLKQYWTKSYGFKLNYIHSCPLIAEIFLQIREAALNYKRS-------------NYNLSYPNLHRASFWFGHAETLLPVIAALGLFNDSVGHDHILRLYADGFENWLGKIRAHPPTHTMFRTGHIVPFGGNLVLELYHCADAVSSLSSDPLAGFFVLPRVNDHTIVWPLASPVQPPTAESPGAPFALLSTVLRHLETCMPNVYNDSKHCA 486          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. TrEMBL
Match: A0A4S2LW61 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004623 PE=3 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 2.685e-75
Identity = 165/525 (31.43%), Postives = 246/525 (46.86%), Query Frame = 2
Query:   83 LCAIVGICKVEDFKEAVLQSSDLNTFSSKTAYRNSKLIEFKEST-NYLEKCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXN-----------DNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAP------MTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQ----DDLSGYRVQVKVNEKAVTWPI----------SNGQSHISIELLMKHLKFCQADKYDHNAICV 1561
            L  ++G+  VE       +  D + F++KTAYR+  L  F + T   L+ C L+ IN I RHGTR PS+KD+ +I  +  ++  S G ++LP     +  PF +   K L   G+EE+   G R R       R       I  YTSS +R+ +SA +F     N T       + I  +           DN LRFF+ C  Y   + KNK + +EY ++ NG  V+ V+ ++  K  L   + +P DV  +F+ CGYE+A                               +   SP C  L   H  V+EYL DLK YWTK+YG ++N++  C L++ I  QI  AA  ++             H+   L   N +RA+FWFGHAET+LP++A LGLFN S        + A  +   L  I  H    T FRT +I+PF GN+ LEL+HC         D L+ + V  +VN+  + WP+          S G     +  +++HL+ C  + Y+ +  C 
Sbjct:   11 LILLLGVMCVEILDPNEHEKIDPSGFATKTAYRHCGLSSFDDGTLKRLDSCTLVHINAICRHGTRAPSSKDVRRISELRDRLISSQG-AVLPSGFHKYPVPFERGTDKALLPRGFEELYSFGRRVRNNNPTWFRRR---PNITFYTSSSSRAVLSARSFYHGLFNLTPISAVDAQGIERHLNSMPEGIQTVDNLLRFFEYCKQYQKEIRKNKTALVEYWKFMNGAVVKGVLDEVVSKHHLPKSDFSPADVNVMFLTCGYEVAA-----------------------------LSNGQSPWCGFLRAHHQLVMEYLLDLKQYWTKSYGFKLNYIHSCPLIAEIFLQIREAALNYKRS-----------HY--NLSHPNLHRASFWFGHAETLLPVIAALGLFNDSVGHDHIQRLYADRFENWLGKIRAHPPTHTMFRTGHIVPFGGNLVLELYHCADAVSPQYIDPLADFFVLPRVNDHTIVWPLGSPVQPPTAESPGAPFAQLSTVLRHLENCMPNVYNDSKHCA 489          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. TrEMBL
Match: A0A504Y8G6 (Multiple inositol polyphosphate phosphatase OS=Fasciola gigantica OX=46835 GN=FGIG_09825 PE=3 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 1.957e-71
Identity = 155/515 (30.10%), Postives = 238/515 (46.21%), Query Frame = 2
Query:  158 FSSKTAYRNSKLIEFKES-----TNYLEKCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXX-----------------------XXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAP------MTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHL----SQDDLSGYRVQVKVNEKAVTWPISN----------GQSHISIELLMKHLKFCQADKYDHNAIC 1558
            FS+KTAYR+  L  +K+         L  C ++ +N +FRHGTR PS KD  K  S+ +++  S+G   LP   ++   PF     K L   G+EE  +LG  FR+R++  ++    + +++ YTSS+ R+  S  +F   F                                    I E+D  LRFFD C  Y   +  NK+S  EY R+ +GPEVRRV + +  +  LT  E    DV  ++ +C +E+A   + F                          ++ SP C        P+ EY+ DLKHYW K+YG E+N++Q C L+  +L QI  AA  +++       A   P            +ATFWFGHAET+LP+VA LGLFN S        +TA  +    +    +    T FR+ +I PF+GN+ L+L+HCP+       D  SG+ V+  VN + V WP+            G +   ++ ++  L  C    ++ + +C
Sbjct:   34 FSTKTAYRHCSLRPYKDPLYMRPVQSLASCKMIHVNALFRHGTRSPSRKDTKKYKSLFERL-LSNGDIKLPKGFRDQPVPFENHTDKGLLPRGFEEHHLLGQLFRSRMDHHMKVD--MSKVQFYTSSVQRAIDSGRSFYHGFFGMPPLSSNYASNDCDSDGEPAKCPPPQIKAERYKSIQESDRLLRFFDHCKRYVEEIESNKSSVREYKRFRDGPEVRRVARGVMSRHLLTPTEFNESDVHLMYSVCSFEVAAETNPF--------------------------KQRSPWCDFFRPTDLPIYEYMADLKHYWLKSYGYELNYVQSCPLVGEMLSQIRQAAYLYKTSRSEDRSARRVP------------QATFWFGHAETLLPVVAALGLFNDSVGASELQHLTADGFEHWQAKRRMNPPSPTMFRSGHIAPFAGNLALQLYHCPNAVSIGVDDPWSGFFVEPLVNGQTVAWPLGGPVQPPTKEFPGATFAPLDTVLSRLGSCMPGTFEEDKVC 507          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. TrEMBL
Match: A0A095C4N9 (Multiple inositol polyphosphate phosphatase 1 OS=Schistosoma haematobium OX=6185 GN=MS3_05089 PE=3 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 9.690e-68
Identity = 159/489 (32.52%), Postives = 250/489 (51.12%), Query Frame = 2
Query:  161 SSKTAYRNSKLIEFKESTN-YLEKCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGR-SILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNL-LKQIKVYTSSLTRSKMSAATFLRAFLNXXXXXX-XXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSA------PMTAKTYSKRLSLISNHQ-HRFTTFRTSNIIPFSGNVGLELFHCPHL--SQDDLSGYRVQVKVNEKAVTWPISN----------GQSHISIELLMKHLKFCQADKYDHNAIC 1558
            SSKTAYR   L  +++  +   ++C+L+ +N + RHGTR P +K +     + +++ +S+   S +P  L     PF  + +KEL   G++E   LG RF    N + +  N  ++ +  Y+SS+ R   S     RAF NE         K IT N+  LRFF  C +Y  ++ KNK++  EY ++ N   +    ++  +++ L       DD++ +F+ C YE+A                A D              + SP C LL    +PV EYL DLKHYW K+YG E+N+ Q C L+  I+ QI + A   Q        + N P           +R +FWFGHAET+LPIVA LG+FN S        +TA ++ +RL +I +      T FRTS I PF+GNV   L++CP L  S +DL  +RV+V +NEK ++WP+++          G+++ S+  ++++   C  + YD+N +C
Sbjct:   31 SSKTAYRFCGLKSYEDKVSAQFKRCSLVHVNVLLRHGTRAPDSKSIKSFTDLHERLKESYNNGSPIPYKLLTHPIPFKNAAAKELLPRGFQEHDGLGRRF---FNLMRQHFNFTIENVDFYSSSIDRCIASG----RAFYNEINNNDHYKKKNITINNYLLRFFADCKNYIENIEKNKSAIREYYQFLNSNYIINSYENFIKRFNLKRENYTFDDLKIIFLACAYEVA----------------AMDDY-----------DDLSPWCSLLTPYDYPVWEYLADLKHYWRKSYGYELNYEQSCPLLGEIIQQIYNVAINFQ----KNNYSQNNPTL---------HRGSFWFGHAETILPIVAALGIFNNSIGHSTLHKLTADSFDERLRMIYDTDVPSPTMFRTSYIAPFAGNVAFLLYYCPDLEDSDNDLDKFRVKVLINEKTISWPLASSIQPPTLDHPGETNASLTTILQYFNGCMPNNYDNNKVC 472          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. TrEMBL
Match: A0A183QXT3 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=3 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 8.653e-64
Identity = 156/521 (29.94%), Postives = 243/521 (46.64%), Query Frame = 2
Query:  161 SSKTAYRNSKLIEFKESTNY-LEKCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGR-SILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRF----RARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAFLN-----------------------------XXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSA------PMTAKTYSKRLSLISNHQ-HRFTTFRTSNIIPFSGNVGLELFHCPHL--SQDDLSGYRVQVKVNEKAVTWPISN----------GQSHISIELLMKHLKFCQADKYDHNAICV 1561
            SSKTAYR   L  +++  +   ++C L+ +N +FRHGTR P +K +     + +++ +S+   S +P  L     PF  +  KEL   G++E   LG RF    R   +  I      + +  Y+SS+ R   S   F   F+N                                      K IT N+  LRFF  C +Y   +  NK++  EY ++     +    ++  +++ L       DD++ +F+ C YE+A      M  ++                      + SP C LL    +PV EYL DLKHYW K+YG E+N+ Q C L+  I+ QI + A   Q        + N P           +R +FWFGHAET+LPIVA LG+FN S        +TA  + +RL +I +      T FRTS I PF+GNV   L++CP L  S +DL  +RV+V +NEK + WP+S+          G+++ S+  ++++   C  + YD+N +C+
Sbjct:   31 SSKTAYRFCGLKSYEDKVSVQFKRCTLVHVNVLFRHGTRAPDSKSIKSFSDLYERLKESYNSGSPIPYKLLTHPIPFKNAAVKELLPRGFQEHDGLGRRFFNLMRQHFDFTI------ENVNFYSSSIDRCIASGRAFYNGFINGPTVKPIWNRTLYCGNEEVPNSCILNDELSEINNDHYKKNITINNYLLRFFADCKNYIEKIENNKSAIQEYYKFFKSNYIMNSYENFIKRFILKRENYKLDDLKTIFLACAYEVAA-----MDDYD----------------------DLSPWCSLLTPYDYPVWEYLADLKHYWRKSYGYELNYEQSCPLLGEIIQQIYNVAINFQ----KHNYSQNNPTL---------HRGSFWFGHAETILPIVAALGIFNNSVGHSTLHKLTADNFDERLKMIYDTDVPSPTMFRTSYIAPFAGNVAFLLYYCPDLEDSDNDLDKFRVKVLINEKTIAWPLSSSIQPPTLDHPGETNASLTTILQYFNGCMPNNYDNNKVCL 505          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Cavefish
Match: minpp1a (multiple inositol-polyphosphate phosphatase 1a [Source:ZFIN;Acc:ZDB-GENE-060929-1194])

HSP 1 Score: 162.925 bits (411), Expect = 6.018e-44
Identity = 113/416 (27.16%), Postives = 187/416 (44.95%), Query Frame = 2
Query:  230 CNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGR---SILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLL-KQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWP 1465
            C  + +  I RHGTRFP+A +++KI +++ K+ KS  +   S LP  L+ WKN +++  +  L + G  + + L  R       ++  SNLL K++K  TSS+ R   S   F +                T ND  +RFF  C     +VL NK + ++ T +  GPE+ +V + + ++ ++    +    V A + +C YE +                   GLV             +P C L +R    V++Y  DL  YW + YG E+N++  C L   + +++     T  +  KS  P +   + +               GHAET++P++ LLGLF     + A  +++ L       HR   F  S  +PF+ N+   L+ CP        G+R+Q +VNE  V  P
Sbjct:   64 CIPIHLTAIIRHGTRFPTAGNVEKI-AILDKLVKSEAKGDLSYLP-ELKAWKNWYTQETAGHLTAAGRGDQIHLAKRLVKTFPTLLTKSNLLNKRVKFITSSVPRCINSTLAFQQGLKESLSIPDNEEFKYTVNDTLMRFFASCERLLVTVLNNKEAVVQVTLFEEGPEMSKVHQRLSDQLQIPYANITLGSVEAAYYLCAYEFSI-----------------LGLV-------------TPWCKLFDRAEAQVMDYAGDLGLYWKRGYGHEVNYMSSCVLFHNLFNRL----ETSINQFKSGQPVSEVVNVQ--------------VGHAETLIPLMTLLGLFKGKISLDANNFAENL-------HR--PFNCSKNVPFAANLMAALWSCP-------DGFRLQFRVNENPVALP 413          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Cavefish
Match: minpp1a (multiple inositol-polyphosphate phosphatase 1a [Source:ZFIN;Acc:ZDB-GENE-060929-1194])

HSP 1 Score: 161.77 bits (408), Expect = 1.203e-43
Identity = 113/416 (27.16%), Postives = 187/416 (44.95%), Query Frame = 2
Query:  230 CNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGR---SILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLL-KQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWP 1465
            C  + +  I RHGTRFP+A +++KI +++ K+ KS  +   S LP  L+ WKN +++  +  L + G  + + L  R       ++  SNLL K++K  TSS+ R   S   F +                T ND  +RFF  C     +VL NK + ++ T +  GPE+ +V + + ++ ++    +    V A + +C YE +                   GLV             +P C L +R    V++Y  DL  YW + YG E+N++  C L   + +++     T  +  KS  P +   + +               GHAET++P++ LLGLF     + A  +++ L       HR   F  S  +PF+ N+   L+ CP        G+R+Q +VNE  V  P
Sbjct:   54 CIPIHLTAIIRHGTRFPTAGNVEKI-AILDKLVKSEAKGDLSYLP-ELKAWKNWYTQETAGHLTAAGRGDQIHLAKRLVKTFPTLLTKSNLLNKRVKFITSSVPRCINSTLAFQQGLKESLSIPDNEEFKYTVNDTLMRFFASCERLLVTVLNNKEAVVQVTLFEEGPEMSKVHQRLSDQLQIPYANITLGSVEAAYYLCAYEFSI-----------------LGLV-------------TPWCKLFDRAEAQVMDYAGDLGLYWKRGYGHEVNYMSSCVLFHNLFNRL----ETSINQFKSGQPVSEVVNVQ--------------VGHAETLIPLMTLLGLFKGKISLDANNFAENL-------HR--PFNCSKNVPFAANLMAALWSCP-------DGFRLQFRVNENPVALP 403          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Cavefish
Match: minpp1a (multiple inositol-polyphosphate phosphatase 1a [Source:ZFIN;Acc:ZDB-GENE-060929-1194])

HSP 1 Score: 156.762 bits (395), Expect = 1.179e-41
Identity = 114/423 (26.95%), Postives = 191/423 (45.15%), Query Frame = 2
Query:  230 CNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGR---SILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLL-KQIKVYTSSLTRSKMSAATFLRAFL-------NXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWP 1465
            C  + +  I RHGTRFP+A +++KI +++ K+ KS  +   S LP  L+ WKN +++  +  L + G  + + L  R       ++  SNLL K++K  TSS+ R   S   F +          N  +    + +L   ND  +RFF  C     +VL NK + ++ T +  GPE+ +V + + ++ ++    +    V A + +C YE +                   GLV             +P C L +R    V++Y  DL  YW + YG E+N++  C L   + +++     T  +  KS  P +   + +               GHAET++P++ LLGLF     + A  +++ L       HR   F  S  +PF+ N+   L+ CP        G+R+Q +VNE  V  P
Sbjct:   72 CIPIHLTAIIRHGTRFPTAGNVEKI-AILDKLVKSEAKGDLSYLP-ELKAWKNWYTQETAGHLTAAGRGDQIHLAKRLVKTFPTLLTKSNLLNKRVKFITSSVPRCINSTLAFQQGLKESLSIPGNLFRFSCRVHELKPVNDTLMRFFASCERLLVTVLNNKEAVVQVTLFEEGPEMSKVHQRLSDQLQIPYANITLGSVEAAYYLCAYEFSI-----------------LGLV-------------TPWCKLFDRAEAQVMDYAGDLGLYWKRGYGHEVNYMSSCVLFHNLFNRL----ETSINQFKSGQPVSEVVNVQ--------------VGHAETLIPLMTLLGLFKGKISLDANNFAENL-------HR--PFNCSKNVPFAANLMAALWSCP-------DGFRLQFRVNENPVALP 428          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Cavefish
Match: minpp1a (multiple inositol-polyphosphate phosphatase 1a [Source:ZFIN;Acc:ZDB-GENE-060929-1194])

HSP 1 Score: 153.68 bits (387), Expect = 1.327e-40
Identity = 110/416 (26.44%), Postives = 179/416 (43.03%), Query Frame = 2
Query:  230 CNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGR---SILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLL-KQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWP 1465
            C  + +  I RHGTRFP+A +++KI +++ K+ KS  +   S LP  L+ WKN +++  +  L + G  + + L  R       ++  SNLL K++K  TSS+ R   S   F +                T ND  +RFF  C     +VL NK + ++ T +  GPE+ +V + + ++ ++    +    + A + +C YE +                   GLV             +P C L +R    V++Y  DL  YW + YG E+N++  C L   +                      N   F +              GHAET++P++ LLGLF     + A  +++ L       HR   F  S  +PF+ N+   L+ CP        G+R+Q +VNE  V  P
Sbjct:   64 CIPIHLTAIIRHGTRFPTAGNVEKI-AILDKLVKSEAKGDLSYLP-ELKAWKNWYTQETAGHLTAAGRGDQIHLAKRLVKTFPTLLTKSNLLNKRVKFITSSVPRCINSTLAFQQGLKESLSIPDNEEFKYTVNDTLMRFFASCERLLVTVLNNKEAVVQVTLFEEGPEMSKVHQRLSDQLQIPYANITLGQLEAAYYLCAYEFSI-----------------LGLV-------------TPWCKLFDRAEAQVMDYAGDLGLYWKRGYGHEVNYMSSCVLFHNLF---------------------NLQPFNKDYSFPVSEVVNVQVGHAETLIPLMTLLGLFKGKISLDANNFAENL-------HR--PFNCSKNVPFAANLMAALWSCP-------DGFRLQFRVNENPVALP 410          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Cavefish
Match: minpp1a (multiple inositol-polyphosphate phosphatase 1a [Source:ZFIN;Acc:ZDB-GENE-060929-1194])

HSP 1 Score: 149.058 bits (375), Expect = 1.016e-38
Identity = 115/427 (26.93%), Postives = 192/427 (44.96%), Query Frame = 2
Query:  230 CNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGR---SILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLL-KQIKVYTSSLTRSKMSAATFLRAFL-------NXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKL--TDIELAPDDVRALFVM--CGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWP 1465
            C  + +  I RHGTRFP+A +++KI +++ K+ KS  +   S LP  L+ WKN +++  +  L + G  + + L  R       ++  SNLL K++K  TSS+ R   S   F +          N  +         T ND  +RFF  C     +VL NK + ++ T +  GPE+ +V + + ++ ++   +I L   D    +++  C Y +     S +            GLV             +P C L +R    V++Y  DL  YW + YG E+N++  C L   + +++     T  +  KS  P +   + +               GHAET++P++ LLGLF     + A  +++ L       HR   F  S  +PF+ N+   L+ CP        G+R+Q +VNE  V  P
Sbjct:   85 CIPIHLTAIIRHGTRFPTAGNVEKI-AILDKLVKSEAKGDLSYLP-ELKAWKNWYTQETAGHLTAAGRGDQIHLAKRLVKTFPTLLTKSNLLNKRVKFITSSVPRCINSTLAFQQGLKESLSIPGNLFRFSYNEEFKYTVNDTLMRFFASCERLLVTVLNNKEAVVQVTLFEEGPEMSKVHQRLSDQLQIPYANITLGQCDHCHFYLIEVCAYYLCAYEFSIL------------GLV-------------TPWCKLFDRAEAQVMDYAGDLGLYWKRGYGHEVNYMSSCVLFHNLFNRL----ETSINQFKSGQPVSEVVNVQ--------------VGHAETLIPLMTLLGLFKGKISLDANNFAENL-------HR--PFNCSKNVPFAANLMAALWSCP-------DGFRLQFRVNENPVALP 450          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Nematostella
Match: EDO48475 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIX6])

HSP 1 Score: 160.999 bits (406), Expect = 1.250e-43
Identity = 123/458 (26.86%), Postives = 192/458 (41.92%), Query Frame = 2
Query:  158 FSSKTAYRNSKLIEF--KESTNYLEKCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGRSILPLSLQNWKNP----FSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAFL-----------NXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELA-PDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNG 1477
            F+SKT Y    L E   KE       C+ + ++ + RHGTR PS +D+ KI    + I +    S  P+ + N   P    F+++  K+L  +G EE+  +  R + R   +     L ++I+  ++   RS  SA  F    L           +  K    +     +ND  LR+FD CP Y   V KNK S  E+  + N   +R V++ +++ + L   E+     V  +++ C +E+A                                  +   C +       VLEY YDLKHYW + YG +I +   C L+  I++ I +A  +                     D +N     F F HAET+ P+ ALLGLF    P+ A  Y         H+H+   +R S I PF  N+   +++C  L       Y++QV  NEK V+ P   G
Sbjct:   26 FASKTRYYEPNLEEDIKKEREG---GCSAVHMSLVARHGTRNPSKRDVKKIQRTTEAIDQLF--SGHPVKIGNLTIPSPSLFTENMDKDLIEIGREELYNMSRRVKQRYPELFNVEMLKEKIRFVSTRTARSIQSAHAFALGLLGRPLVPIAMVTDIDKDPITIETHDKDNDPVLRYFDVCPKYIHQVSKNKTSLYEHHEFKNSSAMRTVVEHVRDLFNLQGSEIIHVKHVIGMYLACTFEVAV------------------------------YNRSDSWCSVFRPSDLDVLEYFYDLKHYWKRGYGYKITYEISCVLLKNIINTIKTAVLS---------------------DNKNGPIGNFMFAHAETIQPLNALLGLFKDVMPLRADNY---------HRHKNRKYRASQISPFGANIAFTVYNCSGL-------YQIQVLSNEKIVSLPCCEG 411          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Nematostella
Match: EDO37606 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFD5])

HSP 1 Score: 82.0333 bits (201), Expect = 1.414e-17
Identity = 70/283 (24.73%), Postives = 113/283 (39.93%), Query Frame = 2
Query:  620 DNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKL-TDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWP 1465
            D  LR +  CP Y   V+  +   +E  +++ G E++RVI +++ +  +  + EL  + V  +F++C +    +                               +TS  C L E +   VLEY  D+  Y+   YG EI +   C L++ I       A+T +S  K   P                    F F H+  ++ + ++L L+    P+TA  Y K    +SN      TFR +   P S N+   L  C         GY+VQV VNE+    P
Sbjct:    5 DKVLRPYSMCPRYD-QVVDGRNGMLEPRKFAQGSEMQRVISNVKSRLGMPKNAELNVEVVEKMFMLCAFLTVND------------------------------NDTS-WCSLFEEEDLNVLEYYLDMWQYYEHGYGHEITYKSICPLVAEI-------AQTIKSFTKKKIP-----------------NGIFRFAHSGGIISLQSILSLYRDPIPLTAGNYHK----LSNR-----TFRIARNAPMSSNIAFVLHEC-------TDGYKVQVLVNERLTVLP 215          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Nematostella
Match: EDO25759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVK0])

HSP 1 Score: 50.0618 bits (118), Expect = 3.094e-7
Identity = 39/151 (25.83%), Postives = 66/151 (43.71%), Query Frame = 2
Query:  119 FKEAVLQSSDLNTFSSKTAYRNSKLIEFKESTNYLEKCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSH---GRSILPLSLQNWKNPFS-KSK-SKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATF 556
            F  AV  +  +  + SKT Y +  L E +        C  + IN + RHG R+PS+ D+    + ++K++  H   G  I       W  P S KSK S EL+  G  +   +  R+ AR  ++          +  +++  R+  S  +F
Sbjct:    7 FSLAVQAAYGIQPYGSKTPYNHGNLSEVETPPG----CKPVHINMLARHGERYPSSDDLKAFAAFLQKLNVLHNTTGPYIYKALTLPWTLPASYKSKLSSELSVAGERQHYGIARRYHARYPSVFSKQYWNADYEFVSTATLRTVQSGNSF 153          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Medaka
Match: minpp1b (multiple inositol polyphosphate phosphatase 1-like [Source:NCBI gene;Acc:101174333])

HSP 1 Score: 125.561 bits (314), Expect = 1.220e-30
Identity = 105/420 (25.00%), Postives = 179/420 (42.62%), Query Frame = 2
Query:  224 EKCNLLQINTIFRHGTRFPSAKDMDKIDS----VMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQ-IKVYTSSLTRSKMSAATFLRAFLNX-XXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWP 1465
            E+C+ + +  + RHG+R+P+ K++ +I+     V  + S++ G  +L L    W+  +++    +L + G EE+  L  R  +   +++   N+ K+ +   +SS  R   S   F          + +         D  +RFF++C  +   V  N+ + +E  ++ +G ++  V + I E   L    L PD + A F +C YE++                                   SP C L       VLEY  DLK YW +++G  I+ L  C L   +   +  A R  +S   +  P                  A+   GHAET+LP+++LLGL+    P TA  Y       S H     TFRTS I+P++ N+   L+ C         G R+Q+ +NE  + +P
Sbjct:   71 ERCSPVHLTAVIRHGSRYPTVKNVRRINRLSELVRTEASRAPGGWLLDLQ-SRWETWYTEDMDGQLVTKGREELQQLARRLASLFPSLLSEENVRKRRVSFVSSSKHRCVSSVEAFQEGLWQHWGPSGETPAYSHRVEDELMRFFERCRGFVEGVENNRTALLEVEKFKHGEQMEAVRRRIAEMLGLPFHRLTPDLLEAAFFLCSYELSIK------------------------------SLHSPWCFLFSETDAKVLEYKSDLKQYWKRSHGHAISSLASCPLFHHVFRTLDKAGRPRRSTEAAPEP------------------ASILVGHAETLLPLLSLLGLYKDETPPTASNYQ------SQHGR---TFRTSRIVPYAANLLFVLYDCQR-------GPRLQMLLNETPLRFP 425          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Medaka
Match: minpp1a (multiple inositol polyphosphate phosphatase 1 [Source:NCBI gene;Acc:101172268])

HSP 1 Score: 124.79 bits (312), Expect = 2.317e-30
Identity = 115/417 (27.58%), Postives = 183/417 (43.88%), Query Frame = 2
Query:  227 KCNLLQINTIFRHGTRFPSAKD---MDKIDSVMKKISKS-HGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLK-QIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTW 1462
            +C  + +  I RHGTR+P++K+   M K+  V+K  +K+ HG   L   L  W   +++     L   G E++  L  RF     ++I   NL   +I   TSS  R   S  +F +A L     +K++      ND  +RFF++C  +   V  N ++  E  ++  GPE++RV + I ++ ++    +  D   A F +C YE A                                 E SP C L +     V+EY  DLK +W + YG EIN    C L   +  ++  A     + +KS           QQ+ +      T   GHAET+LP++ LLG F  S  + +  ++      S  Q    +FRTS ++P++ N  L L+ C           R+Q  +NEK VT+
Sbjct:   73 QCRQIHMTAIIRHGTRYPTSKNARKMQKLYGVVKSDAKAKHG--WLQEILTRWTMWYTEDMDGRLVQKGVEDLRHLAVRFSKLFPSLISQENLRGGRITFITSSKHRCVNSTLSF-KAGLTHLWGIKDMEFDHAVNDALMRFFEQCSRFVEEVDNNPSAMTETDKFKQGPEMKRVQQKIADRLEVPYNLITDDMAEAAFYLCAYEFAIK------------------------------TENSPWCRLFDEADAQVMEYANDLKQFWKRGYGFEINSKASCVLFHDVFTRLEKAV----TEIKSG----------QQVSEA----VTIQVGHAETLLPLLTLLGFFKDSDALRSANFA------SQSQR---SFRTSLMLPYAANFVLVLYDCGG------GDIRLQPLLNEKPVTF 423          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Medaka
Match: minpp1b (multiple inositol polyphosphate phosphatase 1-like [Source:NCBI gene;Acc:101174333])

HSP 1 Score: 112.849 bits (281), Expect = 4.178e-26
Identity = 108/460 (23.48%), Postives = 182/460 (39.57%), Query Frame = 2
Query:  224 EKCNLLQINTIFRHGTRFPSAKDMDKIDS----VMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQ-IKVYTSSLTRSKMSAATFLRAFLNX-XXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHR--------------------------------------FT--TFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWP 1465
            E+C+ + +  + RHG+R+P+ K++ +I+     V  + S++ G  +L L    W+  +++    +L + G EE+  L  R  +   +++   N+ K+ +   +SS  R   S   F          + +         D  +RFF++C  +   V  N+ + +E  ++ +G ++  V + I E   L    L PD + A F +C YE++                                   SP C L       VLEY  DLK YW +++G  I+ L  C L   +   +  A R  +S   +  P                  A+   GHAET+LP+++LLGL+    P TA  Y       S H  R                                      FT  TFRTS I+P++ N+   L+ C         G R+Q+ +NE  + +P
Sbjct:   71 ERCSPVHLTAVIRHGSRYPTVKNVRRINRLSELVRTEASRAPGGWLLDLQ-SRWETWYTEDMDGQLVTKGREELQQLARRLASLFPSLLSEENVRKRRVSFVSSSKHRCVSSVEAFQEGLWQHWGPSGETPAYSHRVEDELMRFFERCRGFVEGVENNRTALLEVEKFKHGEQMEAVRRRIAEMLGLPFHRLTPDLLEAAFFLCSYELSIK------------------------------SLHSPWCFLFSETDAKVLEYKSDLKQYWKRSHGHAISSLASCPLFHHVFRTLDKAGRPRRSTEAAPEP------------------ASILVGHAETLLPLLSLLGLYKDETPPTASNYQ------SQHGKRNDGYRSVRDEELKSDPGSAESAGAFWIRTWESSLTRPVFTGRTFRTSRIVPYAANLLFVLYDCQR-------GPRLQMLLNETPLRFP 468          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Planmine SMEST
Match: SMESG000017263.1 (SMESG000017263.1)

HSP 1 Score: 1055.43 bits (2728), Expect = 0.000e+0
Identity = 518/519 (99.81%), Postives = 519/519 (100.00%), Query Frame = 2
Query:   59 MIFTFLFRLCAIVGICKVEDFKEAVLQSSDLNTFSSKTAYRNSKLIEFKESTNYLEKCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNGQSHISIELLMKHLKFCQADKYDHNAICVQGLSSAQLHQVRKRSDEL 1615
            MIFTFLFRLCAIVGICKVEDFKEAVLQSSDLNTFSSKTAYRNSKLIEFKESTNYLEKCNLLQINTIFRHGTRFPSAKDMDKID+VMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAFLNETKTLKELTKLITENDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNGQSHISIELLMKHLKFCQADKYDHNAICVQGLSSAQLHQVRKRSDEL
Sbjct:    1 MIFTFLFRLCAIVGICKVEDFKEAVLQSSDLNTFSSKTAYRNSKLIEFKESTNYLEKCNLLQINTIFRHGTRFPSAKDMDKIDNVMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAFLNETKTLKELTKLITENDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNGQSHISIELLMKHLKFCQADKYDHNAICVQGLSSAQLHQVRKRSDEL 519          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Planmine SMEST
Match: SMESG000073257.1 (SMESG000073257.1)

HSP 1 Score: 416.772 bits (1070), Expect = 7.853e-141
Identity = 216/494 (43.72%), Postives = 310/494 (62.75%), Query Frame = 2
Query:   77 FRLCAIVGICKVEDFKEAVLQSSDLNTFSSKTAYRNSKLIEFKESTNYLEKCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALFVMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLLERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQSVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQSAPMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQDDLSGYRVQVKVNEKAVTWPISNGQSHISIELLMKHLKFCQADKYDHNAIC 1558
            F  C I G+C V  +K  +   S L+ F+SKTAYRNS L E+ +S++ L +C L+  N +FRHGTRFPS+KD+  ++ +  K++ S  RS LP  L +WK PF ++K K+L +VG +EMM LG RFR  L   +    L   I+V+++S++RS+ S   FLR FLN +K+  ++ K+IT +D  LRFFD CP+Y   V KNK    EY ++  G E+R ++K +    +L D  L  +D+  ++ +CG+EIATN SS+M+P +CP++   +GLV C   H + + +TSP C L +   FPVLEYL+DLKHYWTK+YG  I  +  C LMS I  QIM A + H    KS+      P            +  FWF HAET+LP+VALLGLFNQ+ PMT++++  RL L+   ++RF  FRT+NI+PF+ N G+ +F+CPHLS    SGY+V++K+NEK V WP++N  SHIS+E     L  C    ++    C
Sbjct:    8 FVSCLIFGLC-VHQYKYRL---SYLSHFNSKTAYRNSNLTEYWQSSDPLGQCKLIHTNVVFRHGTRFPSSKDISNMEDLFHKLNNSKKRSNLPNDLLSWKMPFVRNKDKQLTAVGIQEMMGLGRRFRELLFNTLSQHQLQGNIQVFSTSVSRSRNSGNVFLRMFLNTSKSANDIDKMITIDDEHLRFFDGCPYYKIKVEKNKDMKREYNKFMKGREMRSLVKKVNRYIQLNDNPLTAEDLVVMYSLCGFEIATNSSSYMKPFQCPVN---NGLVRC--EHDYHSIQTSPHCSLFDERDFPVLEYLFDLKHYWTKSYGHSITSMMSCKLMSRINQQIMEAVQAH----KSSSTDIRFP------------KGIFWFSHAETILPLVALLGLFNQTIPMTSESFKNRLELVDKQKYRFALFRTANIVPFAANFGIHVFYCPHLSNGGSSGYQVRLKINEKTVPWPLTNHLSHISLEEFETRLLKCGPGSFNFTDQC 476          
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Planmine SMEST
Match: SMESG000073257.1 (SMESG000073257.1)

HSP 1 Score: 179.104 bits (453), Expect = 3.941e-52
Identity = 101/240 (42.08%), Postives = 149/240 (62.08%), Query Frame = 2
Query:   77 FRLCAIVGICKVEDFKEAVLQSSDLNTFSSKTAYRNSKLIEFKESTNYLEKCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGRSILPLSLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIKVYTSSLTRSKMSAATFLRAFLNXXXXXXXXXXXXXXNDNCLRFFDKCPHYTTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDV 796
            F  C I G+C V  +K  +   S L+ F+SKTAYRNS L E+ +S++ L +C L+  N +FRHGTRFPS+KD+  ++ +  K++ S  RS LP  L +WK PF ++K K+L +VG +EMM LG RFR  L   +    L   I+V+++S++RS+ S   FLR FLN +K+  ++ K+IT +D  LRFFD CP+Y   V KNK    EY ++  G E+R ++K +    +L D  L  D +
Sbjct:    8 FVSCLIFGLC-VHQYKYRL---SYLSHFNSKTAYRNSNLTEYWQSSDPLGQCKLIHTNVVFRHGTRFPSSKDISNMEDLFHKLNNSKKRSNLPNDLLSWKMPFVRNKDKQLTAVGIQEMMGLGRRFRELLFNTLSQHQLQGNIQVFSTSVSRSRNSGNVFLRMFLNTSKSANDIDKMITIDDEHLRFFDGCPYYKIKVEKNKDMKREYNKFMKGREMRSLVKKVNRYIQLNDNPLTADRI 243          
The following BLAST results are available for this feature:
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
MINPP12.071e-3726.15multiple inositol-polyphosphate phosphatase 1 [Sou... [more]
MINPP18.989e-3127.81multiple inositol-polyphosphate phosphatase 1 [Sou... [more]
MINPP14.082e-1125.45multiple inositol-polyphosphate phosphatase 1 [Sou... [more]
back to top
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mipp24.000e-2022.44gene:FBgn0026060 transcript:FBtr0070884[more]
back to top
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
minpp1b5.181e-3825.84multiple inositol-polyphosphate phosphatase 1b [So... [more]
minpp1a1.400e-3426.97multiple inositol-polyphosphate phosphatase 1a [So... [more]
minpp1a1.400e-3426.97multiple inositol-polyphosphate phosphatase 1a [So... [more]
minpp1a1.703e-3326.73multiple inositol-polyphosphate phosphatase 1a [So... [more]
minpp1b6.880e-3127.62multiple inositol-polyphosphate phosphatase 1b [So... [more]
back to top
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MINPP11.533e-3326.81multiple inositol-polyphosphate phosphatase 1 [Sou... [more]
back to top
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Minpp11.820e-3624.61multiple inositol polyphosphate histidine phosphat... [more]
back to top
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1NPQ2|MINP1_CHICK3.543e-3826.75Multiple inositol polyphosphate phosphatase 1 OS=G... [more]
sp|Q9UNW1|MINP1_HUMAN9.946e-3726.15Multiple inositol polyphosphate phosphatase 1 OS=H... [more]
sp|Q5R890|MINP1_PONAB2.373e-3625.43Multiple inositol polyphosphate phosphatase 1 OS=P... [more]
sp|Q9Z2L6|MINP1_MOUSE1.273e-3524.61Multiple inositol polyphosphate phosphatase 1 OS=M... [more]
sp|O35217|MINP1_RAT5.022e-3525.06Multiple inositol polyphosphate phosphatase 1 OS=R... [more]
back to top
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7FR781.372e-7731.62Multiple inositol polyphosphate phosphatase 1 OS=C... [more]
A0A4S2LW612.685e-7531.43Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A504Y8G61.957e-7130.10Multiple inositol polyphosphate phosphatase OS=Fas... [more]
A0A095C4N99.690e-6832.52Multiple inositol polyphosphate phosphatase 1 OS=S... [more]
A0A183QXT38.653e-6429.94Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
back to top
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
minpp1a6.018e-4427.16multiple inositol-polyphosphate phosphatase 1a [So... [more]
minpp1a1.203e-4327.16multiple inositol-polyphosphate phosphatase 1a [So... [more]
minpp1a1.179e-4126.95multiple inositol-polyphosphate phosphatase 1a [So... [more]
minpp1a1.327e-4026.44multiple inositol-polyphosphate phosphatase 1a [So... [more]
minpp1a1.016e-3826.93multiple inositol-polyphosphate phosphatase 1a [So... [more]
back to top
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO484751.250e-4326.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376061.414e-1724.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO257593.094e-725.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
minpp1b1.220e-3025.00multiple inositol polyphosphate phosphatase 1-like... [more]
minpp1a2.317e-3027.58multiple inositol polyphosphate phosphatase 1 [Sou... [more]
minpp1b4.178e-2623.48multiple inositol polyphosphate phosphatase 1-like... [more]
back to top
BLAST of Multiple inositol polyphosphate phosphatase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000017263.10.000e+099.81SMESG000017263.1[more]
SMESG000073257.17.853e-14143.72SMESG000073257.1[more]
SMESG000073257.13.941e-5242.08SMESG000073257.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012274 ID=SMED30012274|Name=Multiple inositol polyphosphate phosphatase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1695bp
TTTCAAAATTATAATTTTGCAATTATTATTTTAAAATTTTAATATTCTAT
TTTATTCAATGATATTTACCTTTTTATTTCGTTTGTGTGCAATTGTTGGT
ATATGTAAAGTTGAAGATTTCAAAGAAGCAGTTTTGCAGTCATCTGATCT
AAACACTTTTAGTTCTAAAACTGCGTATCGAAATTCGAAGCTAATTGAAT
TTAAAGAATCAACGAACTATTTAGAAAAATGCAATTTATTGCAAATTAAT
ACTATTTTCCGACATGGGACTCGATTTCCGTCAGCAAAAGACATGGATAA
AATTGATAGCGTGATGAAGAAAATAAGCAAGAGTCATGGACGGTCTATCT
TACCGTTATCACTACAAAATTGGAAAAATCCATTTTCAAAGTCGAAGTCA
AAGGAATTGGCATCTGTTGGCTATGAGGAAATGATGATTCTTGGCAATCG
ATTCCGAGCTCGTTTAAATGCGATTATCCGACCTAGCAACCTTTTGAAGC
AAATAAAAGTATATACCAGTTCATTAACTCGATCTAAAATGAGTGCAGCT
ACTTTTTTACGCGCGTTTCTCAACGAAACTAAAACTCTGAAAGAATTAAC
TAAATTAATCACGGAAAATGACAATTGCTTGCGATTCTTTGATAAATGCC
CGCATTATACGACGAGCGTATTGAAGAACAAAGCGTCGAATATAGAATAC
ACAAGATACAGCAATGGGCCTGAGGTCAGGAGGGTCATTAAGGATATCCA
GGAGAAATGGAAATTGACGGATATTGAATTGGCCCCGGATGACGTCAGGG
CATTGTTTGTAATGTGCGGGTACGAGATTGCCACAAATCTCTCGAGTTTC
ATGCGGCCCCATGAATGTCCATTGTCTCCTGCTGGAGACGGGCTTGTTGT
CTGCCCGTTCAACCATCAGTTTGCTGCACAGGAAACCTCTCCGTTGTGCA
TGTTGCTGGAACGCGACCATTTCCCGGTACTCGAATACCTTTACGATCTC
AAGCATTACTGGACTAAAGCATATGGGAAAGAGATCAATTGGTTGCAAGG
ATGTGCTCTCATGTCCCCGATACTCGATCAGATCATGTCGGCAGCTCGCA
CTCATCAATCCGTATTGAAATCTGCAGGACCAGCAACGAACACTCCACAT
TTCAAGCAGCAACTCGACAAACAGAATTATAACCGTGCTACATTCTGGTT
CGGACATGCTGAAACGGTGCTGCCGATTGTGGCTTTGCTAGGACTATTCA
ACCAATCAGCCCCGATGACCGCCAAGACATATTCAAAGCGGTTGTCACTT
ATAAGCAATCACCAACACCGCTTCACAACATTCCGCACCTCAAATATTAT
TCCGTTCTCAGGCAATGTCGGTTTGGAGCTGTTTCATTGTCCGCACTTGT
CACAAGATGATCTCAGTGGCTACCGAGTCCAGGTCAAGGTCAACGAGAAG
GCAGTGACTTGGCCGATATCCAACGGTCAAAGCCACATATCGATTGAGTT
ATTGATGAAGCACCTGAAGTTCTGCCAGGCAGACAAGTACGACCACAACG
CCATCTGCGTGCAAGGCCTCTCATCCGCGCAATTGCATCAAGTCCGTAAA
CGCAGTGATGAGTTGTGAACGTTTTGTTCACAATCGCTTCCATTTTTATC
ATTATTATTACCTTATTGATTTTATTGCAATAAATTTTATTTGGT
back to top

protein sequence of SMED30012274-orf-1

>SMED30012274-orf-1 ID=SMED30012274-orf-1|Name=SMED30012274-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=520bp
MIFTFLFRLCAIVGICKVEDFKEAVLQSSDLNTFSSKTAYRNSKLIEFKE
STNYLEKCNLLQINTIFRHGTRFPSAKDMDKIDSVMKKISKSHGRSILPL
SLQNWKNPFSKSKSKELASVGYEEMMILGNRFRARLNAIIRPSNLLKQIK
VYTSSLTRSKMSAATFLRAFLNETKTLKELTKLITENDNCLRFFDKCPHY
TTSVLKNKASNIEYTRYSNGPEVRRVIKDIQEKWKLTDIELAPDDVRALF
VMCGYEIATNLSSFMRPHECPLSPAGDGLVVCPFNHQFAAQETSPLCMLL
ERDHFPVLEYLYDLKHYWTKAYGKEINWLQGCALMSPILDQIMSAARTHQ
SVLKSAGPATNTPHFKQQLDKQNYNRATFWFGHAETVLPIVALLGLFNQS
APMTAKTYSKRLSLISNHQHRFTTFRTSNIIPFSGNVGLELFHCPHLSQD
DLSGYRVQVKVNEKAVTWPISNGQSHISIELLMKHLKFCQADKYDHNAIC
VQGLSSAQLHQVRKRSDEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR029033His_PPase_superfam
IPR000560His_Pase_clade-2
IPR016274Histidine_acid_Pase_euk
IPR033379Acid_Pase_AS
Vocabulary: molecular function
TermDefinition
GO:0003993acid phosphatase activity
GO:0016791phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0016311dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000560Histidine phosphatase superfamily, clade-2PFAMPF00328His_Phos_2coord: 60..462
e-value: 5.0E-28
score: 98.5
IPR000560Histidine phosphatase superfamily, clade-2CDDcd07061HP_HAP_likecoord: 59..462
e-value: 1.33156E-24
score: 100.526
IPR016274Histidine acid phosphatase, eukaryoticPIRSFPIRSF000894Acid_Ptasecoord: 1..516
e-value: 9.7E-69
score: 229.8
NoneNo IPR availablePANTHERPTHR20963:SF8MULTIPLE INOSITOL POLYPHOSPHATE PHOSPHATASE 1coord: 28..259
coord: 281..501
NoneNo IPR availablePANTHERPTHR20963MULTIPLE INOSITOL POLYPHOSPHATE PHOSPHATASE-RELATEDcoord: 28..259
coord: 281..501
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.584
IPR033379Histidine acid phosphatase active sitePROSITEPS00616HIS_ACID_PHOSPHAT_1coord: 60..74
IPR029033Histidine phosphatase superfamilySUPERFAMILYSSF53254Phosphoglycerate mutase-likecoord: 48..477