Talin

Overview
NameTalin
Smed IDSMED30012271
Length (bp)8430
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Talin (SMED30012271) t-SNE clustered cells

Violin plots show distribution of expression levels for Talin (SMED30012271) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Talin (SMED30012271) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Talin (SMED30012271) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012271

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30012271SMESG000072542.1 dd_Smed_v4_2443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30012271SMESG000072542.1 dd_Smed_v4_2443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012271SMESG000072542.1 dd_Smed_v4_2443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012271SMESG000072542.1 dd_Smed_v4_2443_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
oocyteSMED30012271SMESG000072542.1 Contig41835uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30012271SMESG000072542.1 Contig41835uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30012271SMESG000072542.1 Contig41835newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30012271SMESG000072542.1 Contig41835newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Talin vs. Ensembl Human
Match: TLN1 (talin 1 [Source:HGNC Symbol;Acc:HGNC:11845])

HSP 1 Score: 1010.36 bits (2611), Expect = 0.000e+0
Identity = 852/2769 (30.77%), Postives = 1407/2769 (50.81%), Query Frame = 3
Query:   69 MHTLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMK-TMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQP--IAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITA----HQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASN------YQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLN-NYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVI--QGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPN--NQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG-VLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLA-QLLPHSRDRGEVIELTKTVLEAFLAMVQECETLS-----TTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDA-ASAHTLIFQSIKGITDTVTD----------------NSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVT--GVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFI---GQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            M  L + I   N   +++ +  T+VYD CR + +RIP+       +FGLF+SD D  +  WL+  K + YY L  GD    + ++ + R L IR +D T KT+ VDDSK++ ++++ IC ++GI+NH+EYSL+ EL E ++ + T TL++ KT +RD  K+EK+KQKL TDDELNWL HG+TLR+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A + AG QCQ + G     K K+   +LK+FLPKEYVK KG ++KI   ++     S+ + KV Y +L RSLKTYG++FFLVKEK++ KNKLVPRL+GI+KE VMRVDEKTKE+IQ W LT ++R+AA+   F+LDFGDY D  Y +QTTEGE+IAQLI GYIDII+KK+K+KD+   + +EE+ M+E++V+P K+ V+   +          N +  + H    G + + +  R G++ P    + +     Q   + Q  +  +  L+  ++AL   I  +++ ++AA   LD    +  LG D +S+ +RK  +D +K  +   + ++T  T +++ +   D       DY  +  A+ TI  N   L E  R V  +    ++E  +G  L++AAK L  A  +LL +++P + E                   + L++A   VG+AS  LL  I       SD +   +D L+  AK +A+  +    ++K  SVA + T+ +  Q  +I AA     +TS L++  KVVA +I  P+ Q+QL  + + V  +V+  +   Q   E   ++ + +      + +++++L QH+  ++  A      D      L+ +E + +++G++ EMV QA+ILA+A ++L + +   A  +S            D +  R+L+ AA+ L DA  K+V A K      + + E QQ L +AA  +    +  A   I+++L + LE A +Q A +A Q + ++Q AA T +AS        Q C    E     +P ++      +  P  P+AQ  L+ A Q  +Q   +++ +++A  P ++D +    L+   +N  T+LA+L+   Q+A     P  + +  ++    +Q L   +     +   G+L PLPGET+E  +  +G+S+KA S    +L   +   N NY         G+      +A+++   +  L + ARG+AAL S       + +   DV+D    +I   +      G   +  R   + ++ K++ +    ++  V  +P  +++D   + L++  +   + + ++ P       T +  + QS    A A  NQ   +L+  S  T   L   + +  +     L  G+++  + P+  ++ Q+ S LK +S +S+ LL   K L     + ++      L  AA  V+DSIN L++ C    P  Q+ C+++ R+LE ++   L E P  PIN+ SY  C+ SV E S+ L   M  I    K G+  +F  AI   S +     ++  QA Y +G+   N+       V  P   +    A  M+  C S+     ++      AT +    S++C   +     +++P  + + + + K VA +T NL+KTI +   + + EN    +A    +L  V+ L+  A     +NP   +I  Q    GR A   I  ++  M+E +  L++ A AL  + +  P+      + +T    + +L   ++  APGQ E       L   LR+LD+A++   S   + +    S +++++   +M  +++++ + I P+ N  + +++   LG  V +   Y  P++ ++   A + L H +    +++ TKT+ E+ L ++   +             + L E V  +    +DL   ++  AS  G +  M+ SI ++  +L E     P  +     T + ++ K I  TV +                N L  D    RL   E+     A E+ +I S      + +  ++L H   +LVT  G +Q   S A                          Y +KE I    +V  +++ ++  LQ+ +RGTQ CI AA++V+ ++ADLDT I+F          +N E  +    + A  +E I K  K LV D + +V +  G QE LA A  ++V    +L   VK            LG + +  E    Q +L+NAV+DVA AL D  + TK       D +     LK+S + MV +V  L+K+VK++ED   +GTRALE + E +R+E     +  P                              K  + E+ + MTK + +A+ KA+AA  + +QED++  AN+ R+AI D++           KE    P     E AP V               ++ + +G+      +++ +++  ++   K +   K Q+T  S+R+A S+ E+ ++A  +K T   D EDP     IAENELL AA+ IE AAKK+  LKPR    K+  E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LVK A +    ++           + MV  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:    1 MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGD---TMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKG-ERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQY----------NRVGKVEH----GSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGD---PAETDYTAVGCAVTTISSN---LTEMSRGVKLLAALLEDEGGSGRPLLQAAKGLAGAVSELLRSAQPASAE-----------------PRQNLLQAAGNVGQASGELLQQIGE-----SDTDPHFQDALMQLAKAVASAAA--ALVLKAKSVA-QRTEDSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLL-RGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGES------------DLENSRKLLSAAKILADATAKMVEAAKGAAAHPD-SEEQQQRLREAAEGLRMATNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVAEQ----IPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSV----VQNLEKDLQEVKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYA--------GI------AARDVAGGLRSLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQR---LAQVAKAVTQA---LNRCVSCLPGQRDVD---NALRAVGDASKRLLSDSLP-----PSTGTFQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPAAPNLK---SQLAAAARAVTDSINQLITMCTQQAP-GQKECDNALRELETVRE--LLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLV-EPTQFARANQAIQMA--CQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRAATAPLLEAVDNLSAFA-----SNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPR-EGISQEALHT---QMLTAVQEISHLIEPLAN--AARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMA-LLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYG--RL-ASEAKPAAVAAENEEIGSH-----IKHRVQELGHGCAALVTKAGALQCSPSDA--------------------------YTKKELIECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMF-----ATAGTLNREGTE----TFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVK------------LGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGD-DPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPA----------------------------KTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLR--------ACKEAAYHP-----EVAPDV--------------RLRALHYGRECANGYLELLDHVLLTLQ--KPSPELKQQLTGHSKRVAGSVTELIQAAEAMKGTEWVDPEDPT---VIAENELLGAAAAIEAAAKKLEQLKPRAK-PKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAL---DDGQWSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFEEQENETVV--VKEKMVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQ 2527          
BLAST of Talin vs. Ensembl Human
Match: TLN2 (talin 2 [Source:HGNC Symbol;Acc:HGNC:15447])

HSP 1 Score: 974.156 bits (2517), Expect = 0.000e+0
Identity = 835/2763 (30.22%), Postives = 1420/2763 (51.39%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIG-QGNVNV-QPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLI--AEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLS--LKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQD----LMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLI-FQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE----HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            +L+I +   N   +++ +  T VYD CR + +R+P+ +     ++GLF+SD D  +  WL+  + + YY L + + +L +K + R   IR +D + KT+ VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +   T TLK+ +T +RD  K+EK+K KL TDD+LNWL H +T R+ G+DE + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ E+A +  G Q Q + G     K K    +LKEFLPKEY+K +G +K+I  +++     S+ + KV Y +L RSL+TYG++FFLVKEK++ KNKLVPRL+GI+K+ VMRVDEKTKE++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K+ ++   F          N      H    G + + +  R GS+ P      S    Q  V V Q  +  +  L+  ++ALM  I  ++  ++ A +DL +   +  LG D +SR + +  +D +K  +   + ++T  T +++ +   D     + DY  +  AI TI  N  ++ + ++ +  +    D+E  +G +L+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L++ AK +AN  + +V  +K  +VA +  + T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV+N ++  Q    T S + +Q+    +++ +++  L QH  +    +  +P+          +  +E + +++G++ EMV QA++LA+A ++L + +             S + + +D +  ++L+ AA+ L D+  ++V A K      E   + QQ L +AA  +    +  A   I++++   LE A +Q A  A Q + +SQ AA + +  A+  Q+    + + + + P+++      +    D +AQ  L+ + Q  +Q   +++ S++A  P V D +    L+   +N  TSLA+L+   Q+A     P  + +  N     +QTL + +  A  +    +L PLPGET+E  +  +GS+SKA      +L       N + +       G+      +A+E  ++++ L + ARG+AA  +   +   + +   DV++    +I+  +  +    +A   A     L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TK   + QSE   A A  NQ+ G+++++    S  L   + + ++  D  L  G+++   A+   +Q Q+   LK++S  S+ LL   K L    G+      K  L  AA  V++SIN L++ C    P  Q+ C+++ R+LE +K  L  + P+ P+++ SY  C++SV E S+ L   M  I    KTGD   F   + + S +   + ++  QA Y +G+   N+       V +PI  +    A  M+  C ++    +S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S +N    + A   ++  VE LT  A     +NP   +I  Q    G QAQ  I  ++  M+E S  L+R A +L  + K  P       +  T    +  L   ++  APGQRE     + + + +R++++A++   S + +++      D I+ +  + QL+  ++++ + I PI    + + +   LG  V +  SY  P+  ++  +A  +   + +  V++ TKT+ E+ L M+   +        Q     + E    +K   DD+M  ++  AS  G +  M+ +I ++ ++L E     P       T + +Q+      TV   S  K I+VT   ++  TK +   E+   L+            ++  DY  L       M++     ++   +++  V  +G  C+ L++            Y ++E I   R+   +++ ++  LQ+ ++GTQ CI AA +V+ ++ADLDT I+F          +N+EN +    + A  +E+I K  K+LV D + +V       + LA A  ++     QL   VK  A ++GS+                Q +L+NA++DVA AL D  + TK   +   D +     LK + + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++     +DV                        +K  S E  + MTK + +A+ KA+AA  + +QED++  AN+ RKA++D++   +                  +   P VSD  R           + +  G       +D+ E++   V   K     K Q+   S+R+A ++ E+ ++A  +K T   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++  S   +  ++ QWS GLISAAR+VAAAT +L ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LV+ A +      D  D  +   +       V  +  +I AQ +++ KERELE  R K   IRQ      P
Sbjct:    5 SLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGD-ILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQF----------NRTGKAEH----GSVALPAVMRSGSSGPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAGDP---ADTDYTAVGCAITTISSNLTEMSKGVKLLAAL---MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGE-----------------PRQTVLTAAGSIGQASGDLLRQIGENE---TDERFQ--DVLMSLAKAVANAAAMLV--LKAKNVA-QVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAAT-TDSELLKQVSAAASVVSQALHDLLQH--VRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKAVADHI-PQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNT----VQTLKNELQDAKMAAVESQLKPLPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALKTLAQAARGVAASTTDPAAAHAMLDSARDVMEGSAMLIQEAKQAL----IAPGDAERQQRLAQVAKAVSHSLNNCVNCLPGQKDVDV---ALKSIGESSKKLLVDSLP-----PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLAAKSLSVDPGAP---NAKNLLAAAARAVTESINQLITLCTQQAP-GQKECDNALRELETVKGML--DNPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLV-DPIQFARANQAIQMA--CQNLVDPGSSPSQVLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATAPLIEAVENLTAFA-----SNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLATR------DDISVEALQEQLTSVVQEIGHLIDPIAT--AARGEAAQLGHKVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEP-----KGTFVDYQT------TVVKYS--KAIAVT--AQEMMTKSVTNPEELGGLA-----------SQMTSDYGHL--AFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMF-----ATAGTLNAENSE----TFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDP------------ETQVVLINAIKDVAKALSDLISATKGAASKPVD-DPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQS-----KDV-----------------------PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQ-----------------ASFHPDVSDEVR----------TRALRFGTECTLGYLDLLEHV--LVILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVG-SIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKF-------VGGIAQIIAAQEEMLKKERELEEARKKLAQIRQQQYKFLP 2534          
BLAST of Talin vs. Ensembl Human
Match: TLN2 (talin 2 [Source:HGNC Symbol;Acc:HGNC:15447])

HSP 1 Score: 454.136 bits (1167), Expect = 1.315e-130
Identity = 479/1703 (28.13%), Postives = 814/1703 (47.80%), Query Frame = 3
Query: 3201 LIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLI--AEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLS--LKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQD----LMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLI-FQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALV----KEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            L+   E L KS++A  P V D +    L+   +N  TSLA+L+   Q+A     P  + +  N     +QTL + +  A  +    +L PLPGET+E  +  +GS+SKA      +L       N + +       G+      +A+E  ++++ L + ARG+AA  +   +   + +   DV++    +I+  +  +    +A   A     L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TK   + QSE   A A  NQ+ G+++++    S  L   + + ++  D  L  G+++   A+   +Q Q+   LK++S  S+ LL   K L    G+      K  L  AA  V++SIN L++ C    P  Q+ C+++ R+LE +K  L  + P+ P+++ SY  C++SV E S+ L   M  I    KTGD   F   + + S +   + ++  QA Y +G+   N+       V +PI  +    A  M+  C ++    +S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S +N    + A   ++  VE LT  A     +NP   +I  Q    G QAQ  I  ++  M+E S  L+R A +L  + K  P       +  T    +  L   ++  APGQRE     + + + +R++++A++   S + +++      D I+ +  + QL+  ++++ + I PI    + + +   LG  V +  SY  P+  ++  +A  +   + +  V++ TKT+ E+ L M+   +        Q     + E    +K   DD+M  ++  AS  G +  M+ +I ++ ++L E     P       T + +Q+      TV   S  K I+VT   ++  TK +   E+   L+            ++  DY  L       M++     ++   +++  V  +G  C+ L++            Y ++E I   R+   +++ ++  LQ+ ++GTQ CI AA +V+ ++ADLDT I+F          +N+EN +    + A  +E+I K  K+LV D + +V       + LA A  ++     QL   VK  A ++GS+                Q +L+NA++DVA AL D  + TK   +   D +     LK + + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++     +DV                        +K  S E  + MTK + +A+ KA+AA  + +QED++  AN+ RKA++D++   +                  +   P VSD  R           + +  G       +D+ E++   V   K     K Q+   S+R+A ++ E+ ++A  +K T   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++  S   +  ++ QWS GLISAAR+VAAAT +L ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LV    K A    D  D  +   +       V  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:   20 LLIETENLRKSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNT----VQTLKNELQDAKMAAVESQLKPLPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALKTLAQAARGVAASTTDPAAAHAMLDSARDVMEGSAMLIQEAKQAL----IAPGDAERQQRLAQVAKAVSHSLNNCVNCLPGQKDVDV---ALKSIGESSKKLLVDSLP-----PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLAAKSLSVDPGAP---NAKNLLAAAARAVTESINQLITLCTQQAP-GQKECDNALRELETVKGML--DNPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLV-DPIQFARANQAIQMA--CQNLVDPGSSPSQVLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATAPLIEAVENLTAFA-----SNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLATR------DDISVEALQEQLTSVVQEIGHLIDPIAT--AARGEAAQLGHKVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEP-----KGTFVDYQT------TVVKYS--KAIAVTA--QEMMTKSVTNPEELGGLA-----------SQMTSDYGHL--AFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMF-----ATAGTLNAENSE----TFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDP------------ETQVVLINAIKDVAKALSDLISATKGAASKPVD-DPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQS-----KDV-----------------------PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQ-----------------ASFHPDVSDEVR----------TRALRFGTECTLGYLDLLEHV--LVILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVG-SIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKF-------VGGIAQIIAAQEEMLKKERELEEARKKLAQIRQ 1552          
BLAST of Talin vs. Ensembl Human
Match: TLN2 (talin 2 [Source:HGNC Symbol;Acc:HGNC:15447])

HSP 1 Score: 419.083 bits (1076), Expect = 1.202e-119
Identity = 440/1574 (27.95%), Postives = 755/1574 (47.97%), Query Frame = 3
Query: 3633 SAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLI--AEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLS--LKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQD----LMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLI-FQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQ---------------AAGSAVKRATEALVKEATE----HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            +A+E  ++++ L + ARG+AA  +   +   + +   DV++    +I+  +  +    +A   A     L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TK   + QSE   A A  NQ+ G+++++    S  L   + + ++  D  L  G+++   A+   +Q Q+   LK++S  S+ LL   K L    G+      K  L  AA  V++SIN L++ C    P  Q+ C+++ R+LE +K  L  + P+ P+++ SY  C++SV E S+ L   M  I    KTGD   F   + + S +   + ++  QA Y +G+   N+       V +PI  +    A  M+  C ++    +S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S +N    + A   ++  VE LT  A     +NP   +I  Q    G QAQ  I  ++  M+E S  L+R A +L  + K  P       +  T    +  L   ++  APGQRE     + + + +R++++A++   S + +++      D I+ +  + QL+  ++++ + I PI    + + +   LG  V +  SY  P+  ++  +A  +   + +  V++ TKT+ E+ L M+   +        Q     + E    +K   DD+M  ++  AS  G +  M+ +I ++ ++L E     P       T + +Q+      TV   S  K I+VT   ++  TK +   E+   L+            ++  DY  L       M++     ++   +++  V  +G  C+ L++            Y ++E I   R+   +++ ++  LQ+ ++GTQ CI AA +V+ ++ADLDT I+FA +G+     +N+EN +    + A  +E+I K  K+LV D + +V       + LA A  ++     QL   VK  A ++GS+                Q +L+NA++DVA AL D  + TK   +   D +     LK + + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++     +DV                        +K  S E  + MTK + +A+ KA+AA  + +QED++  AN+ RKA++D++   +                  +   P VSD  R           + +  G       +D+ E++   V   K     K Q+   S+R+A ++ E+ ++A  +K T   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++  S   +  ++ QWS GLISAAR+VAAAT +L ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQ               AAG+AVKRA++ LV+ A +      D  D  +   +       V  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:   36 AARETAQALKTLAQAARGVAASTTDPAAAHAMLDSARDVMEGSAMLIQEAKQAL----IAPGDAERQQRLAQVAKAVSHSLNNCVNCLPGQKDVDV---ALKSIGESSKKLLVDSLP-----PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLAAKSLSVDPGAP---NAKNLLAAAARAVTESINQLITLCTQQAP-GQKECDNALRELETVKGML--DNPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLV-DPIQFARANQAIQMA--CQNLVDPGSSPSQVLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATAPLIEAVENLTAFA-----SNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLATR------DDISVEALQEQLTSVVQEIGHLIDPIAT--AARGEAAQLGHKVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEP-----KGTFVDYQT------TVVKYS--KAIAVTA--QEMMTKSVTNPEELGGLA-----------SQMTSDYGHL--AFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMFATAGT-----LNAENSE----TFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDP------------ETQVVLINAIKDVAKALSDLISATKGAASKPVD-DPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQS-----KDV-----------------------PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQ-----------------ASFHPDVSDEVR----------TRALRFGTECTLGYLDLLEHV--LVILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVG-SIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQVMVTDAGGKILLLERAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKF-------VGGIAQIIAAQEEMLKKERELEEARKKLAQIRQ 1456          
BLAST of Talin vs. Ensembl Human
Match: HIP1 (huntingtin interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:4913])

HSP 1 Score: 83.5741 bits (205), Expect = 4.694e-15
Identity = 69/236 (29.24%), Postives = 114/236 (48.31%), Query Frame = 3
Query: 7524 IAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALV------KEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGH 8213
            + + E+   ++ IETA  +I  +   KS   DTG +   + +I+  C S++ A   L+  +   Q+E+V  GR   S        ++W+ GLISA++ V      + D+A  VVQG+   + L+  S ++AA TA L+ A +VK+D DS    +LQ A   V +AT  +V      K   E  D  D S        + ++    R  + +Q  ++  E EL+  R K   +R+ H
Sbjct:  782 LVDKEMAATSAAIETATARIEEMLS-KSRAGDTGVKLEVNERILGCCTSLMQAIQVLIVASKDLQREIVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGRGKFEELMVCSHEIAASTAQLVAASKVKADKDSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFS--------SMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKH 1008          
BLAST of Talin vs. Ensembl Celegans
Match: tln-1 (TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9])

HSP 1 Score: 467.233 bits (1201), Expect = 2.595e-140
Identity = 340/1050 (32.38%), Postives = 543/1050 (51.71%), Query Frame = 3
Query:   69 MHTLRILIVPTNKTI--SLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLI-----------------------YELDENERMKTMTLKRGKTQI------RDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGR---VGSAQPIAIRNDSKIGQGNVNVQ----PQKFQIRDLSQ-PKRALMIRIGDNLKILKAATEDLDK--HIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQ-----LDETVAMICESIDKLKQHLIINSITA----HQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQT------LENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAK 3050
            M  L + +    K I  +++ +  T++YD  + L +      ++   E+G+F  D +  ++ W+DN +   +Y + +K+ +  +K ++R L +R +D   KT+ VD+S+ +++L++ +CNK+GISN+EEYSL+                       + L E E  ++ +  RG   I      ++  KLE++++KL TD+EL WL H KTLR+ GI E++ L+LRRKYFFSD NVD+RDP+QLNLLYVQ ++ I+ G HPV  E A QLA +Q   + G+   DK K  H + ++ LPKEY K K  +KK++A Y++LSG S+ D K  Y  LCR LKTYG+TFF+VKEK+  KNKLVPRL+G++KE VMRVDE +K++++ WPL  VRR+  +A  FSLDFGDY D  Y +QTT+GEKIAQLI GY+DII+KK++ +D+   + +E + M+E+ VAP+KA +++H  I            AT G +  RG +     G+   +  AQ  A+        G +  Q     Q+ + +D+ Q P+RAL+  I   ++ ++ A  +L+    I++ +  +D S   + ++   + K  V   L +M  AT  ++     +E  D      R+  AIATIG N   +  N+R +         E    G+L++A K L  AF   LN                ++N E  A  N+    A   VGE S+ L++++          +    + L+  AK +A   + +V   K  S    E Q    Q  +I +A     ATS L++ A+VVA +I+    QQQL  +A +V  SV+N++       +    +YQQ     + E    +  ++D L +H   +  T      ++ +  + L  + R+    G S ++  +A+ +      L +   + A  Q P++            R+R        L DA  K+ HAT   +  +EQ       +E +  L  AA  +  V + T  E   Q + + LE A +QTA  A Q + ++  A K
Sbjct:    1 MGVLSLTVSSAEKGIKKTMQFEPSTLIYDAAK-LIREKFAMHDVNANEYGIFRLDENPSKSLWMDNGRTFEHYLVRNKDEIE-YKRKIRLLKVRMLDGAVKTISVDESQPVSQLMMTVCNKIGISNYEEYSLVRDDILMQNGGGGGGGGGQNGGSTWNLKEKE-SRSKSSDRGGGGIYGTMRKKNEQKLEELRKKLHTDEELPWLDHTKTLREQGITEEETLILRRKYFFSDSNVDSRDPVQLNLLYVQCRDGILRGLHPVEKETAFQLAALQSHIQYGDFPYDKPK-FHLDGRDVLPKEYAKNKENEKKVVAMYKELSGTSELDAKSKYVHLCRGLKTYGVTFFVVKEKLPGKNKLVPRLLGVNKESVMRVDENSKQILKEWPLEQVRRWVPSAKCFSLDFGDYQDGYYSVQTTDGEKIAQLIQGYVDIILKKKRTQDHQGIEGDEGSTMLEDMVAPAKATLVAHGQIG-------SGQHATDGLVAVRGVLRTPQGGQGYGINGAQYGAV-------SGEITSQELARAQRLRYQDMYQHPQRALIGTIEATIRAVEDAEIELEAEPQIDIPRFNDDYSQNRWMEEQQAVNKENVNERLAAMGAATAQVVQWTAVEEYDD------RVGTAIATIGSNLPDVSRNVRDLGAFM-----EHRERGDLLDATKKLCGAFGKFLN----------------TVNPETEARRNEVFRTA-GHVGETSQHLINVMEAPNEGQQKFD----ERLVQSAKNVATSTAQLVLCAKTISAECDEPQ---VQERVIQSATKCAFATSQLVACARVVAPTIDNNACQQQLSTAATEVTQSVNNLLH------DAEHAVYQQSSLTDIHEAARQVTSALDSLLEHAKCSPKTQTTRREEEEMYNEVLRRTNRMVVHQGPSEDLTREARKVVRHSQLLTEQFQHEAH-QRPEH------------RER--------LLDAAAKVAHATSEMILATEQAESQPRQVETEYALRTAAERLGQVTNETTQEQQEQHIMQRLEQAAKQTAYDATQTISAANSAKK 970          
BLAST of Talin vs. Ensembl Celegans
Match: tln-1 (TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9])

HSP 1 Score: 491.115 bits (1263), Expect = 1.384e-139
Identity = 370/1157 (31.98%), Postives = 594/1157 (51.34%), Query Frame = 3
Query:   69 MHTLRILIVPTNKTI--SLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLI-----------------------YELDENERMKTMTLKRGKTQI------RDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIG--QGNVNVQ----PQKFQIRDLSQ-PKRALMIRIGDNLKILKAATEDL--DKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQ-----LDETVAMICESIDKLKQHLIINSITA----HQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQT------LENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQ--ICSEAQEMTEIVLPEVILACTKIRENPIDPN-------AQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQA 3347
            M  L + +    K I  +++ +  T++YD  + L +      ++   E+G+F  D +  ++ W+DN +   +Y + +K+ +  +K ++R L +R +D   KT+ VD+S+ +++L++ +CNK+GISN+EEYSL+                       + L E E  ++ +  RG   I      ++  KLE++++KL TD+EL WL H KTLR+ GI E++ L+LRRKYFFSD NVD+RDP+QLNLLYVQ ++ I+ G HPV  E A QLA +Q   + G+   DK K  H + ++ LPKEY K K  +KK++A Y++LSG S+ D K  Y  LCR LKTYG+TFF+VKEK+  KNKLVPRL+G++KE VMRVDE +K++++ WPL  VRR+  +A  FSLDFGDY D  Y +QTT+GEKIAQLI GY+DII+KK++ +D+   + +E + M+E+ VAP+KA +++H  I            AT G +  R   GV+   + G    I   N ++ G   G +  Q     Q+ + +D+ Q P+RAL+  I   ++ ++ A  +L  +  I++ +  +D S   + ++   + K  V   L +M  AT  ++     +E  D      R+  AIATIG N   +  N+R +         E    G+L++A K L  AF   LN                ++N E  A  N+    A   VGE S+ L++++          +    + L+  AK +A   + +V   K  S    E Q    Q  +I +A     ATS L++ A+VVA +I+    QQQL  +A +V  SV+N++       +    +YQQ     + E    +  ++D L +H   +  T      ++ +  + L  + R+    G S ++  +A+ +      L +   + A  Q P++            R+R        L DA  K+ HAT   +  +EQ       +E +  L  AA  +  V + T  E   Q + + LE A +QTA  A Q + ++  A     + +Y+  +  E+ + T   LP +I   T IRE+    N       AQ+ L+    K+++   +L +++    P V D  + S+L+ S     TSLADL+  V  A
Sbjct:    1 MGVLSLTVSSAEKGIKKTMQFEPSTLIYDAAK-LIREKFAMHDVNANEYGIFRLDENPSKSLWMDNGRTFEHYLVRNKDEIE-YKRKIRLLKVRMLDGAVKTISVDESQPVSQLMMTVCNKIGISNYEEYSLVRDDILMQNGGGGGGGGGQNGGSTWNLKEKES-RSKSSDRGGGGIYGTMRKKNEQKLEELRKKLHTDEELPWLDHTKTLREQGITEEETLILRRKYFFSDSNVDSRDPVQLNLLYVQCRDGILRGLHPVEKETAFQLAALQSHIQYGDFPYDKPK-FHLDGRDVLPKEYAKNKENEKKVVAMYKELSGTSELDAKSKYVHLCRGLKTYGVTFFVVKEKLPGKNKLVPRLLGVNKESVMRVDENSKQILKEWPLEQVRRWVPSAKCFSLDFGDYQDGYYSVQTTDGEKIAQLIQGYVDIILKKKRTQDHQGIEGDEGSTMLEDMVAPAKATLVAHGQIG-------SGQHATDGLVAVR---GVLRTPQGGQGYGI---NGAQYGAVSGEITSQELARAQRLRYQDMYQHPQRALIGTIEATIRAVEDAEIELEAEPQIDIPRFNDDYSQNRWMEEQQAVNKENVNERLAAMGAATAQVVQWTAVEEYDD------RVGTAIATIGSNLPDVSRNVRDLGAFM-----EHRERGDLLDATKKLCGAFGKFLN----------------TVNPETEARRNEVFRTA-GHVGETSQHLINVMEAPNEGQQKFD----ERLVQSAKNVATSTAQLVLCAKTISAECDEPQ---VQERVIQSATKCAFATSQLVACARVVAPTIDNNACQQQLSTAATEVTQSVNNLLH------DAEHAVYQQSSLTDIHEAARQVTSALDSLLEHAKCSPKTQTTRREEEEMYNEVLRRTNRMVVHQGPSEDLTREARKVVRHSQLLTEQFQHEAH-QRPEH------------RER--------LLDAAAKVAHATSEMILATEQAESQPRQVETEYALRTAAERLGQVTNETTQEQQEQHIMQRLEQAAKQTAYDATQTISAANSAKDVIESRSYKENLVYESTQ-TAGHLPNLI---TSIRESQKVDNTPGEKFKAQSRLIRDSYKVLETSVRLFETARTAVPMVSDSHLASSLDQSANRLGTSLADLRTSVNDA 1074          

HSP 2 Score: 311.997 bits (798), Expect = 1.267e-84
Identity = 347/1282 (27.07%), Postives = 595/1282 (46.41%), Query Frame = 3
Query: 4392 QQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKS---RASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQDLMENV----SSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARL-TETNNVAPLDA-ASAHTLIFQSIKGITDTVTD-NSLNK-DISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGE--EYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEH---RDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNK 8189
            Q+ C+++ R+++A+    + +  ++P+N+  Y   +QSV + S  L   M  +    K  D+  FC++++  + +   + +S + + Y +G+     S   SS     ++DS     SV S N  S     + ++   EL +DI S   ++SS+ QL +     + +P+ +  L+     VA  T +L+       R    E+   + A E +     QL   A   P       +I+ +G  AQ  I Q+S EM++ S  +++ A +     +     Q   +N +     + RL N +  +APGQ E       L  +   ++R+ MD ++     K  A +   +   +Q++Q    QL++ +  + N   +    E L + V      +  +++++   A +   S  + E+ +  KTV+EA LAM+          N      NV      LK    D+ + I  ++S  G ++ M+ +I  S A      ++  P  + A A T +   ++ I  T  +  +LN  D+    L   E   R+ A +  Q       AD+    K  V     L T  I+ ++         ED              + I+       G V  R+  ++  L S SRGTQ CI AAN+V+ ++ DLDT I+F          +NS +D+  P+     KE I K  K+LV D + +V      QE LA+A  NAVR    L  AVK+ A+++ S  S              Q L+++AVRDVA AL      TK N +  + +     +LK + + MV +V  L+K+V ++E+   +GTRA+E +++A+  E +  E+            + EG     +   +++  +++ +  +   V+          +   A Q+  +E+I+  AN+ R A+  L+  +R TI     +  + P R        V D  R    +VK                L+ ++  +   V    + ES ++ +  AS+ ++ ++  +     ++  T L    +  S  A AENELL AAS IE A+ K+A L+PR+ ++++T E  E  FD  II++   I+ A   L++ AS +Q+EL  QGR             QWS GLISAAR+V A+   L D+A  +++G+   +RLISA+KQV++ TA LL+AC V++D DS+ N+RLQAAG AV+ A E LV+ A +    RD ++ +I       +  +VN +  V+ AQ +++ KEREL   R+K
Sbjct: 1375 QRECDAALRRIQAVYH--VTQHANVPLNDNGYFASLQSVSDGSRRLGEAMTGMARHAKGNDTEGFCTSVRDSADALCSLAESASHSAYLVGI-----SHPASSPGRAALIDSSEVARSVESINA-SCQRVESRQLNREELMSDISSITKQSSSLAQLCRIASEKTQNPNVKKHLVGCAMGVASKTSSLVTAFKDLDRMPDAESRCTSSASE-LRQVALQLLHFAD-KPDFAAIQGSISTEGHSAQQPILQSSREMLDSSAQMIQTAKSWASAPQDEATWQRMAVNSRQVSDSIMRLVNAIHEAAPGQMELEAAIGRLSALSGQIERSAMDCYASGNVQKHGANAERQL---LQQVQHIASQLEDKVDDLHNAAVEHG--ERLPKVVQLHCQMVEDLADAACCAAGMTVDSNQQTELFDKCKTVVEAELAMMVASRESGGNPNAVHAHANVKDAAGQLKHAIGDMRQTIAKVSSEQGAVQGMVDTISSSIAHTDVAVSSAHPGSSFADAQTRMTAYLEDIRRTAIEMPTLNTTDLGAASLNLSEKY-RLVAGDVRQAAGMLPEADIGQRLKLAVQ---KLGTSCIETVTVAGGKRAHPED--------------ERIQRQLSSQAGTVVERVEQVLAALHSASRGTQACINAANTVSGIIGDLDTTIMF-----ATSGSLNSSDDRKFPSH----KEAIVKTAKALVEDTKALVAGAASNQEQLAVAAQNAVRTIVNLSDAVKTGAVSLSSENS------------ETQVLVIHAVRDVAAALTSLIQATK-NASGLSLQHPAMGHLKDAAKVMVSNVARLLKTVATVEEKNQQGTRAVEAAVDAIGFEMKQFEH-----------DLNEGAAIPTDFRPEHLQQTAEHVSEITKRVM----------QGADAPQS--EEEIIGVANLSRSAVRSLLAVVR-TIS---NDADTAPQRY------AVLDSGRDVANNVK--------------SLLVSLHTQM---VRNPGQEESRRLLLE-ASKGVSSALSHLVGLCNEM--TGLPHNHEMESAAAQAENELLGAASSIEAASAKLAELRPRQIVQENTQEIVETEFDDNIIISAKGILHAVHTLMRSASNAQRELAMQGRAAAGGT----GTYQWSEGLISAARVVVASVHKLCDAANTLMKGQTTEERLISAAKQVSSSTAQLLVACNVRADPDSQANRRLQAAGQAVRNAAERLVQSAQQEMIARDDRNIAI-------SDRLVNGIAQVMDAQEEVLRKERELGEARHK 2537          
BLAST of Talin vs. Ensembl Celegans
Match: tln-1 (TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9])

HSP 1 Score: 308.916 bits (790), Expect = 1.944e-84
Identity = 346/1279 (27.05%), Postives = 591/1279 (46.21%), Query Frame = 3
Query: 4392 QQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKS---RASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQDLMENV----SSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARL-TETNNVAPLDA-ASAHTLIFQSIKGITDTVTD-NSLNK-DISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGE--EYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNK 8189
            Q+ C+++ R+++A+    + +  ++P+N+  Y   +QSV + S  L   M  +    K  D+  FC++++  + +   + +S + + Y +G+     S   SS     ++DS     SV S N  S     + ++   EL +DI S   ++SS+ QL +     + +P+ +  L+     VA  T +L+       R    E+   + A E +     QL   A   P       +I+ +G  AQ  I Q+S EM++ S  +++ A +     +     Q   +N +     + RL N +  +APGQ E       L  +   ++R+ MD ++     K  A +   +   +Q++Q    QL++ +  + N   +    E L + V      +  +++++   A +   S  + E+ +  KTV+EA LAM+          N      NV      LK    D+ + I  ++S  G ++ M+ +I  S A      ++  P  + A A T +   ++ I  T  +  +LN  D+    L   E   R+ A +  Q       AD+    K  V     L T  I+ ++         ED              + I+       G V  R+  ++  L S SRGTQ CI AAN+V+ ++ DLDT I+F          +NS +D+  P+     KE I K  K+LV D + +V      QE LA+A  NAVR    L  AVK+ A+++ S  S              Q L+++AVRDVA AL      TK N +  + +     +LK + + MV +V  L+K+V ++E+   +GTRA+E +++A+  E +  E+            + EG     +   +++  +++ +  +   V+          +   A Q+  +E+I+  AN+ R A+  L+  +R TI     +  + P R        V D  R    +VK                L+ ++  +   V    + ES ++ +  AS+ ++ ++  +     ++  T L    +  S  A AENELL AAS IE A+ K+A L+PR+ ++++T E  E  FD  II++   I+ A   L++ AS +Q+EL  QGR             QWS GLISAAR+V A+   L D+A  +++G+   +RLISA+KQV++ TA LL+AC V++D DS+ N+RLQAAG AV+ A E LV+ A +    +D       D     +VN +  V+ AQ +++ KEREL   R+K
Sbjct:  333 QRECDAALRRIQAVYH--VTQHANVPLNDNGYFASLQSVSDGSRRLGEAMTGMARHAKGNDTEGFCTSVRDSADALCSLAESASHSAYLVGI-----SHPASSPGRAALIDSSEVARSVESINA-SCQRVESRQLNREELMSDISSITKQSSSLAQLCRIASEKTQNPNVKKHLVGCAMGVASKTSSLVTAFKDLDRMPDAESRCTSSASE-LRQVALQLLHFAD-KPDFAAIQGSISTEGHSAQQPILQSSREMLDSSAQMIQTAKSWASAPQDEATWQRMAVNSRQVSDSIMRLVNAIHEAAPGQMELEAAIGRLSALSGQIERSAMDCYASGNVQKHGANAERQL---LQQVQHIASQLEDKVDDLHNAAVEHG--ERLPKVVQLHCQMVEDLADAACCAAGMTVDSNQQTELFDKCKTVVEAELAMMVASRESGGNPNAVHAHANVKDAAGQLKHAIGDMRQTIAKVSSEQGAVQGMVDTISSSIAHTDVAVSSAHPGSSFADAQTRMTAYLEDIRRTAIEMPTLNTTDLGAASLNLSEKY-RLVAGDVRQAAGMLPEADIGQRLKLAVQ---KLGTSCIETVTVAGGKRAHPED--------------ERIQRQLSSQAGTVVERVEQVLAALHSASRGTQACINAANTVSGIIGDLDTTIMF-----ATSGSLNSSDDRKFPSH----KEAIVKTAKALVEDTKALVAGAASNQEQLAVAAQNAVRTIVNLSDAVKTGAVSLSSENS------------ETQVLVIHAVRDVAAALTSLIQATK-NASGLSLQHPAMGHLKDAAKVMVSNVARLLKTVATVEEKNQQGTRAVEAAVDAIGFEMKQFEH-----------DLNEGAAIPTDFRPEHLQQTAEHVSEITKRVM----------QGADAPQS--EEEIIGVANLSRSAVRSLLAVVR-TIS---NDADTAPQRY------AVLDSGRDVANNVK--------------SLLVSLHTQM---VRNPGQEESRRLLLE-ASKGVSSALSHLVGLCNEM--TGLPHNHEMESAAAQAENELLGAASSIEAASAKLAELRPRQIVQENTQEIVETEFDDNIIISAKGILHAVHTLMRSASNAQRELAMQGRAAAGGT----GTYQWSEGLISAARVVVASVHKLCDAANTLMKGQTTEERLISAAKQVSSSTAQLLVACNVRADPDSQANRRLQAAGQAVRNAAERLVQSAQQEMIARDDRNIAISD----RLVNGIAQVMDAQEEVLRKERELGEARHK 1495          
BLAST of Talin vs. Ensembl Celegans
Match: tln-1 (TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9])

HSP 1 Score: 309.301 bits (791), Expect = 6.606e-84
Identity = 347/1282 (27.07%), Postives = 595/1282 (46.41%), Query Frame = 3
Query: 4392 QQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKS---RASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQDLMENV----SSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARL-TETNNVAPLDA-ASAHTLIFQSIKGITDTVTD-NSLNK-DISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGE--EYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEH---RDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNK 8189
            Q+ C+++ R+++A+    + +  ++P+N+  Y   +QSV + S  L   M  +    K  D+  FC++++  + +   + +S + + Y +G+     S   SS     ++DS     SV S N  S     + ++   EL +DI S   ++SS+ QL +     + +P+ +  L+     VA  T +L+       R    E+   + A E +     QL   A   P       +I+ +G  AQ  I Q+S EM++ S  +++ A +     +     Q   +N +     + RL N +  +APGQ E       L  +   ++R+ MD ++     K  A +   +   +Q++Q    QL++ +  + N   +    E L + V      +  +++++   A +   S  + E+ +  KTV+EA LAM+          N      NV      LK    D+ + I  ++S  G ++ M+ +I  S A      ++  P  + A A T +   ++ I  T  +  +LN  D+    L   E   R+ A +  Q       AD+    K  V     L T  I+ ++         ED              + I+       G V  R+  ++  L S SRGTQ CI AAN+V+ ++ DLDT I+F          +NS +D+  P+     KE I K  K+LV D + +V      QE LA+A  NAVR    L  AVK+ A+++ S  S              Q L+++AVRDVA AL      TK N +  + +     +LK + + MV +V  L+K+V ++E+   +GTRA+E +++A+  E +  E+            + EG     +   +++  +++ +  +   V+          +   A Q+  +E+I+  AN+ R A+  L+  +R TI     +  + P R        V D  R    +VK                L+ ++  +   V    + ES ++ +  AS+ ++ ++  +     ++  T L    +  S  A AENELL AAS IE A+ K+A L+PR+ ++++T E  E  FD  II++   I+ A   L++ AS +Q+EL  QGR             QWS GLISAAR+V A+   L D+A  +++G+   +RLISA+KQV++ TA LL+AC V++D DS+ N+RLQAAG AV+ A E LV+ A +    RD ++ +I       +  +VN +  V+ AQ +++ KEREL   R+K
Sbjct: 1010 QRECDAALRRIQAVYH--VTQHANVPLNDNGYFASLQSVSDGSRRLGEAMTGMARHAKGNDTEGFCTSVRDSADALCSLAESASHSAYLVGI-----SHPASSPGRAALIDSSEVARSVESINA-SCQRVESRQLNREELMSDISSITKQSSSLAQLCRIASEKTQNPNVKKHLVGCAMGVASKTSSLVTAFKDLDRMPDAESRCTSSASE-LRQVALQLLHFAD-KPDFAAIQGSISTEGHSAQQPILQSSREMLDSSAQMIQTAKSWASAPQDEATWQRMAVNSRQVSDSIMRLVNAIHEAAPGQMELEAAIGRLSALSGQIERSAMDCYASGNVQKHGANAERQL---LQQVQHIASQLEDKVDDLHNAAVEHG--ERLPKVVQLHCQMVEDLADAACCAAGMTVDSNQQTELFDKCKTVVEAELAMMVASRESGGNPNAVHAHANVKDAAGQLKHAIGDMRQTIAKVSSEQGAVQGMVDTISSSIAHTDVAVSSAHPGSSFADAQTRMTAYLEDIRRTAIEMPTLNTTDLGAASLNLSEKY-RLVAGDVRQAAGMLPEADIGQRLKLAVQ---KLGTSCIETVTVAGGKRAHPED--------------ERIQRQLSSQAGTVVERVEQVLAALHSASRGTQACINAANTVSGIIGDLDTTIMF-----ATSGSLNSSDDRKFPSH----KEAIVKTAKALVEDTKALVAGAASNQEQLAVAAQNAVRTIVNLSDAVKTGAVSLSSENS------------ETQVLVIHAVRDVAAALTSLIQATK-NASGLSLQHPAMGHLKDAAKVMVSNVARLLKTVATVEEKNQQGTRAVEAAVDAIGFEMKQFEH-----------DLNEGAAIPTDFRPEHLQQTAEHVSEITKRVM----------QGADAPQS--EEEIIGVANLSRSAVRSLLAVVR-TIS---NDADTAPQRY------AVLDSGRDVANNVK--------------SLLVSLHTQM---VRNPGQEESRRLLLE-ASKGVSSALSHLVGLCNEM--TGLPHNHEMESAAAQAENELLGAASSIEAASAKLAELRPRQIVQENTQEIVETEFDDNIIISAKGILHAVHTLMRSASNAQRELAMQGRAAAGGT----GTYQWSEGLISAARVVVASVHKLCDAANTLMKGQTTEERLISAAKQVSSSTAQLLVACNVRADPDSQANRRLQAAGQAVRNAAERLVQSAQQEMIARDDRNIAI-------SDRLVNGIAQVMDAQEEVLRKERELGEARHK 2172          

HSP 2 Score: 196.438 bits (498), Expect = 1.388e-49
Identity = 220/788 (27.92%), Postives = 365/788 (46.32%), Query Frame = 3
Query: 1083 MRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIG--QGNVNVQ----PQKFQIRDLSQ-PKRALMIRIGDNLKILKAATEDL--DKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQ-----LDETVAMICESIDKLKQHLIINSITA----HQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQT------LENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQ--ICSEAQEMTEIVLPEVILACTKIRENPIDPN-------AQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQA 3347
            MRVDE +K++++ WPL  VRR+  +A  FSLDFGDY D  Y +QTT+GEKIAQLI GY+DII+KK++ +D+   + +E + M+E+ VAP+KA +++H  I            AT G +  R   GV+   + G    I   N ++ G   G +  Q     Q+ + +D+ Q P+RAL+  I   ++ ++ A  +L  +  I++ +  +D S   + ++   + K  V   L +M  AT  ++     +E  D      R+  AIATIG N   +  N+R +         E    G+L++A K L  AF   LN                ++N E  A  N+    A   VGE S+ L++++          +    + L+  AK +A   + +V   K  S    E Q    Q  +I +A     ATS L++ A+VVA +I+    QQQL  +A +V  SV+N++       +    +YQQ     + E    +  ++D L +H   +  T      ++ +  + L  + R+    G S ++  +A+ +      L +   + A  Q P++            R+R        L DA  K+ HAT   +  +EQ       +E +  L  AA  +  V + T  E   Q + + LE A +QTA  A Q + ++  A     + +Y+  +  E+ + T   LP +I   T IRE+    N       AQ+ L+    K+++   +L +++    P V D  + S+L+ S     TSLADL+  V  A
Sbjct:    1 MRVDENSKQILKEWPLEQVRRWVPSAKCFSLDFGDYQDGYYSVQTTDGEKIAQLIQGYVDIILKKKRTQDHQGIEGDEGSTMLEDMVAPAKATLVAHGQIG-------SGQHATDGLVAVR---GVLRTPQGGQGYGI---NGAQYGAVSGEITSQELARAQRLRYQDMYQHPQRALIGTIEATIRAVEDAEIELEAEPQIDIPRFNDDYSQNRWMEEQQAVNKENVNERLAAMGAATAQVVQWTAVEEYDD------RVGTAIATIGSNLPDVSRNVRDLGAFM-----EHRERGDLLDATKKLCGAFGKFLN----------------TVNPETEARRNEVFRTA-GHVGETSQHLINVMEAPNEGQQKFD----ERLVQSAKNVATSTAQLVLCAKTISAECDEPQ---VQERVIQSATKCAFATSQLVACARVVAPTIDNNACQQQLSTAATEVTQSVNNLLH------DAEHAVYQQSSLTDIHEAARQVTSALDSLLEHAKCSPKTQTTRREEEEMYNEVLRRTNRMVVHQGPSEDLTREARKVVRHSQLLTEQFQHEAH-QRPEH------------RER--------LLDAAAKVAHATSEMILATEQAESQPRQVETEYALRTAAERLGQVTNETTQEQQEQHIMQRLEQAAKQTAYDATQTISAANSAKDVIESRSYKENLVYESTQ-TAGHLPNLI---TSIRESQKVDNTPGEKFKAQSRLIRDSYKVLETSVRLFETARTAVPMVSDSHLASSLDQSANRLGTSLADLRTSVNDA 709          
BLAST of Talin vs. Ensembl Celegans
Match: tln-1 (TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9])

HSP 1 Score: 308.145 bits (788), Expect = 1.106e-83
Identity = 347/1282 (27.07%), Postives = 595/1282 (46.41%), Query Frame = 3
Query: 4392 QQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKS---RASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQDLMENV----SSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARL-TETNNVAPLDA-ASAHTLIFQSIKGITDTVTD-NSLNK-DISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGE--EYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEH---RDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNK 8189
            Q+ C+++ R+++A+    + +  ++P+N+  Y   +QSV + S  L   M  +    K  D+  FC++++  + +   + +S + + Y +G+     S   SS     ++DS     SV S N  S     + ++   EL +DI S   ++SS+ QL +     + +P+ +  L+     VA  T +L+       R    E+   + A E +     QL   A   P       +I+ +G  AQ  I Q+S EM++ S  +++ A +     +     Q   +N +     + RL N +  +APGQ E       L  +   ++R+ MD ++     K  A +   +   +Q++Q    QL++ +  + N   +    E L + V      +  +++++   A +   S  + E+ +  KTV+EA LAM+          N      NV      LK    D+ + I  ++S  G ++ M+ +I  S A      ++  P  + A A T +   ++ I  T  +  +LN  D+    L   E   R+ A +  Q       AD+    K  V     L T  I+ ++         ED              + I+       G V  R+  ++  L S SRGTQ CI AAN+V+ ++ DLDT I+F          +NS +D+  P+     KE I K  K+LV D + +V      QE LA+A  NAVR    L  AVK+ A+++ S  S              Q L+++AVRDVA AL      TK N +  + +     +LK + + MV +V  L+K+V ++E+   +GTRA+E +++A+  E +  E+            + EG     +   +++  +++ +  +   V+          +   A Q+  +E+I+  AN+ R A+  L+  +R TI     +  + P R        V D  R    +VK                L+ ++  +   V    + ES ++ +  AS+ ++ ++  +     ++  T L    +  S  A AENELL AAS IE A+ K+A L+PR+ ++++T E  E  FD  II++   I+ A   L++ AS +Q+EL  QGR             QWS GLISAAR+V A+   L D+A  +++G+   +RLISA+KQV++ TA LL+AC V++D DS+ N+RLQAAG AV+ A E LV+ A +    RD ++ +I       +  +VN +  V+ AQ +++ KEREL   R+K
Sbjct:  712 QRECDAALRRIQAVYH--VTQHANVPLNDNGYFASLQSVSDGSRRLGEAMTGMARHAKGNDTEGFCTSVRDSADALCSLAESASHSAYLVGI-----SHPASSPGRAALIDSSEVARSVESINA-SCQRVESRQLNREELMSDISSITKQSSSLAQLCRIASEKTQNPNVKKHLVGCAMGVASKTSSLVTAFKDLDRMPDAESRCTSSASE-LRQVALQLLHFAD-KPDFAAIQGSISTEGHSAQQPILQSSREMLDSSAQMIQTAKSWASAPQDEATWQRMAVNSRQVSDSIMRLVNAIHEAAPGQMELEAAIGRLSALSGQIERSAMDCYASGNVQKHGANAERQL---LQQVQHIASQLEDKVDDLHNAAVEHG--ERLPKVVQLHCQMVEDLADAACCAAGMTVDSNQQTELFDKCKTVVEAELAMMVASRESGGNPNAVHAHANVKDAAGQLKHAIGDMRQTIAKVSSEQGAVQGMVDTISSSIAHTDVAVSSAHPGSSFADAQTRMTAYLEDIRRTAIEMPTLNTTDLGAASLNLSEK-YRLVAGDVRQAAGMLPEADIGQRLKLAVQ---KLGTSCIETVTVAGGKRAHPED--------------ERIQRQLSSQAGTVVERVEQVLAALHSASRGTQACINAANTVSGIIGDLDTTIMF-----ATSGSLNSSDDRKFPSH----KEAIVKTAKALVEDTKALVAGAASNQEQLAVAAQNAVRTIVNLSDAVKTGAVSLSSENS------------ETQVLVIHAVRDVAAALTSLIQATK-NASGLSLQHPAMGHLKDAAKVMVSNVARLLKTVATVEEKNQQGTRAVEAAVDAIGFEMKQFEH-----------DLNEGAAIPTDFRPEHLQQTAEHVSEITKRVM----------QGADAPQS--EEEIIGVANLSRSAVRSLLAVVR-TIS---NDADTAPQRY------AVLDSGRDVANNVK--------------SLLVSLHTQM---VRNPGQEESRRLLLE-ASKGVSSALSHLVGLCNEM--TGLPHNHEMESAAAQAENELLGAASSIEAASAKLAELRPRQIVQENTQEIVETEFDDNIIISAKGILHAVHTLMRSASNAQRELAMQGRAAAGGT----GTYQWSEGLISAARVVVASVHKLCDAANTLMKGQTTEERLISAAKQVSSSTAQLLVACNVRADPDSQANRRLQAAGQAVRNAAERLVQSAQQEMIARDDRNIAI-------SDRLVNGIAQVMDAQEEVLRKERELGEARHK 1874          

HSP 2 Score: 63.1586 bits (152), Expect = 3.526e-9
Identity = 96/377 (25.46%), Postives = 167/377 (44.30%), Query Frame = 3
Query: 2289 EAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQ-----LDETVAMICESIDKLKQHLIINSITA----HQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQT------LENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQ--ICSEAQEMTEIVLPEVILACTKIRENPIDPN-------AQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQA 3347
            + Q  +I +A     ATS L++ A+VVA +I+    QQQL  +A +V  SV+N++       +    +YQQ     + E    +  ++D L +H   +  T      ++ +  + L  + R+    G S ++  +A+ +      L +   + A  Q P++            R+R        L DA  K+ HAT   +  +EQ       +E +  L  AA  +  V + T  E   Q + + LE A +QTA  A Q + ++  A     + +Y+  +  E+ + T   LP +I   T IRE+    N       AQ+ L+    K+++   +L +++    P V D  + S+L+ S     TSLADL+  V  A
Sbjct:   66 QVQERVIQSATKCAFATSQLVACARVVAPTIDNNACQQQLSTAATEVTQSVNNLLH------DAEHAVYQQSSLTDIHEAARQVTSALDSLLEHAKCSPKTQTTRREEEEMYNEVLRRTNRMVVHQGPSEDLTREARKVVRHSQLLTEQFQHEAH-QRPEH------------RER--------LLDAAAKVAHATSEMILATEQAESQPRQVETEYALRTAAERLGQVTNETTQEQQEQHIMQRLEQAAKQTAYDATQTISAANSAKDVIESRSYKENLVYESTQ-TAGHLPNLI---TSIRESQKVDNTPGEKFKAQSRLIRDSYKVLETSVRLFETARTAVPMVSDSHLASSLDQSANRLGTSLADLRTSVNDA 411          
BLAST of Talin vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0333108)

HSP 1 Score: 925.62 bits (2391), Expect = 0.000e+0
Identity = 821/2776 (29.57%), Postives = 1397/2776 (50.32%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDIC---RDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDE-------NERMKTMTLKRGKTQIRDFD-KLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHL-PNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKF-QIR----DLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQ-NSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPLVTKFLSASERLPAAIGNSL--------EMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQR-LSKGLEFAGRQTALTADQLVLSSQEAAK-----TTRASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVA-NIANIEDG--QLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNN-LPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPNNQ--QQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNP-ILD--SLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRA----NMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLS----TTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKAN--EDNQILSQNKMA--------DVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKS--IKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRL--KPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDV-QDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQG 8210
            +LRI +     T +++   +T V+D C   RD F    Q +     E+GLF+SD  + +  WL+  + + YY L +++  L ++ + R L +R +D   KT+ VDDS+ +++L++ IC K+GI+NHEEY L+ E +E       + +  T+TLKR K   +D D K+E +++KLKTDDE+NW+   +TLR+ GIDE + +LLRR++FFSDQN+D+RDP+QLNLLYVQ ++AI+DGTHPV  ++A + AGIQ   + G     K K+   +LK+FLP+ YV+TKGI+KKI +++ K    S+ D KV+Y +  R L TYG+TFFLVKEK+  KNKLVPRL+G++K+ V+R+DE TKE++ +WPLTTVRR+ A+ + F+LDFGDY+++ Y +QTTE E+I QLI GYIDII+KK++ KD+   + +E + M+EE+VAPSKA  + H       L+ E  SLA  G + P  G+   + +  V + Q  A      +GQ N   QP    ++R    +L++P+RAL+  I     +L  A E+L     + +LG+D  S  +R+ TLD +K  V  ++ +M+ AT  ++     DE      D   I A+++ I     ++ + +R +  +     E D +G  L+EAA+ L +AF DLL A++P   ES           E P    + L+ A +RVGEA+  +L  I+ E+     DL     D LL  AK +AN  + +V   K  + +  + Q   A+  +I AA     ATS L++ AKVVA ++     ++QL A+A+ V  +V+++ ++          +   L      + +S+  + +H+ ++S   H +   T+ LS  E +   IG  +        EMV  A+ L +         + A L+QS +    Q     D+D +R L+ AA+ L DA  KLV A ++C      + +NQ  L +AA  +  +    A     +R L + LEF  +Q A  A Q + ++Q A +      T+ +  Q C    +     +P ++ +    R  P DPNAQ NL+ A ++ I+   Q+ KSS AL+P V D  I SA  +S          L QCV +  ++ +  R A     +E    +++ LH  +D   ++   G+L PLPG+T+E+ +  +  S+K       +L ++ L +  +Y      +      DF RS                G+AA    T  N  + +   DV+    ++I   +  +QG       A   + L ++  ++   +   V  IP  +E+D  +  +    E+   +        E    ++ ++ +QSE        +   G+++ S  + + L   ++    ++  +L   +++  +    +    +   L+ VS  S  LL   K + A  G  +       L  AA  V++SIN L+ A   + P  Q+ C+++ R +EAL+  L+ + P  PIN   Y  C++     S +L   +  +    K     +F  ++  ++ S   +++S +QA Y +G+         SS    P I+D   L      + ++C  ++S  +++       T I    S +C + ++   N+S+P  +N+ +   K+VA AT +L++ I +     +  + E  +  + +L  V+ + Q A  +  ++   K I+ +GR+AQ  + QA   +++G   +++AA +L     + P  Q   ++       + RL + ++  APGQ +  ++   L    R LD      N    S  + + ++  S  ++N        S  +L + + PI   ++ ++  E LG AV E   Y+ P+   +      + HS+ +  +I+ T++V+E+ + +VQ  +  +     T  +  L + +   +    +L + ++ I +  G +  ++  + +S  RLT+    + L+A+ + T +    + +       SL  +++     +  +  ++  +  ++ Q L+Q+ +         DV    +  V D    V+ +IQ  + GA     G  K             ++ R  +     +V  ++  ++  LQ+ SRGTQ CI AA++V+ ++ DLDT I+F          ++S+ D     S A  +E I +  K+LV D + +V    G Q+ LA A  NAV    QL  AVK  A ++GS                +Q +++NAV+DVA AL D  NCTK+  +  +  +    +LK S   MV +V  L+K+VK++ED   RGTRA+E ++EA+ +E R + +  P G    N+++                         E+L+ +T  +  A+ KA+AA  +  Q DI+ AAN+GR+AI++++   R ++     E +   SR                                 A  A+ + Y +L   +     N S   +M L SRR+A  + ++   A  LK +   D EDP     IAENELL AA+ I+ AAKK+A L+PR+   +K +  E   FD  I+ A   I+ A++ LV+ A+ +Q+EL+  G++  +P   ++  ++ QWS GLISAARLVAAAT +L ++A+ +V+G    + LIS +KQVAA TA LL+AC+VKS+ +S+  +RLQAAG+AV ++T+ LV  A +  +  ++ S+       N SMV+ M   I A++ ++ KE+ELE  R   +++R  
Sbjct:    5 SLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQP---SEYGLFISDEQNQQGVWLEPGRTLGYYILHNQD-TLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKR-KIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHETNRMEQLNVE--SLAHPGIMRPYDGERSYM-ENEVQTVQYGAF-----VGQVNHAHQPPTTKEVRISSVNLTEPQRALLGYISAGQDVLIRADEELRTKAPIQELGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASHPDE-----VDTEAISASVSQIAQTIPEVTKEVRLIAALM----ENDTSGDQLLEAARNLCSAFSDLLKAAEP---ESK----------EPP----QHLINAASRVGEATTHVLSTIAEEEVPENRDLH----DMLLALAKAVANTTAALVLRAKNIAASCDDEQ---ARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNE-ASNDPKLKADLLAAARDVSKSLTDMLEHVKLSS-REHANRTSTE-LSPVENV--IIGTDILVSTHDPQEMVRHARTLGQ---------TTAQLIQSIKGEADQQQ---DADMKRHLLSAAKQLADATAKLVEAARLCSSNPHDS-DNQNALRKAAEELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQHSQDHQTKETLLQDCKRVAD----TIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSKSSRALQPTVTD--IPSATQLS-----KGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHDVLDDTRQAAIAGQLRPLPGQTVENTADELRKSAKNVGIALSQLLSSVLHNQRSYAGAAGRDTALALGDFTRS--------------VHGVAA----TTQNPAIIDCADDVVTSSARLIEQAQRTLQG-------ASNPEALTQAGREVTGALSATVDCIPGQREVDVALRNVSELSEILSMS--------EFPPSSRPYATLQSELKQVAEQLSSAGGEIVVSYSSPALLAESSQNFAANYRDLLSVSMEMAGQTQEEEVRSHMIESLRHVSTQSCSLLSTAKSIAADPGQPNAK---NLLHAAARGVTESINQLVDASIQSAP-GQKECDNAMRNIEALR--LMLDYPHEPINELGYFDCVEQATGKSRNLGYAISEMINNAKQSQHVEFSQSVNNVNDSIQGLIESSSQAAYLIGVSHP------SSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQMISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQDIKAIEEQSAGGSRE--RLVDPLLEAVKAVRQYASSSEFSSVPAK-ISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAVNAQGLSQRRDNNLHGFSGQTMN--------SASELIDKLEPIR--MAGKNNAEQLGHAVGEISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKESAGNPRATHAHPRLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQ-SLLNASYSDTFVDYQTRMVARAKEIASLANEMNAKSSVEPSALPQLAVDMTQNYQQLTQDSVGASTTTSSPDVAMRIRTTVIDLGRSVSSMIQSSAGGARPNDAGAQK-------------EIARSAR-----EVSEKVAQVLAALQAGSRGTQACINAAHTVSGIIGDLDTTIMF-----ATAGTLHSDGD----GSFADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQP------------DSQVMVINAVKDVASALGDLINCTKL-ASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVEAISQEIRAMHSPPPVG----NTQV-----------------------GPEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRRAISEMLIVCR-SVAWNCAETEELRSRTLE------------------------------AGTAVGESYRDLLSGILH---NCSADDRMHL-SRRVAKCVTDLVAMARLLKGSDWIDPEDPT---VIAENELLGAAASIDAAAKKLASLRPRRQADVKIELDENMKFDEMILEAAKGIMGASAALVRAANAAQRELIDTGKVARRP---LTSSDDGQWSEGLISAARLVAAATHSLVEAAQNLVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAGRRLQAAGNAVIKSTDNLVHSAQQGLEAEEEHSLKI-----NTSMVDGMAQEINARSAVLRKEKELEEARQLLKNVRHA 2533          
BLAST of Talin vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0305210)

HSP 1 Score: 924.85 bits (2389), Expect = 0.000e+0
Identity = 821/2776 (29.57%), Postives = 1397/2776 (50.32%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDIC---RDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDE-------NERMKTMTLKRGKTQIRDFD-KLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHL-PNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKF-QIR----DLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQ-NSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPLVTKFLSASERLPAAIGNSL--------EMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQR-LSKGLEFAGRQTALTADQLVLSSQEAAK-----TTRASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVA-NIANIEDG--QLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNN-LPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPNNQ--QQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNP-ILD--SLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDR----ANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLS----TTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKAN--EDNQILSQNKMA--------DVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKS--IKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRL--KPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDV-QDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQG 8210
            +LRI +     T +++   +T V+D C   RD F    Q +     E+GLF+SD  + +  WL+  + + YY L +++  L ++ + R L +R +D   KT+ VDDS+ +++L++ IC K+GI+NHEEY L+ E +E       + +  T+TLKR K   +D D K+E +++KLKTDDE+NW+   +TLR+ GIDE + +LLRR++FFSDQN+D+RDP+QLNLLYVQ ++AI+DGTHPV  ++A + AGIQ   + G     K K+   +LK+FLP+ YV+TKGI+KKI +++ K    S+ D KV+Y +  R L TYG+TFFLVKEK+  KNKLVPRL+G++K+ V+R+DE TKE++ +WPLTTVRR+ A+ + F+LDFGDY+++ Y +QTTE E+I QLI GYIDII+KK++ KD+   + +E + M+EE+VAPSKA  + H       L+ E  SLA  G + P  G+   + +  V + Q  A      +GQ N   QP    ++R    +L++P+RAL+  I     +L  A E+L     + +LG+D  S  +R+ TLD +K  V  ++ +M+ AT  ++     DE      D   I A+++ I     ++ + +R +  +     E D +G  L+EAA+ L +AF DLL A++P   ES           E P    + L+ A +RVGEA+  +L  I+ E+     DL     D LL  AK +AN  + +V   K  + +  + Q   A+  +I AA     ATS L++ AKVVA ++     ++QL A+A+ V  +V+++ ++          +   L      + +S+  + +H+ ++S   H +   T+ LS  E +   IG  +        EMV  A+ L +         + A L+QS +    Q     D+D +R L+ AA+ L DA  KLV A ++C      + +NQ  L +AA  +  +    A     +R L + LEF  +Q A  A Q + ++Q A +      T+ +  Q C    +     +P ++ +    R  P DPNAQ NL+ A ++ I+   Q+ KSS AL+P V D  I SA  +S          L QCV +  ++ +  R A     +E    +++ LH  +D   ++   G+L PLPG+T+E+ +  +  S+K       +L ++ L +  +Y      +      DF RS                G+AA    T  N  + +   DV+    ++I   +  +QG       A   + L ++  ++   +   V  IP  +E+D  +  +    E+   +        E    ++ ++ +QSE        +   G+++ S  + + L   ++    ++  +L   +++  +    +    +   L+ VS  S  LL   K + A  G  +       L  AA  V++SIN L+ A   + P  Q+ C+++ R +EAL+  L+ + P  PIN   Y  C++     S +L   +  +    K     +F  ++  ++ S   +++S +QA Y +G+         SS    P I+D   L      + ++C  ++S  +++       T I    S +C + ++   N+S+P  +N+ +   K+VA AT +L++ I +     +  + E  +  + +L  V+ + Q A  +  ++   K I+ +GR+AQ  + QA   +++G   +++AA +L     + P  Q   ++       + RL + ++  APGQ +  ++   L    R LD      N    S  + + ++  S  ++N        S  +L + + PI   ++ ++  E LG AV E   Y+ P+   +      + HS+ +  +I+ T++V+E+ + +VQ  +  +     T  +  L + +   +    +L + ++ I +  G +  ++  + +S  RLT+    + L+A+ + T +    + +       SL  +++     +  +  ++  +  ++ Q L+Q+ +         DV    +  V D    V+ +IQ  + GA     G  K             ++ R  +     +V  ++  ++  LQ+ SRGTQ CI AA++V+ ++ DLDT I+F          ++S+ D     S A  +E I +  K+LV D + +V    G Q+ LA A  NAV    QL  AVK  A ++GS                +Q +++NAV+DVA AL D  NCTK+  +  +  +    +LK S   MV +V  L+K+VK++ED   RGTRA+E ++EA+ +E R + +  P G    N+++                         E+L+ +T  +  A+ KA+AA  +  Q DI+ AAN+GR+AI++++   R ++     E +   SR                                 A  A+ + Y +L   +     N S   +M L SRR+A  + ++   A  LK +   D EDP     IAENELL AA+ I+ AAKK+A L+PR+   +K +  E   FD  I+ A   I+ A++ LV+ A+ +Q+EL+  G++  +P   ++  ++ QWS GLISAARLVAAAT +L ++A+ +V+G    + LIS +KQVAA TA LL+AC+VKS+ +S+  +RLQAAG+AV ++T+ LV  A +  +  ++ S+       N SMV+ M   I A++ ++ KE+ELE  R   +++R  
Sbjct:    5 SLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQP---SEYGLFISDEQNQQGVWLEPGRTLGYYILHNQD-TLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKR-KIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHETNRMEQLNVE--SLAHPGIMRPYDGERSYM-ENEVQTVQYGAF-----VGQVNHAHQPPTTKEVRISSVNLTEPQRALLGYISAGQDVLIRADEELRTKAPIQELGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASHPDE-----VDTEAISASVSQIAQTIPEVTKEVRLIAALM----ENDTSGDQLLEAARNLCSAFSDLLKAAEP---ESK----------EPP----QHLINAASRVGEATTHVLSTIAEEEVPENRDLH----DMLLALAKAVANTTAALVLRAKNIAASCDDEQ---ARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNE-ASNDPKLKADLLAAARDVSKSLTDMLEHVKLSS-REHANRTSTE-LSPVENV--IIGTDILVSTHDPQEMVRHARTLGQ---------TTAQLIQSIKGEADQQQ---DADMKRHLLSAAKQLADATAKLVEAARLCSSNPHDS-DNQNALRKAAEELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQHSQDHQTKETLLQDCKRVAD----TIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSKSSRALQPTVTD--IPSATQLS-----KGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHDVLDDTRQAAIAGQLRPLPGQTVENTADELRKSAKNVGIALSQLLSSVLHNQRSYAGAAGRDTALALGDFTRS--------------VHGVAA----TTQNPAIIDCADDVVTSSARLIEQAQRTLQG-------ASNPEALTQAGREVTGALSATVDCIPGQREVDVALRNVSELSEILSMS--------EFPPSSRPYATLQSELKQVAEQLSSAGGEIVVSYSSPALLAESSQNFAANYRDLLSVSMEMAGQTQEEEVRSHMIESLRHVSTQSCSLLSTAKSIAADPGQPNAK---NLLHAAARGVTESINQLVDASIQSAP-GQKECDNAMRNIEALR--LMLDYPHEPINELGYFDCVEQATGKSRNLGYAISEMINNAKQSQHVEFSQSVNNVNDSIQGLIESSSQAAYLIGVSHP------SSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQMISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQDIKAIEEQSAGGSRE--RLVDPLLEAVKAVRQYASSSEFSSVPAK-ISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAVNAQGLSQRRDNNLHGFSGQTMN--------SASELIDKLEPIR--MAGKNNAEQLGHAVGEISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKESAGNPRATHAHPRLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQ-SLLNASYSDTFVDYQTRMVARAKEIASLANEMNAKSSVEPSALPQLAVDMTQNYQQLTQDSVGASTTTSSPDVAMRIRTTVIDLGRSVSSMIQSSAGGARPNDAGAQK-------------EIARSAR-----EVSEKVAQVLAALQAGSRGTQACINAAHTVSGIIGDLDTTIMF-----ATAGTLHSDGD----GSFADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQP------------DSQVMVINAVKDVASALGDLINCTKL-ASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVEAISQEIRAMHSPPPVG----NTQV-----------------------GPEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRRAISEMLIVCR-SVAWNCAETEELRSRTLE------------------------------AGTAVGESYRDLLSGILH---NCSADDRMHL-SRRVAKCVTDLVAMARLLKGSDWIDPEDPT---VIAENELLGAAASIDAAAKKLASLRPRRQADVKIELDENMKFDEMILEAAKGIMGASAALVRAANAAQRELIDTGKVARRP---LTSSDDGQWSEGLISAARLVAAATHSLVEAAQNLVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAGRRLQAAGNAVIKSTDNLVHSAQQGLEAEEEHSLKI-----NTSMVDGMAQEINARSAVLRKEKELEEARQLLKNVRHA 2533          
BLAST of Talin vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0333105)

HSP 1 Score: 924.85 bits (2389), Expect = 0.000e+0
Identity = 821/2776 (29.57%), Postives = 1397/2776 (50.32%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDIC---RDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDE-------NERMKTMTLKRGKTQIRDFD-KLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHL-PNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKF-QIR----DLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQ-NSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPLVTKFLSASERLPAAIGNSL--------EMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQR-LSKGLEFAGRQTALTADQLVLSSQEAAK-----TTRASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVA-NIANIEDG--QLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNN-LPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPNNQ--QQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNP-ILD--SLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDR----ANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLS----TTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKAN--EDNQILSQNKMA--------DVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKS--IKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRL--KPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDV-QDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQG 8210
            +LRI +     T +++   +T V+D C   RD F    Q +     E+GLF+SD  + +  WL+  + + YY L +++  L ++ + R L +R +D   KT+ VDDS+ +++L++ IC K+GI+NHEEY L+ E +E       + +  T+TLKR K   +D D K+E +++KLKTDDE+NW+   +TLR+ GIDE + +LLRR++FFSDQN+D+RDP+QLNLLYVQ ++AI+DGTHPV  ++A + AGIQ   + G     K K+   +LK+FLP+ YV+TKGI+KKI +++ K    S+ D KV+Y +  R L TYG+TFFLVKEK+  KNKLVPRL+G++K+ V+R+DE TKE++ +WPLTTVRR+ A+ + F+LDFGDY+++ Y +QTTE E+I QLI GYIDII+KK++ KD+   + +E + M+EE+VAPSKA  + H       L+ E  SLA  G + P  G+   + +  V + Q  A      +GQ N   QP    ++R    +L++P+RAL+  I     +L  A E+L     + +LG+D  S  +R+ TLD +K  V  ++ +M+ AT  ++     DE      D   I A+++ I     ++ + +R +  +     E D +G  L+EAA+ L +AF DLL A++P   ES           E P    + L+ A +RVGEA+  +L  I+ E+     DL     D LL  AK +AN  + +V   K  + +  + Q   A+  +I AA     ATS L++ AKVVA ++     ++QL A+A+ V  +V+++ ++          +   L      + +S+  + +H+ ++S   H +   T+ LS  E +   IG  +        EMV  A+ L +         + A L+QS +    Q     D+D +R L+ AA+ L DA  KLV A ++C      + +NQ  L +AA  +  +    A     +R L + LEF  +Q A  A Q + ++Q A +      T+ +  Q C    +     +P ++ +    R  P DPNAQ NL+ A ++ I+   Q+ KSS AL+P V D  I SA  +S          L QCV +  ++ +  R A     +E    +++ LH  +D   ++   G+L PLPG+T+E+ +  +  S+K       +L ++ L +  +Y      +      DF RS                G+AA    T  N  + +   DV+    ++I   +  +QG       A   + L ++  ++   +   V  IP  +E+D  +  +    E+   +        E    ++ ++ +QSE        +   G+++ S  + + L   ++    ++  +L   +++  +    +    +   L+ VS  S  LL   K + A  G  +       L  AA  V++SIN L+ A   + P  Q+ C+++ R +EAL+  L+ + P  PIN   Y  C++     S +L   +  +    K     +F  ++  ++ S   +++S +QA Y +G+         SS    P I+D   L      + ++C  ++S  +++       T I    S +C + ++   N+S+P  +N+ +   K+VA AT +L++ I +     +  + E  +  + +L  V+ + Q A  +  ++   K I+ +GR+AQ  + QA   +++G   +++AA +L     + P  Q   ++       + RL + ++  APGQ +  ++   L    R LD      N    S  + + ++  S  ++N        S  +L + + PI   ++ ++  E LG AV E   Y+ P+   +      + HS+ +  +I+ T++V+E+ + +VQ  +  +     T  +  L + +   +    +L + ++ I +  G +  ++  + +S  RLT+    + L+A+ + T +    + +       SL  +++     +  +  ++  +  ++ Q L+Q+ +         DV    +  V D    V+ +IQ  + GA     G  K             ++ R  +     +V  ++  ++  LQ+ SRGTQ CI AA++V+ ++ DLDT I+F          ++S+ D     S A  +E I +  K+LV D + +V    G Q+ LA A  NAV    QL  AVK  A ++GS                +Q +++NAV+DVA AL D  NCTK+  +  +  +    +LK S   MV +V  L+K+VK++ED   RGTRA+E ++EA+ +E R + +  P G    N+++                         E+L+ +T  +  A+ KA+AA  +  Q DI+ AAN+GR+AI++++   R ++     E +   SR                                 A  A+ + Y +L   +     N S   +M L SRR+A  + ++   A  LK +   D EDP     IAENELL AA+ I+ AAKK+A L+PR+   +K +  E   FD  I+ A   I+ A++ LV+ A+ +Q+EL+  G++  +P   ++  ++ QWS GLISAARLVAAAT +L ++A+ +V+G    + LIS +KQVAA TA LL+AC+VKS+ +S+  +RLQAAG+AV ++T+ LV  A +  +  ++ S+       N SMV+ M   I A++ ++ KE+ELE  R   +++R  
Sbjct:    5 SLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQP---SEYGLFISDEQNQQGVWLEPGRTLGYYILHNQD-TLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKR-KIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHETNRMEQLNVE--SLAHPGIMRPYDGERSYM-ENEVQTVQYGAF-----VGQVNHAHQPPTTKEVRISSVNLTEPQRALLGYISAGQDVLIRADEELRTKAPIQELGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASHPDE-----VDTEAISASVSQIAQTIPEVTKEVRLIAALM----ENDTSGDQLLEAARNLCSAFSDLLKAAEP---ESK----------EPP----QHLINAASRVGEATTHVLSTIAEEEVPENRDLH----DMLLALAKAVANTTAALVLRAKNIAASCDDEQ---ARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNE-ASNDPKLKADLLAAARDVSKSLTDMLEHVKLSS-REHANRTSTE-LSPVENV--IIGTDILVSTHDPQEMVRHARTLGQ---------TTAQLIQSIKGEADQQQ---DADMKRHLLSAAKQLADATAKLVEAARLCSSNPHDS-DNQNALRKAAEELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQHSQDHQTKETLLQDCKRVAD----TIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSKSSRALQPTVTD--IPSATQLS-----KGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHDVLDDTRQAAIAGQLRPLPGQTVENTADELRKSAKNVGIALSQLLSSVLHNQRSYAGAAGRDTALALGDFTRS--------------VHGVAA----TTQNPAIIDCADDVVTSSARLIEQAQRTLQG-------ASNPEALTQAGREVTGALSATVDCIPGQREVDVALRNVSELSEILSMS--------EFPPSSRPYATLQSELKQVAEQLSSAGGEIVVSYSSPALLAESSQNFAANYRDLLSVSMEMAGQTQEEEVRSHMIESLRHVSTQSCSLLSTAKSIAADPGQPNAK---NLLHAAARGVTESINQLVDASIQSAP-GQKECDNAMRNIEALR--LMLDYPHEPINELGYFDCVEQATGKSRNLGYAISEMINNAKQSQHVEFSQSVNNVNDSIQGLIESSSQAAYLIGVSHP------SSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQMISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQDIKAIEEQSAGGSRE--RLVDPLLEAVKAVRQYASSSEFSSVPAK-ISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAVNAQGLSQRRDNNLHGFSGQTMN--------SASELIDKLEPIR--MAGKNNAEQLGHAVGEISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKESAGNPRATHAHPRLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQ-SLLNASYSDTFVDYQTRMVARAKEIASLANEMNAKSSVEPSALPQLAVDMTQNYQQLTQDSVGASTTTSSPDVAMRIRTTVIDLGRSVSSMIQSSAGGARPNDAGAQK-------------EIARSAR-----EVSEKVAQVLAALQAGSRGTQACINAAHTVSGIIGDLDTTIMF-----ATAGTLHSDGD----GSFADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQP------------DSQVMVINAVKDVASALGDLINCTKL-ASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVEAISQEIRAMHSPPPVG----NTQV-----------------------GPEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRRAISEMLIVCR-SVAWNCAETEELRSRTLE------------------------------AGTAVGESYRDLLSGILH---NCSADDRMHL-SRRVAKCVTDLVAMARLLKGSDWIDPEDPT---VIAENELLGAAASIDAAAKKLASLRPRRQADVKIELDENMKFDEMILEAAKGIMGASAALVRAANAAQRELIDTGKVARRP---LTSSDDGQWSEGLISAARLVAAATHSLVEAAQNLVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAGRRLQAAGNAVIKSTDNLVHSAQQGLEAEEEHSLKI-----NTSMVDGMAQEINARSAVLRKEKELEEARQLLKNVRHA 2533          
BLAST of Talin vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0333106)

HSP 1 Score: 924.85 bits (2389), Expect = 0.000e+0
Identity = 821/2776 (29.57%), Postives = 1397/2776 (50.32%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDIC---RDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDE-------NERMKTMTLKRGKTQIRDFD-KLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHL-PNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKF-QIR----DLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQ-NSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPLVTKFLSASERLPAAIGNSL--------EMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQR-LSKGLEFAGRQTALTADQLVLSSQEAAK-----TTRASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVA-NIANIEDG--QLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNN-LPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPNNQ--QQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNP-ILD--SLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDR----ANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLS----TTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKAN--EDNQILSQNKMA--------DVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKS--IKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRL--KPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDV-QDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQG 8210
            +LRI +     T +++   +T V+D C   RD F    Q +     E+GLF+SD  + +  WL+  + + YY L +++  L ++ + R L +R +D   KT+ VDDS+ +++L++ IC K+GI+NHEEY L+ E +E       + +  T+TLKR K   +D D K+E +++KLKTDDE+NW+   +TLR+ GIDE + +LLRR++FFSDQN+D+RDP+QLNLLYVQ ++AI+DGTHPV  ++A + AGIQ   + G     K K+   +LK+FLP+ YV+TKGI+KKI +++ K    S+ D KV+Y +  R L TYG+TFFLVKEK+  KNKLVPRL+G++K+ V+R+DE TKE++ +WPLTTVRR+ A+ + F+LDFGDY+++ Y +QTTE E+I QLI GYIDII+KK++ KD+   + +E + M+EE+VAPSKA  + H       L+ E  SLA  G + P  G+   + +  V + Q  A      +GQ N   QP    ++R    +L++P+RAL+  I     +L  A E+L     + +LG+D  S  +R+ TLD +K  V  ++ +M+ AT  ++     DE      D   I A+++ I     ++ + +R +  +     E D +G  L+EAA+ L +AF DLL A++P   ES           E P    + L+ A +RVGEA+  +L  I+ E+     DL     D LL  AK +AN  + +V   K  + +  + Q   A+  +I AA     ATS L++ AKVVA ++     ++QL A+A+ V  +V+++ ++          +   L      + +S+  + +H+ ++S   H +   T+ LS  E +   IG  +        EMV  A+ L +         + A L+QS +    Q     D+D +R L+ AA+ L DA  KLV A ++C      + +NQ  L +AA  +  +    A     +R L + LEF  +Q A  A Q + ++Q A +      T+ +  Q C    +     +P ++ +    R  P DPNAQ NL+ A ++ I+   Q+ KSS AL+P V D  I SA  +S          L QCV +  ++ +  R A     +E    +++ LH  +D   ++   G+L PLPG+T+E+ +  +  S+K       +L ++ L +  +Y      +      DF RS                G+AA    T  N  + +   DV+    ++I   +  +QG       A   + L ++  ++   +   V  IP  +E+D  +  +    E+   +        E    ++ ++ +QSE        +   G+++ S  + + L   ++    ++  +L   +++  +    +    +   L+ VS  S  LL   K + A  G  +       L  AA  V++SIN L+ A   + P  Q+ C+++ R +EAL+  L+ + P  PIN   Y  C++     S +L   +  +    K     +F  ++  ++ S   +++S +QA Y +G+         SS    P I+D   L      + ++C  ++S  +++       T I    S +C + ++   N+S+P  +N+ +   K+VA AT +L++ I +     +  + E  +  + +L  V+ + Q A  +  ++   K I+ +GR+AQ  + QA   +++G   +++AA +L     + P  Q   ++       + RL + ++  APGQ +  ++   L    R LD      N    S  + + ++  S  ++N        S  +L + + PI   ++ ++  E LG AV E   Y+ P+   +      + HS+ +  +I+ T++V+E+ + +VQ  +  +     T  +  L + +   +    +L + ++ I +  G +  ++  + +S  RLT+    + L+A+ + T +    + +       SL  +++     +  +  ++  +  ++ Q L+Q+ +         DV    +  V D    V+ +IQ  + GA     G  K             ++ R  +     +V  ++  ++  LQ+ SRGTQ CI AA++V+ ++ DLDT I+F          ++S+ D     S A  +E I +  K+LV D + +V    G Q+ LA A  NAV    QL  AVK  A ++GS                +Q +++NAV+DVA AL D  NCTK+  +  +  +    +LK S   MV +V  L+K+VK++ED   RGTRA+E ++EA+ +E R + +  P G    N+++                         E+L+ +T  +  A+ KA+AA  +  Q DI+ AAN+GR+AI++++   R ++     E +   SR                                 A  A+ + Y +L   +     N S   +M L SRR+A  + ++   A  LK +   D EDP     IAENELL AA+ I+ AAKK+A L+PR+   +K +  E   FD  I+ A   I+ A++ LV+ A+ +Q+EL+  G++  +P   ++  ++ QWS GLISAARLVAAAT +L ++A+ +V+G    + LIS +KQVAA TA LL+AC+VKS+ +S+  +RLQAAG+AV ++T+ LV  A +  +  ++ S+       N SMV+ M   I A++ ++ KE+ELE  R   +++R  
Sbjct:    5 SLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQP---SEYGLFISDEQNQQGVWLEPGRTLGYYILHNQD-TLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKR-KIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHETNRMEQLNVE--SLAHPGIMRPYDGERSYM-ENEVQTVQYGAF-----VGQVNHAHQPPTTKEVRISSVNLTEPQRALLGYISAGQDVLIRADEELRTKAPIQELGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASHPDE-----VDTEAISASVSQIAQTIPEVTKEVRLIAALM----ENDTSGDQLLEAARNLCSAFSDLLKAAEP---ESK----------EPP----QHLINAASRVGEATTHVLSTIAEEEVPENRDLH----DMLLALAKAVANTTAALVLRAKNIAASCDDEQ---ARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNE-ASNDPKLKADLLAAARDVSKSLTDMLEHVKLSS-REHANRTSTE-LSPVENV--IIGTDILVSTHDPQEMVRHARTLGQ---------TTAQLIQSIKGEADQQQ---DADMKRHLLSAAKQLADATAKLVEAARLCSSNPHDS-DNQNALRKAAEELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQHSQDHQTKETLLQDCKRVAD----TIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSKSSRALQPTVTD--IPSATQLS-----KGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHDVLDDTRQAAIAGQLRPLPGQTVENTADELRKSAKNVGIALSQLLSSVLHNQRSYAGAAGRDTALALGDFTRS--------------VHGVAA----TTQNPAIIDCADDVVTSSARLIEQAQRTLQG-------ASNPEALTQAGREVTGALSATVDCIPGQREVDVALRNVSELSEILSMS--------EFPPSSRPYATLQSELKQVAEQLSSAGGEIVVSYSSPALLAESSQNFAANYRDLLSVSMEMAGQTQEEEVRSHMIESLRHVSTQSCSLLSTAKSIAADPGQPNAK---NLLHAAARGVTESINQLVDASIQSAP-GQKECDNAMRNIEALR--LMLDYPHEPINELGYFDCVEQATGKSRNLGYAISEMINNAKQSQHVEFSQSVNNVNDSIQGLIESSSQAAYLIGVSHP------SSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQMISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQDIKAIEEQSAGGSRE--RLVDPLLEAVKAVRQYASSSEFSSVPAK-ISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAVNAQGLSQRRDNNLHGFSGQTMN--------SASELIDKLEPIR--MAGKNNAEQLGHAVGEISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKESAGNPRATHAHPRLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQ-SLLNASYSDTFVDYQTRMVARAKEIASLANEMNAKSSVEPSALPQLAVDMTQNYQQLTQDSVGASTTTSSPDVAMRIRTTVIDLGRSVSSMIQSSAGGARPNDAGAQK-------------EIARSAR-----EVSEKVAQVLAALQAGSRGTQACINAAHTVSGIIGDLDTTIMF-----ATAGTLHSDGD----GSFADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQP------------DSQVMVINAVKDVASALGDLINCTKL-ASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVEAISQEIRAMHSPPPVG----NTQV-----------------------GPEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRRAISEMLIVCR-SVAWNCAETEELRSRTLE------------------------------AGTAVGESYRDLLSGILH---NCSADDRMHL-SRRVAKCVTDLVAMARLLKGSDWIDPEDPT---VIAENELLGAAASIDAAAKKLASLRPRRQADVKIELDENMKFDEMILEAAKGIMGASAALVRAANAAQRELIDTGKVARRP---LTSSDDGQWSEGLISAARLVAAATHSLVEAAQNLVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAGRRLQAAGNAVIKSTDNLVHSAQQGLEAEEEHSLKI-----NTSMVDGMAQEINARSAVLRKEKELEEARQLLKNVRHA 2533          
BLAST of Talin vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0333107)

HSP 1 Score: 920.228 bits (2377), Expect = 0.000e+0
Identity = 814/2770 (29.39%), Postives = 1388/2770 (50.11%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDIC---RDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDE-------NERMKTMTLKRGKTQIRDFD-KLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQ-NSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPLVTKFLSASERLPAAIGNSL--------EMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQR-LSKGLEFAGRQTALTADQLVLSSQEAAK-----TTRASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVA-NIANIEDG--QLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNN-LPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPNNQ--QQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNP-ILD--SLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRA----NMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLS----TTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKAN--EDNQILSQNKMA--------DVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKS--IKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRL--KPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDV-QDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQG 8210
            +LRI +     T +++   +T V+D C   RD F    Q +     E+GLF+SD  + +  WL+  + + YY L +++  L ++ + R L +R +D   KT+ VDDS+ +++L++ IC K+GI+NHEEY L+ E +E       + +  T+TLKR K   +D D K+E +++KLKTDDE+NW+   +TLR+ GIDE + +LLRR++FFSDQN+D+RDP+QLNLLYVQ ++AI+DGTHPV  ++A + AGIQ   + G     K K+   +LK+FLP+ YV+TKGI+KKI +++ K    S+ D KV+Y +  R L TYG+TFFLVKEK+  KNKLVPRL+G++K+ V+R+DE TKE++ +WPLTTVRR+ A+ + F+LDFGDY+++ Y +QTTE E+I QLI GYIDII+KK++ KD+   + +E + M+EE+VAPSKA  + H       L+ E  SLA  G          + +    S  P+  +   ++   +VN          L++P+RAL+  I     +L  A E+L     + +LG+D  S  +R+ TLD +K  V  ++ +M+ AT  ++     DE      D   I A+++ I     ++ + +R +  +     E D +G  L+EAA+ L +AF DLL A++P   ES           E P    + L+ A +RVGEA+  +L  I+ E+     DL     D LL  AK +AN  + +V   K  + +  + Q   A+  +I AA     ATS L++ AKVVA ++     ++QL A+A+ V  +V+++ ++          +   L      + +S+  + +H+ ++S   H +   T+ LS  E +   IG  +        EMV  A+ L +         + A L+QS +    Q     D+D +R L+ AA+ L DA  KLV A ++C      + +NQ  L +AA  +  +    A     +R L + LEF  +Q A  A Q + ++Q A +      T+ +  Q C    +     +P ++ +    R  P DPNAQ NL+ A ++ I+   Q+ KSS AL+P V D  I SA  +S          L QCV +  ++ +  R A     +E    +++ LH  +D   ++   G+L PLPG+T+E+ +  +  S+K       +L ++ L +  +Y      +      DF RS                G+AA    T  N  + +   DV+    ++I   +  +QG       A   + L ++  ++   +   V  IP  +E+D  +  +    E+   +        E    ++ ++ +QSE        +   G+++ S  + + L   ++    ++  +L   +++  +    +    +   L+ VS  S  LL   K + A  G  +       L  AA  V++SIN L+ A   + P  Q+ C+++ R +EAL+  L+ + P  PIN   Y  C++     S +L   +  +    K     +F  ++  ++ S   +++S +QA Y +G+         SS    P I+D   L      + ++C  ++S  +++       T I    S +C + ++   N+S+P  +N+ +   K+VA AT +L++ I +     +  + E  +  + +L  V+ + Q A  +  ++   K I+ +GR+AQ  + QA   +++G   +++AA +L     + P  Q   ++       + RL + ++  APGQ +  ++   L    R LD      N    S  + + ++  S  ++N        S  +L + + PI   ++ ++  E LG AV E   Y+ P+   +      + HS+ +  +I+ T++V+E+ + +VQ  +  +     T  +  L + +   +    +L + ++ I +  G +  ++  + +S  RLT+    + L+A+ + T +    + +       SL  +++     +  +  ++  +  ++ Q L+Q+ +         DV    +  V D    V+ +IQ  + GA     G  K             ++ R  +     +V  ++  ++  LQ+ SRGTQ CI AA++V+ ++ DLDT I+F          ++S+ D     S A  +E I +  K+LV D + +V    G Q+ LA A  NAV    QL  AVK  A ++GS                +Q +++NAV+DVA AL D  NCTK+  +  +  +    +LK S   MV +V  L+K+VK++ED   RGTRA+E ++EA+ +E R + +  P G    N+++                         E+L+ +T  +  A+ KA+AA  +  Q DI+ AAN+GR+AI++++   R ++     E +   SR                                 A  A+ + Y +L   +     N S   +M L SRR+A  + ++   A  LK +   D EDP     IAENELL AA+ I+ AAKK+A L+PR+   +K +  E   FD  I+ A   I+ A++ LV+ A+ +Q+EL+  G++  +P   ++  ++ QWS GLISAARLVAAAT +L ++A+ +V+G    + LIS +KQVAA TA LL+AC+VKS+ +S+  +RLQAAG+AV ++T+ LV  A +  +  ++ S+       N SMV+ M   I A++ ++ KE+ELE  R   +++R  
Sbjct:    5 SLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQP---SEYGLFISDEQNQQGVWLEPGRTLGYYILHNQD-TLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKR-KIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHETNRMEQLNVE--SLAHPG----------IMRPYDASGHPMFYKT-KEVRISSVN----------LTEPQRALLGYISAGQDVLIRADEELRTKAPIQELGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASHPDE-----VDTEAISASVSQIAQTIPEVTKEVRLIAALM----ENDTSGDQLLEAARNLCSAFSDLLKAAEP---ESK----------EPP----QHLINAASRVGEATTHVLSTIAEEEVPENRDLH----DMLLALAKAVANTTAALVLRAKNIAASCDDEQ---ARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNE-ASNDPKLKADLLAAARDVSKSLTDMLEHVKLSS-REHANRTSTE-LSPVENV--IIGTDILVSTHDPQEMVRHARTLGQ---------TTAQLIQSIKGEADQQQ---DADMKRHLLSAAKQLADATAKLVEAARLCSSNPHDS-DNQNALRKAAEELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQHSQDHQTKETLLQDCKRVAD----TIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSKSSRALQPTVTD--IPSATQLS-----KGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHDVLDDTRQAAIAGQLRPLPGQTVENTADELRKSAKNVGIALSQLLSSVLHNQRSYAGAAGRDTALALGDFTRS--------------VHGVAA----TTQNPAIIDCADDVVTSSARLIEQAQRTLQG-------ASNPEALTQAGREVTGALSATVDCIPGQREVDVALRNVSELSEILSMS--------EFPPSSRPYATLQSELKQVAEQLSSAGGEIVVSYSSPALLAESSQNFAANYRDLLSVSMEMAGQTQEEEVRSHMIESLRHVSTQSCSLLSTAKSIAADPGQPNAK---NLLHAAARGVTESINQLVDASIQSAP-GQKECDNAMRNIEALR--LMLDYPHEPINELGYFDCVEQATGKSRNLGYAISEMINNAKQSQHVEFSQSVNNVNDSIQGLIESSSQAAYLIGVSHP------SSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQMISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQDIKAIEEQSAGGSRE--RLVDPLLEAVKAVRQYASSSEFSSVPAK-ISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAVNAQGLSQRRDNNLHGFSGQTMN--------SASELIDKLEPIR--MAGKNNAEQLGHAVGEISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKESAGNPRATHAHPRLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQ-SLLNASYSDTFVDYQTRMVARAKEIASLANEMNAKSSVEPSALPQLAVDMTQNYQQLTQDSVGASTTTSSPDVAMRIRTTVIDLGRSVSSMIQSSAGGARPNDAGAQK-------------EIARSAR-----EVSEKVAQVLAALQAGSRGTQACINAAHTVSGIIGDLDTTIMF-----ATAGTLHSDGD----GSFADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQP------------DSQVMVINAVKDVASALGDLINCTKL-ASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVEAISQEIRAMHSPPPVG----NTQV-----------------------GPEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRRAISEMLIVCR-SVAWNCAETEELRSRTLE------------------------------AGTAVGESYRDLLSGILH---NCSADDRMHL-SRRVAKCVTDLVAMARLLKGSDWIDPEDPT---VIAENELLGAAASIDAAAKKLASLRPRRQADVKIELDENMKFDEMILEAAKGIMGASAALVRAANAAQRELIDTGKVARRP---LTSSDDGQWSEGLISAARLVAAATHSLVEAAQNLVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAGRRLQAAGNAVIKSTDNLVHSAQQGLEAEEEHSLKI-----NTSMVDGMAQEINARSAVLRKEKELEEARQLLKNVRHA 2512          
BLAST of Talin vs. Ensembl Zebrafish
Match: tln1 (talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48])

HSP 1 Score: 993.416 bits (2567), Expect = 0.000e+0
Identity = 858/2777 (30.90%), Postives = 1416/2777 (50.99%), Query Frame = 3
Query:   69 MHTLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTM-TLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDS--KIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLN-NYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAID---ELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPN--NQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXX--XXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRE-----LATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG-VLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNN-------QDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDA-ASAHTLIFQSIKGITDT----VTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMA-------DVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVR---SRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRS---NLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIR-VTIDMKLKEE-KSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLA--SRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHR-DVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            M  L + I   N   +++ +  TVVYD CR + +R+P+ +     ++GLF+SD D  +  WL+  K + YY L  GD    L +K + R L IR +D T KT+ VDDSK ++++++ IC ++GI+N++EYSL+ ++ E ++ +T  TLKR KT +RD  K+EK+KQKL TDDELNWL HG+TLR+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A + AG QCQ + G+    K K    +LKEFLPKEYVK KG +K+I   ++     ++ + KV Y +L RSLKTYG++FFLVKEK++ KNKLVPRL+GI+KE VMRVDEKTKE+IQ W LT ++R+AA+   F+LDFGDY D  Y +QTTEGE+IAQLI GYIDII+KK+K+KD+   + +EE+ M+E++V+P K+ V+   F          N +  +      G + + +  R G+  P +++  S  +  Q   + Q  +  +  L+  ++AL   I  +++ ++A    LD+   +  LG D +S+ +RK  +D +K  +   + ++T  T +++ +   D       DY  +  A+ TI  N  ++ + ++ +  +    ++E  NG  L+ AAK L  A  D+L  ++P + E                   + L++A   VG+AS  LL  I       SD +   +D L+  AK +AN  +    ++K  +VA K ++ +  Q  +I AA     +TS L++  +VVA +I  P+ Q+QL  + + V  SV+  ++          ++ +Q+      + +++++L QH  I    +   P+        + L  ++ + +++G++ EMV QA+ILA+A ++L + +   A  +S            D +  R+L+ AA+ L DA  ++V A K      + + E QQ L +AA  +    +  A   I++RL   LE A +Q A  A Q + ++Q AA + +  A+  Q+    + + + + P+++      +  P  P+AQ  L+ A Q  +Q   +++ +++A  P + D +    L+   +N  ++LA+L+   Q+A     P  + N   +  G    L   M  A  S A G+L PLPGET+E  S  +GSS+KA S    +L +     N NY         G+      +A+++ +++  L   ARG+AA     ++ + L    +  +DC   ++     +I+  K A  +    D    L +    + + ++  V  +P  +++D   + +++  E   K + +  P        K+  + Q+    A A  NQ+  +L+  S  T   L   + +  +  +  L  G+ +  +  +  +Q Q+ + LK++S +S+       LL A + S+D N    K  L  AA  V+DSIN L+S C    P  Q+ C+++ R+LE +   L  E P+  +N+  Y  C+ SV E S+ L   M  I    K  +  +F  ++   S +   + ++  Q  Y +G+   N+       V +P      Q A   +K  I MA  N  +  C +      AT +    S++C   +   + +S+P  + + + + K VA +T NL+K+I +   + + EN +  K   G ++  V+ LT  A     +NP   ++  Q    G  A   I  A+  M+E S  L++ A +L  + K  P       + +T    + +L   ++  APGQRE  +  E L   +R +D+A++       S ++  + + S  +  ++M  S+ ++ N I P+   ++ ++    LG  V +  SY  P+  ++   A  + +S+ +  V++ TKT+ E+ L M+    T   T  N       + L E+V  +K   DDL   +  +AS  G +  M+ SI +S  ++ +     P        T + ++ K I  T    VT ++ N D  +  L  + +T      E   + S+ K A       ++    KK V +     TG++    +GA                    C     Y +KE I   R    +++ ++  LQ+ +RGTQ CI AA++V+ ++ADLDT I+F          +N EN +   +    I E I K  K LV D + +V      QE LA A  ++V    +L   VK  A ++GS            E    Q +L+NAV+DVA AL D  + TK    A   K  D      LK+S + MV +V  L+K+VK++ED   +GTRALE ++E +++E     +  P                              K  + E  + MTK + LA+ KA+AA  + +QED++  AN+ R+A+ D++   +      ++K E +++  R  SE                  + + ++EH    V  +I              +  SH ++  LA  S+R+A S+ E+ ++A  +K T   D EDP     IAENELL AA+ IE AAKK+  LKPR +  K+  E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A + VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+T +RLQAAG+AVKRA++ LVK A +   + QD             MV  +  +I AQ +++ KE+ELE  R K   IRQ
Sbjct:    1 MVALSLKIGVGNVVKTMQFEPSTVVYDACRIIRERVPEAQLGQPSDYGLFLSDDDPKKGIWLEAGKALDYYMLRNGD---TLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIGITNYDEYSLVRDVGEEKKEETTGTLKRDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTLREQGVEESEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGDHNESKHKPGFLDLKEFLPKEYVKNKG-EKRIFQAHKNCQNMTEIEAKVNYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQF----------NKMGKV----ETGSVALPAIIRSGAGGPESMKMGSMPQAKQHITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAVQASLDEFDALPPLGTDSASQAWRKNKMDESKHEIHSQVDAITAGTASMVNLTAGDP---AETDYTAVGCAVTTISSNLTEMSKGVKLLAAL---MEDEGGNGQQLLGAAKNLACAVSDMLKTAQPSSTE-----------------PRQNLLQAAGNVGQASGELLQQIGE-----SDADQHFQDMLMQLAKAVANAAA--ALVLKAKNVAQK-SEDSAQQNKVIAAATQCALSTSQLVACTRVVAPTISSPVCQEQLIEAGKLVAKSVEGCVEASHGATGDEHLL-KQVGAAATGVTQALNELLQH--IRQYASGGQPIGRHGEATDRILDVTDNIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGES------------DLENSRKLLSAAKLLADATARMVEAAKGAAANPD-SEEQQQKLREAAEGLRMATNAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASSNKNPAAQQQLVQSCKVVADQI-PQLVQGLRSSQAQPDSPSAQLALIGASQNFLQPGAKMVTAAKATVPTISDQASAMQLSQCAKNLASALAELRTAAQKAQEACGPLEIDNALTMVRG----LERDMQEAKASAAEGKLRPLPGETLEKCSQDLGSSTKAVSSAIAQLLSEATQGNENY--------TGM------AARDVAQALRSLASAARGVAA-----NTEDPLARNAM--LDCTGDVMDKSASLIEETKRAIAKPGDPDSQQRLAQVAKAVSQALNRSVNCLPGQRDVD---NAIRTVGEASKKLLSDKFPA-----SGKNFQEAQANLNEAAAGLNQSANELVQASRGTTQDLAKASGKFGQDFNQFLQAGVDMAGQSQSKEDQTQVVTNLKTISMSSS-----KLLLAAKALSTDPNSPNLKNQLAAAARAVTDSINQLISMCTQQAP-GQKECDNALRELETVGGML--ENPTEAVNDLGYFDCIDSVMENSKVLGEAMAGISHNAKNSNLPEFGDSVSSASKALCGLTEAAAQGAYLVGVSDPNSHAGQKGLV-DP-----SQFAR--AKQSIQMACQNLVDPACTQSQVLSAATIVAKHTSALCNACRLASSKTSNPVAKRQFVQSAKEVANSTANLVKSIKAIDGAFNQENRQKCKEATGPLIEAVDNLTAFA-----SNPEFASVPAQISPEGLAAMEPITAAAKAMLESSTGLIQTARSLAVNPKDPPKWSVLAGHSRTVSDSIKKLITNMREKAPGQRECDDAIEVLSNCIREVDKASLAAI----SQQLTPRDDISHEALHEQMAASVHEISNLIEPV--AIAARADASQLGHKVSQMVSYFEPLIMAAIGTASKILNSQQQMNVLDQTKTLAESALQMLY---TAKETGGNHKAAHTQEALEESVQMMKEAVDDLGSTLAEVASAAGAVGGMVNSITQSINKMEDGPAFEPEGTFVDYQTTMVKTAKAIAVTVQEMVTKSNTNPD-ELGGLANQLTT------EFGDLASEAKCAAMTAENDEIGSHIKKQVTELGYTCTGLVS--KAGALQ------------------CSPNDSYTKKELIDSARKVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMF-----ATAGTLNRENAETFADHRYYI-EHILKTAKVLVEDTKLLVSGAGASQEKLAQAAQSSVNTITKLADVVKLGAASLGS------------EDPETQVVLINAVKDVAKALGDLISATK----AAAGKPHDDPAMLQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATIEHIKQELAVFSSADP----------------------------PPKTATPEEFIRMTKGITLATAKAVAAGNSCRQEDVIATANLSRRAVADMLRSCKQAAYHPEVKREVQTRALRFGSE---------------CSTSYLGLLEH----VLVII--------------QKPSHDLKQQLANYSKRVASSVTELIQAAEAMKGTEWVDPEDPT---VIAENELLGAAAAIEAAAKKLEQLKPR-AKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAV---DDGQWSQGLISAARMVAAATNNLCEAANSAVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSQTMKRLQAAGNAVKRASDNLVKAAQKAAFEAQDDQAVMV----KSKMVGGIAQIIAAQEEMLRKEKELEEARKKLAMIRQ 2527          
BLAST of Talin vs. Ensembl Zebrafish
Match: tln1 (talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48])

HSP 1 Score: 981.089 bits (2535), Expect = 0.000e+0
Identity = 856/2778 (30.81%), Postives = 1414/2778 (50.90%), Query Frame = 3
Query:   69 MHTLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTM-TLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDS--KIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAK-VVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLN-NYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAID---ELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPN--NQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXX--XXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRE-----LATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG-VLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNN-------QDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDA-ASAHTLIFQSIKGITDT----VTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMA-------DVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVR---SRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRS---NLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIR-VTIDMKLKEE-KSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLA--SRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHR-DVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            M  L + I   N   +++ +  TVVYD CR + +R+P+ +     ++GLF+SD D  +  WL+  K + YY L  GD    L +K + R L IR +D T KT+ VDDSK ++++++ IC ++GI+N++EYSL+ ++ E ++ +T  TLKR KT +RD  K+EK+KQKL TDDELNWL HG+TLR+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A + AG QCQ + G+    K K    +LKEFLPKEYVK KG +K+I   ++     ++ + KV Y +L RSLKTYG++FFLVKEK++ KNKLVPRL+GI+KE VMRVDEKTKE+IQ W LT ++R+AA+      DFGDY D  Y +QTTEGE+IAQLI GYIDII+KK+K+KD+   + +EE+ M+E++V+P K+ V+   F          N +  +      G + + +  R G+  P +++  S  +  Q   + Q  +  +  L+  ++AL   I  +++ ++A    LD+   +  LG D +S+ +RK  +D +K  +   + ++T  T +++ +   D       DY  +  A+ TI  N  ++ + ++ +  +    ++E  NG  L+ AAK L  A  D+L  ++P + E                   + L++A   VG+AS  LL  I       SD +   +D L+  AK +AN  +    ++K  +VA K ++ +  Q  +I AA     +TS L++  + VVA +I  P+ Q+QL  + + V  SV+  ++          ++ +Q+      + +++++L QH  I    +   P+        + L  ++ + +++G++ EMV QA+ILA+A ++L + +   A  +S            D +  R+L+ AA+ L DA  ++V A K      + + E QQ L +AA  +    +  A   I++RL   LE A +Q A  A Q + ++Q AA + +  A+  Q+    + + + + P+++      +  P  P+AQ  L+ A Q  +Q   +++ +++A  P + D +    L+   +N  ++LA+L+   Q+A     P  + N   +  G    L   M  A  S A G+L PLPGET+E  S  +GSS+KA S    +L +     N NY         G+      +A+++ +++  L   ARG+AA     ++ + L    +  +DC   ++     +I+  K A  +    D    L +    + + ++  V  +P  +++D   + +++  E   K + +  P        K+  + Q+    A A  NQ+  +L+  S  T   L   + +  +  +  L  G+ +  +  +  +Q Q+ + LK++S +S+       LL A + S+D N    K  L  AA  V+DSIN L+S C    P  Q+ C+++ R+LE +   L  E P+  +N+  Y  C+ SV E S+ L   M  I    K  +  +F  ++   S +   + ++  Q  Y +G+   N+       V +P      Q A   +K  I MA  N  +  C +      AT +    S++C   +   + +S+P  + + + + K VA +T NL+K+I +   + + EN +  K   G ++  V+ LT  A     +NP   ++  Q    G  A   I  A+  M+E S  L++ A +L  + K  P       + +T    + +L   ++  APGQRE  +  E L   +R +D+A++       S ++  + + S  +  ++M  S+ ++ N I P+   ++ ++    LG  V +  SY  P+  ++   A  + +S+ +  V++ TKT+ E+ L M+    T   T  N       + L E+V  +K   DDL   +  +AS  G +  M+ SI +S  ++ +     P        T + ++ K I  T    VT ++ N D  +  L  + +T      E   + S+ K A       ++    KK V +     TG++    +GA                    C     Y +KE I   R    +++ ++  LQ+ +RGTQ CI AA++V+ ++ADLDT I+F          +N EN +    + A  +E I K  K LV D + +V      QE LA A  ++V    +L   VK  A ++GS            E    Q +L+NAV+DVA AL D  + TK    A   K  D      LK+S + MV +V  L+K+VK++ED   +GTRALE ++E +++E     +  P                              K  + E  + MTK + LA+ KA+AA  + +QED++  AN+ R+A+ D++   +      ++K E +++  R  SE                  + + ++EH    V  +I              +  SH ++  LA  S+R+A S+ E+ ++A  +K T   D EDP     IAENELL AA+ IE AAKK+  LKPR +  K+  E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A + VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+T +RLQAAG+AVKRA++ LVK A +   + QD             MV  +  +I AQ +++ KE+ELE  R K   IRQ
Sbjct:    1 MVALSLKIGVGNVVKTMQFEPSTVVYDACRIIRERVPEAQLGQPSDYGLFLSDDDPKKGIWLEAGKALDYYMLRNGD---TLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIGITNYDEYSLVRDVGEEKKEETTGTLKRDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTLREQGVEESEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGDHNESKHKPGFLDLKEFLPKEYVKNKG-EKRIFQAHKNCQNMTEIEAKVNYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPK----DFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQF----------NKMGKV----ETGSVALPAIIRSGAGGPESMKMGSMPQAKQHITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAVQASLDEFDALPPLGTDSASQAWRKNKMDESKHEIHSQVDAITAGTASMVNLTAGDP---AETDYTAVGCAVTTISSNLTEMSKGVKLLAAL---MEDEGGNGQQLLGAAKNLACAVSDMLKTAQPSSTE-----------------PRQNLLQAAGNVGQASGELLQQIGE-----SDADQHFQDMLMQLAKAVANAAA--ALVLKAKNVAQK-SEDSAQQNKVIAAATQCALSTSQLVACTRVVVAPTISSPVCQEQLIEAGKLVAKSVEGCVEASHGATGDEHLL-KQVGAAATGVTQALNELLQH--IRQYASGGQPIGRHGEATDRILDVTDNIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGES------------DLENSRKLLSAAKLLADATARMVEAAKGAAANPD-SEEQQQKLREAAEGLRMATNAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASSNKNPAAQQQLVQSCKVVADQI-PQLVQGLRSSQAQPDSPSAQLALIGASQNFLQPGAKMVTAAKATVPTISDQASAMQLSQCAKNLASALAELRTAAQKAQEACGPLEIDNALTMVRG----LERDMQEAKASAAEGKLRPLPGETLEKCSQDLGSSTKAVSSAIAQLLSEATQGNENY--------TGM------AARDVAQALRSLASAARGVAA-----NTEDPLARNAM--LDCTGDVMDKSASLIEETKRAIAKPGDPDSQQRLAQVAKAVSQALNRSVNCLPGQRDVD---NAIRTVGEASKKLLSDKFPA-----SGKNFQEAQANLNEAAAGLNQSANELVQASRGTTQDLAKASGKFGQDFNQFLQAGVDMAGQSQSKEDQTQVVTNLKTISMSSS-----KLLLAAKALSTDPNSPNLKNQLAAAARAVTDSINQLISMCTQQAP-GQKECDNALRELETVGGML--ENPTEAVNDLGYFDCIDSVMENSKVLGEAMAGISHNAKNSNLPEFGDSVSSASKALCGLTEAAAQGAYLVGVSDPNSHAGQKGLV-DP-----SQFAR--AKQSIQMACQNLVDPACTQSQVLSAATIVAKHTSALCNACRLASSKTSNPVAKRQFVQSAKEVANSTANLVKSIKALDGAFNQENRQKCKEATGPLIEAVDNLTAFA-----SNPEFASVPAQISPEGLAAMEPITAAAKAMLESSTGLIQTARSLAVNPKDPPKWSVLAGHSRTVSDSIKKLITNMREKAPGQRECDDAIEVLSNCIREVDKASLAAI----SQQLTPRDDISHEALHEQMAASVHEISNLIEPV--AIAARADASQLGHKVSQMVSYFEPLIMAAIGTASKILNSQQQMNVLDQTKTLAESALQMLY---TAKETGGNHKAAHTQEALEESVQMMKEAVDDLGSTLAEVASAAGAVGGMVNSITQSINKMEDGPAFEPEGTFVDYQTTMVKTAKAIAVTVQEMVTKSNTNPD-ELGGLANQLTT------EFGDLASEAKCAAMTAENDEIGSHIKKQVTELGYTCTGLVS--KAGALQ------------------CSPNDSYTKKELIDSARKVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMF-----ATAGTLNRENAE----TFADHREHILKTAKVLVEDTKLLVSGAGASQEKLAQAAQSSVNTITKLADVVKLGAASLGS------------EDPETQVVLINAVKDVAKALGDLISATK----AAAGKPHDDPAMLQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATIEHIKQELAVFSSADP----------------------------PPKTATPEEFIRMTKGITLATAKAVAAGNSCRQEDVIATANLSRRAVADMLRSCKQAAYHPEVKREVQTRALRFGSE---------------CSTSYLGLLEH----VLVII--------------QKPSHDLKQQLANYSKRVASSVTELIQAAEAMKGTEWVDPEDPT---VIAENELLGAAAAIEAAAKKLEQLKPR-AKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAV---DDGQWSQGLISAARMVAAATNNLCEAANSAVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSQTMKRLQAAGNAVKRASDNLVKAAQKAAFEAQDDQAVMV----KSKMVGGIAQIIAAQEEMLRKEKELEEARKKLAMIRQ 2521          
BLAST of Talin vs. Ensembl Zebrafish
Match: tln2a (talin 2a [Source:ZFIN;Acc:ZDB-GENE-040724-263])

HSP 1 Score: 971.844 bits (2511), Expect = 0.000e+0
Identity = 835/2772 (30.12%), Postives = 1422/2772 (51.30%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGS------AQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLL------TDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSIT-----AHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRV--ANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVP--NNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHA---SVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKT----ITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQL--SLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQDLMENVSSL-KIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE---HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            +L+I +   N   +++ +  T VYD CR + +R+P+ +     E+GLF+SD D  +  WL+  + + YY L  GD   +L +K + R   ++ +D   KT+ VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +   T TLK+ +T +R+  K+EK+K KL TDD+LNWL HG+T R+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A +  GIQ Q + G     K K+   +LKEFLPKEY+K +G +KKI  +++     ++ + KV Y +L RSL+TYG++FFLVKEK+++KNKLVPRL+G++KE VMRVDEKTK+++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE  M+EE+V+P K+ ++   F        E  S+A    LP     G++  G VG+        P A +     GQ ++   P       LS  ++AL+  I  +++ ++ A +DL++  E+  LG+D +S+ + +  +D +K  +   + ++T  T +++ +   D     + DY  +  AI TI  N  ++ + ++ +  +    ++E  +G +L+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L+       +A  +  L +  V  V E SV          Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV+  ++       +   + + +     ++ +++  L  H + N  T        D      ++ +E + +++G++ EMV QA++LA+A ++L + + + A V+   NN  +  ++            A+ L DA  ++V A K      E   + QQ L +AA  +    +  A   I+++L   LE A +Q A  A Q + +SQ AA + +  A++ Q+    + + + + P+++      +  P D +AQ  L+ A +  +Q   +++ S+++  P V D +    L    +N  T+LA+L+   Q A     P  +  A IA      +QTL + +  A  + + G+L PLPGE++E  +  +G +SKA      +L       N + +       G+      +A E  ++++ L + ARG+AA  S       + +   +V++   ++I   ++ +     A I+      L +    +   ++  V  +P  +++D     LKS  E   K ++   P       +KS  + QS+     A  NQ+ GD+++ S  T + L   + + +++ D  L  G+++    P  ++Q Q+   LK++S  S+ LL   K L    G+      K  L  AA  V+DSIN L++ C    P  Q+ C+++ R+LEA++   L + P+ P+N+ SY  C++SV E S+ L   M  I   CKTGD   F   +   S +   + ++  QA+Y +G+         SS   +P L   IQ A     +   C ++   ++S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S EN E  + A   ++  V+ LT  A     +NP   +    I+ +G  AQ  I Q++  M++ S  LL+ A +LV + K  P       + +T    +  L   ++  APGQ+E     + + + +R++++A++   S       N    D ++S+  + QL  S++++ + I PI    + + +   LG  V +  SY  P+  +S  +A      + +  +++ TKT+ E+ L M+   +E       ++  D +   + L +   DDL+  ++  AS  G +  M+ SI  S  +L E     P        + +Q+        T    +K I+V+   ++  TK + + ED   L+            ++  DY  L   V   ++S     ++   ++K  V  +G  C+ L++            + ++E I   R+   +++ ++  LQ+ ++GTQ CI AA++V+ ++ADLDT I+F      +   +N+END    +S A  +E+I K  K+LV D + +V      QE LA A  ++ +   QL   VK  A +IG +                Q +L+NAV+DVA AL +  + TK       D +     LKS+ + MV +V  L+K+VK++ED   RGTRALE ++E +R+E    ++                              + +K  + E  + MTK +  A+ KA+AA  + +QED++  AN+ RK I D++   +                 F+E+  +             E   + + +G       ID+ E++ + +   K     K ++ + S+++A ++ E+ ++A  +K T   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LV+ A +   ++   D  +  T        V  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:    5 SLKICVRQCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASEYGLFLSDEDPRKGIWLEGGRTLDYYMLRNGD---ILEYKKKQRPQKVKMLDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQETVEEKKDEGTGTLKKDRTLLREERKMEKLKAKLHTDDDLNWLDHGRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQTQIQFGPHIEHKHKTGFLDLKEFLPKEYIKQRGAEKKIFQEHKGCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGVTKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEEATMLEESVSPKKSTILQQQF--NRVGRVEHGSVA----LP-----GILRSGSVGAETLNMGTMP-APQQQITTGQMHLGHMP------PLSAAQQALVGTINTSMQAVQQAQDDLEEVEELPPLGDDMASKMWIQNKMDESKHDIHSQVDAITAGTASVVNLTAGDP---TDTDYTAVGCAITTISSNLTEMSKGVKLLAAL---MEDEVGSGHDLMRAARTLTGAVSDLLKAVEPTSGE-----------------PRQTVLTAAGSIGQASGDLLRQIGENE---TDERFQ--DVLMNLAKAVANAAAMMVLKAKNVAQVSEDSV---------MQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVEGCVKACLSAT-SDGELLKAVSAAAGIVTQALSDLLTH-VRNYATRGEPIGRYDQATDTIMNVTENIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDAEVEVDVNNSKKLLAA------------AKLLADATARMVEAAKGAAAYPENE-DQQQKLREAAEGLRVATNAAAQNAIKKKLITRLENAAKQAAAAATQTIAASQNAAASNKNTAAHQQLVQSCRAVADHI-PQLVQGVRGSQGQPEDGSAQLALIIASKNFLQPGSKMVSSAKSSVPTVTDQAAAMQLGQCAKNLATTLAELRTAAQTAHEACGPMEIDSALIA------VQTLKNELQDAKMAASEGQLKPLPGESLEKCAQDLGGTSKAVGSSMAQLLTCAAQGNEHYT-------GV------AASETAQALKTLAQAARGVAATTSDPAGAAAMLDSAREVMEGSAKLISEAKEALVAPGDAEIQ----QRLAQVAKAVSHSLNACVNCLPGQKDVDM---ALKSIGEASKKLLVETLPPC-----SKSFQEAQSDLNQTAADLNQSAGDVVHASRGTTTQLADASGKFSDNFDEFLDAGIEMAGHTPGKDDQLQVIGNLKNISMASSKLLLAAKSLSVDPGA---GNAKNLLAAAARSVTDSINQLITMCTQNAP-GQRECDNALRELEAVRG--LLDNPNEPVNDLSYFDCIESVMENSKVLGESMAGISHNCKTGDVPAFGDCVGGASKALCGLTEAAGQASYLVGVSDP------SSQAGHPGLVDPIQFARANQAIQMACQNLVDPDSSPSQVLSAATIVAKHTSALCNACRLASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENREKCRIATAPLIEAVDNLTIFA-----SNPEFASVPAQISREGSAAQEPIIQSARSMLDSSTHLLKTARSLVMNPKDPPTWSLLAGHSRTVSDSIKSLITAIRDKAPGQKECDSAIDNINKCIRDIEQASLAAVS------QNLPRRDEVSSEALQEQLTSSVQEVGHLIEPITT--AAKGEAAQLGHKVSQLVSYFTPLVSASMGIASKTLDHQQQMNLLDQTKTLAESALQMLYAAKEGGGNPKASHTHDAIAEAAQLMREAVDDLLLTLNEAASEVGMVSGMVDSIADSMGKLGEGTPPEP----EGSFVEYQT--------TMVRYSKAIAVS--AQEMITKSVSSPEDLCSLA-----------SQVTADYSQL--AVQGRLASATAEPEEIGFQIKTSVQELGHGCIVLVQKAGALQISPTDSFTKRELIECARAVTEKVSMVLSALQAGNKGTQACITAASAVSGIIADLDTTIMF-----ASAGTLNAENDS---DSFADHRENILKTAKALVEDTKNLVSGAASSQEKLAQAAQSSAKTITQLTDVVKLGAASIGPDDP------------ETQVVLINAVKDVAKALAELISATKCAAGKAAD-DPSMFQLKSAAKVMVTNVTSLLKTVKAVEDEASRGTRALEATIECIRQELTMFQS----------------------------KETPEKSSTPEEFIRMTKGITTATAKAVAAGNSARQEDVISTANLSRKVIADMLTSCK--------------QAAFNEEVSV-------------EVRSRALLYGTECTNGYIDLLEHVLQVLQ--KPTGDQKQKLAMFSKKVAAAVTELIQTAEAMKGTEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADESLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIPANAV---DDGQWSQGLISAARMVAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFNKADDDNVVVKTR------FVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQ 2528          
BLAST of Talin vs. Ensembl Zebrafish
Match: tln2a (talin 2a [Source:ZFIN;Acc:ZDB-GENE-040724-263])

HSP 1 Score: 968.378 bits (2502), Expect = 0.000e+0
Identity = 835/2772 (30.12%), Postives = 1422/2772 (51.30%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGS------AQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLL------TDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSIT-----AHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRV--ANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVP--NNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHA---SVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKT----ITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQL--SLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQDLMENVSSL-KIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE---HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            +L+I +   N   +++ +  T VYD CR + +R+P+ +     E+GLF+SD D  +  WL+  + + YY L  GD   +L +K + R   ++ +D   KT+ VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +   T TLK+ +T +R+  K+EK+K KL TDD+LNWL HG+T R+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A +  GIQ Q + G     K K+   +LKEFLPKEY+K +G +KKI  +++     ++ + KV Y +L RSL+TYG++FFLVKEK+++KNKLVPRL+G++KE VMRVDEKTK+++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE  M+EE+V+P K+ ++   F        E  S+A    LP     G++  G VG+        P A +     GQ ++   P       LS  ++AL+  I  +++ ++ A +DL++  E+  LG+D +S+ + +  +D +K  +   + ++T  T +++ +   D     + DY  +  AI TI  N  ++ + ++ +  +    ++E  +G +L+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L+       +A  +  L +  V  V E SV          Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV+  ++       +   + + +     ++ +++  L  H + N  T        D      ++ +E + +++G++ EMV QA++LA+A ++L + + + A V+   NN  +  ++            A+ L DA  ++V A K      E   + QQ L +AA  +    +  A   I+++L   LE A +Q A  A Q + +SQ AA + +  A++ Q+    + + + + P+++      +  P D +AQ  L+ A +  +Q   +++ S+++  P V D +    L    +N  T+LA+L+   Q A     P  +  A IA      +QTL + +  A  + + G+L PLPGE++E  +  +G +SKA      +L       N + +       G+      +A E  ++++ L + ARG+AA  S       + +   +V++   ++I   ++ +     A I+      L +    +   ++  V  +P  +++D     LKS  E   K ++   P       +KS  + QS+     A  NQ+ GD+++ S  T + L   + + +++ D  L  G+++    P  ++Q Q+   LK++S  S+ LL   K L    G+      K  L  AA  V+DSIN L++ C    P  Q+ C+++ R+LEA++   L + P+ P+N+ SY  C++SV E S+ L   M  I   CKTGD   F   +   S +   + ++  QA+Y +G+         SS   +P L   IQ A     +   C ++   ++S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S EN E  + A   ++  V+ LT  A     +NP   +    I+ +G  AQ  I Q++  M++ S  LL+ A +LV + K  P       + +T    +  L   ++  APGQ+E     + + + +R++++A++   S       N    D ++S+  + QL  S++++ + I PI    + + +   LG  V +  SY  P+  +S  +A      + +  +++ TKT+ E+ L M+   +E       ++  D +   + L +   DDL+  ++  AS  G +  M+ SI  S  +L E     P        + +Q+        T    +K I+V+   ++  TK + + ED   L+            ++  DY  L   V   ++S     ++   ++K  V  +G  C+ L++            + ++E I   R+   +++ ++  LQ+ ++GTQ CI AA++V+ ++ADLDT I+F      +   +N+END    +S A  +E+I K  K+LV D + +V      QE LA A  ++ +   QL   VK  A +IG +                Q +L+NAV+DVA AL +  + TK       D +     LKS+ + MV +V  L+K+VK++ED   RGTRALE ++E +R+E    ++                              + +K  + E  + MTK +  A+ KA+AA  + +QED++  AN+ RK I D++   +                 F+E+  +             E   + + +G       ID+ E++ + +   K     K ++ + S+++A ++ E+ ++A  +K T   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LV+ A +   ++   D  +  T        V  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:    5 SLKICVRQCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASEYGLFLSDEDPRKGIWLEGGRTLDYYMLRNGD---ILEYKKKQRPQKVKMLDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQETVEEKKDEGTGTLKKDRTLLREERKMEKLKAKLHTDDDLNWLDHGRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQTQIQFGPHIEHKHKTGFLDLKEFLPKEYIKQRGAEKKIFQEHKGCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGVTKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEEATMLEESVSPKKSTILQQQF--NRVGRVEHGSVA----LP-----GILRSGSVGAETLNMGTMP-APQQQITTGQMHLGHMP------PLSAAQQALVGTINTSMQAVQQAQDDLEEVEELPPLGDDMASKMWIQNKMDESKHDIHSQVDAITAGTASVVNLTAGDP---TDTDYTAVGCAITTISSNLTEMSKGVKLLAAL---MEDEVGSGHDLMRAARTLTGAVSDLLKAVEPTSGE-----------------PRQTVLTAAGSIGQASGDLLRQIGENE---TDERFQ--DVLMNLAKAVANAAAMMVLKAKNVAQVSEDSV---------MQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVEGCVKACLSAT-SDGELLKAVSAAAGIVTQALSDLLTH-VRNYATRGEPIGRYDQATDTIMNVTENIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDAEVEVDVNNSKKLLAA------------AKLLADATARMVEAAKGAAAYPENE-DQQQKLREAAEGLRVATNAAAQNAIKKKLITRLENAAKQAAAAATQTIAASQNAAASNKNTAAHQQLVQSCRAVADHI-PQLVQGVRGSQGQPEDGSAQLALIIASKNFLQPGSKMVSSAKSSVPTVTDQAAAMQLGQCAKNLATTLAELRTAAQTAHEACGPMEIDSALIA------VQTLKNELQDAKMAASEGQLKPLPGESLEKCAQDLGGTSKAVGSSMAQLLTCAAQGNEHYT-------GV------AASETAQALKTLAQAARGVAATTSDPAGAAAMLDSAREVMEGSAKLISEAKEALVAPGDAEIQ----QRLAQVAKAVSHSLNACVNCLPGQKDVDM---ALKSIGEASKKLLL--PPC------SKSFQEAQSDLNQTAADLNQSAGDVVHASRGTTTQLADASGKFSDNFDEFLDAGIEMAGHTPGKDDQLQVIGNLKNISMASSKLLLAAKSLSVDPGA---GNAKNLLAAAARSVTDSINQLITMCTQNAP-GQRECDNALRELEAVRG--LLDNPNEPVNDLSYFDCIESVMENSKVLGESMAGISHNCKTGDVPAFGDCVGGASKALCGLTEAAGQASYLVGVSDP------SSQAGHPGLVDPIQFARANQAIQMACQNLVDPDSSPSQVLSAATIVAKHTSALCNACRLASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENREKCRIATAPLIEAVDNLTIFA-----SNPEFASVPAQISREGSAAQEPIIQSARSMLDSSTHLLKTARSLVMNPKDPPTWSLLAGHSRTVSDSIKSLITAIRDKAPGQKECDSAIDNINKCIRDIEQASLAAVS------QNLPRRDEVSSEALQEQLTSSVQEVGHLIEPITT--AAKGEAAQLGHKVSQLVSYFTPLVSASMGIASKTLDHQQQMNLLDQTKTLAESALQMLYAAKEGGGNPKASHTHDAIAEAAQLMREAVDDLLLTLNEAASEVGMVSGMVDSIADSMGKLGEGTPPEP----EGSFVEYQT--------TMVRYSKAIAVS--AQEMITKSVSSPEDLCSLA-----------SQVTADYSQL--AVQGRLASATAEPEEIGFQIKTSVQELGHGCIVLVQKAGALQISPTDSFTKRELIECARAVTEKVSMVLSALQAGNKGTQACITAASAVSGIIADLDTTIMF-----ASAGTLNAENDS---DSFADHRENILKTAKALVEDTKNLVSGAASSQEKLAQAAQSSAKTITQLTDVVKLGAASIGPDDP------------ETQVVLINAVKDVAKALAELISATKCAAGKAAD-DPSMFQLKSAAKVMVTNVTSLLKTVKAVEDEASRGTRALEATIECIRQELTMFQS----------------------------KETPEKSSTPEEFIRMTKGITTATAKAVAAGNSARQEDVISTANLSRKVIADMLTSCK--------------QAAFNEEVSV-------------EVRSRALLYGTECTNGYIDLLEHVLQVLQ--KPTGDQKQKLAMFSKKVAAAVTELIQTAEAMKGTEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADESLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIPANAV---DDGQWSQGLISAARMVAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFNKADDDNVVVKTR------FVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQ 2525          
BLAST of Talin vs. Ensembl Zebrafish
Match: tln2b (talin 2b [Source:ZFIN;Acc:ZDB-GENE-130325-1])

HSP 1 Score: 455.677 bits (1171), Expect = 1.633e-131
Identity = 480/1687 (28.45%), Postives = 819/1687 (48.55%), Query Frame = 3
Query: 3219 QLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLIAEV--PNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMS-KNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQDLMENVSSL-KIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKAN-EDNQILSQNKMADVNYPFKKLVHDYDSLV--TGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYEN----LNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE--HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            +++ SS+A  P V D +    L    +N  T LA+L+   Q+A     P  + +  +     +QTL S +  A  +    +L PLPGE++E  +  +GS+SKA      +L       N + +       G+      +A+E  +++  L + ARG+AA   +  +   + +    V++    +I      +    +    A +   L +    +   ++  V  +P  +++D     L+S  E   K ++ N P       +KS  + Q++     A  N + GD++ S+   S+ L + + + ++  D  L  G+++       ++Q Q+ S LK++S  S+ LL   K L    G+++   L  +  +A   V++SIN L++ C    P  Q+ C+++ R+LEA++  L  + P+ P+++ SY  C++SV E S+ L   M  I   CKTG+   F   + V S +   + ++  QA+Y +G+   N S      + +PI  +    A  M+ +N +  ASS +  +     AT +    S++C   +   + +++P  +   + + K VA  T NL+KTI +     S EN E  + A   ++  V+ L+  A     +NP   +I  Q    G  AQ  I +++  M++ S  LL  A +L+ + K  P       + +T    +  L   ++  APGQRE  +  + + + +R++++ ++   +V +S  +  + + S+ +  + +  +++++ + I PI    + + +   LG  V +  SY  P+  +S  LA      + +  +++ TKT+ E+ L M+   +E       T+  D +   + L K   DD+M  ++  AS  G +  M+ SI +S  R++++N    L         +Q  K +T       L   ++V   Q  +  +   A  E  ++ SQ     +    ++L H    LV   G +Q+  + +F  ++    L +C  AV +                   +++ ++  LQ+ ++GTQ CI AA+SV+ ++ADLDT I+FA +G+     +N+EN++    S A  +E+I K  K+LV D + +V      Q+ LA A  ++ +   QL   VK            LG + M  E    Q +L+NAVRDVA AL +  + TK       D +     LKS+ + MV +V  L+K+VK++ED   RGTRALE ++E +++E             V  SK             DN     +K  + E  + MTK + +A+ KA+AA  + +QED++  AN+ RKAI+D++           K+    P                   E V+    K + +G       +D+ E+    L K  AE       K Q+   S+++A S+ E+ ++A  +K +   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LVK A +      +D S+           V  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:   13 KMVTSSKAAVPTVTDQAAAMQLGQCAKNLATCLAELRTAAQKAHEACGPLEIDSALSA----VQTLKSELQDAKMAALDLQLKPLPGESLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALRTLAQAARGVAASTVEPQAAAAMLDSAYHVMEGSAMLIHEAHQAL----VCPGDAESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDM---ALRSIGEASKKLLVENLPPC-----SKSFQEAQTDLNHTAAELNHSAGDVVQSSRGSSSQLAVASGKFSQDFDEFLDAGIEMAGHTQSKDDQIQVISNLKNISMASSKLLLAAKSLSVDPGAANAKNLLAAAARA---VTESINQLITLCTQQAP-GQKECDNALRELEAVRGML--DNPNEPVSDLSYFDCIESVMENSKVLGESMAGISQHCKTGNVPAFGDCVGVASKALCGLTEAAGQASYLVGVSDPN-SQSGHQGLVDPIQFARANQAIQMACQNLVDPASSPSQVLSA---ATIVAKHTSALCNACRLASSKTANPVARRHFVQSAKEVANTTANLVKTIKALDGDFSDENRERCRVATTPLIEAVDNLSTFA-----SNPEFASIPAQISHEGSAAQEPIVRSARSMLDSSTHLLETARSLIINPKDPPTWSILAGHSRTVSDSIKSLITSIRDKAPGQRECDQSIDSINKSIRDIEQVSL--AAVGQS--LPRRDDISLEALQELLTSAVQEIGHLIDPIST--AARGEAAQLGHKVTQLASYFEPVIVASVGLASKHADHQQQMNILDQTKTLFESALQMLYAAKEGGGNPKATHTHDAISEAAQLMKEAVDDIMVTLNEAASEGGMVGGMVESIAESIGRVSDSN----LYIYIYIYCKYQMTKSVTCPEELGGLASQVTVDYSQLAQQGRLAAATAELEEVGSQ-----IKTRVQELGHGCIYLVQKAGALQMSPTDSFTKRE----LIECARAVTE-------------------KVSMVLSALQAGNKGTQACITAASSVSGIIADLDTTIMFASAGT-----LNAENEE----SFADHRENILKTAKALVEDTKLLVSGAASSQDKLAQAAQSSAKTITQLTDVVK------------LGAASMGSEDPETQVVLINAVRDVAKALAELISATKCAAGKAAD-DPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELT-----------VFQSK-------------DN----PEKSTTPEEFIRMTKGITVATAKAVAAGNSAQQEDVISTANLSRKAISDML--------TTCKQAAYHP----------------EVGEDVRN---KALLYGIECTTGYVDLLEHVLLVLQKPTAE------QKQQLASLSKKVASSVTELIQTAEAMKGSEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADESLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAV---DDGQWSQGLISAARMVAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVKAAQKAAFDKAEDDSVVV-----KTKFVGGIAQIIAAQEEMLRKERELEEARKKLAHIRQ 1522          
BLAST of Talin vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 978.778 bits (2529), Expect = 0.000e+0
Identity = 845/2784 (30.35%), Postives = 1434/2784 (51.51%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNV-------------QPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLIAEVPN--NQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMS-KNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVEN-DEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLS--LKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQDLMENVSSL-KIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENW-IPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDL-------VHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKP-SENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE---HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            +L+I +   N   +++ +  T VYD CR + +R+ + ++    +FGLF+SD D  +  WL+  + + YY L  GD   VL +K + R   IR +D   K + VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +  +T TLK+ +T +RD  K+EK+K KL T+DELNWL H +T R+ G+DE + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A +  GIQ Q + G     K K     LKEFLPKEY+K +G +KKI  +++     ++ + KV Y +L RSL+TYG++FFLVKEK++ KNKLVPRL+GI+K+ VMRVDEKTKE++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K+ ++    I +                P + ++G V       A P  IR+ S  G    NV             Q  +  +  L+  ++ALM  I  ++  ++ A  DL +   +  LG+D +SR + +  +D +K  +   + ++T  T +++ +   D       DY  +  AI TI  N  ++ + ++ +  +    ++E  +G  L+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L+  AK +AN  + +V  +K  +VA + T+ T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV+N +       E   ++ +Q+    +++ ++++ L QH  +    +  +P+          +S +E + +++G++ EMV QA++LA+A ++L + +             S + + +D D  ++L+ AA+ L D+  ++V A K      E   + QQ L +AA  +    +  A   I++++   LE A +Q A  A Q + +SQ A+ + +  A++ Q+    + + + + P+++      +    D +AQ  L+ + Q  +Q   +++ S++A  P V D +    L+   +N  TSLA+L+   Q+A     P  + +  N     +QTL + +  A  + +  +L PLPGET+E  +  +GS+SK       +L       N + +       G+      +A+E  ++++ L + ARG+AA  S   +  ++ +   DV++    +I+  +  +     A I+      L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TKS  + QSE   A    NQ+ G++++++   S  L   + + ++  D  L  G+++  +  N  +Q Q+   LK++S  S+ LL   K L   SG+         L  AA  V++SIN L++ C    P  Q+ C+++ R+LE +K  L  E P+ P ++ SY  C++SV E S+ L   M  I    KTGD   F   + V S +   + ++  QA Y +G+   N+       V +PI  +    A  M+ +N +  ASS +  +     AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S EN ++ + A   +++ VE LT  A     +NP   +I  Q    G +AQ  I  +++ M+E S SL++ A +L  + K  P   +   + +     +  L   ++  APGQRE  +  + + + +R++++A++   SV++   M     D I+ +  + QL+  ++++ + I PI    + + +   LG  V +   Y  P+  ++  L   +   + +  V++ TKT+ E+ L M+   +E        +  D +   + L K   DDLM  ++  AS  G +  M+ SI ++ ++L E     P       T +     G+         +K I+VT   ++  TK +   E+   L+            ++  DY +L   V   M++     ++   ++K  +  +G  C+ L++            Y ++E I   R+   +++ ++  LQ+ ++GTQ CI A+++V+ ++ADLDT I+F          +N+EN +    S A  +E+I K  K+LV D + +V      QE LA A  ++     QL   VK  A ++GS+                Q +L+NA++DVA AL D    TK       D +     LKS+ + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++  IP                             +K  S E  + MTK +  A+ KA+AA  + +QED++  AN+ RKA++++       V+H  V  D +         R F                           +G     A ++M E++  S+ +    E+ K Q+++ S+RIA ++ E+ ++   +K T   D +DP     IAE ELL AA+ IE AAKK+  LKPR   ++   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   + N +  ++ QWS GLISAAR+VAAAT NL +SA A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LV+ A +    +  +D  +  T        V  +  +I AQ +++ KERELE  R K   IRQ      P
Sbjct:    5 SLKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQSGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGD---VLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRETMEEKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQQITR----------------PGKPELGTV-------ALPAIIRSGSS-GPETFNVGSMPSAQQQLTTGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAHSDLSQVDNLPPLGHDMASRVWIQNKVDESKHEIHSQVDAITAGTASVVNLTAGD---PTETDYTAVGCAITTISSNLTEMSKGVKLLAAL---MEDEVGSGEKLLGAARTLAGAVSDLLTAVQPSSGE-----------------PRQTVLTAAGSIGQASGELLRQIGENE---ADERFQVFDVLMNLAKAVANAAAMLV--LKAKNVA-QVTEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVHACHSATEDIELL-KQVSAAASVVSQALNDLLQH--VRQFASRGEPIGRYDQATDTIMSVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEIDMDNSKKLLAAAKLLADSTARMVEAAKGAAANPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKIVNRLEAAAKQAAAAATQTIAASQNASLSNKNTAAHQQLVQSCKTVADHI-PQLVQGVRSSQAQAEDLSAQLTLIVSSQNFLQPGSKMVASAKAAVPTVTDQAAAMQLSQCAKNLATSLAELRTAAQKAHEACGPMEIDSALNA----VQTLKNELQDAKMAASDRQLKPLPGETLEKCAQDLGSTSKTVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALKTLAQAARGVAASTSDPQAASDMLDSARDVMEGSANLIQEAKQALVAPGDAEIQ----QRLAQVAKAVSHSLNNCVNCLPGQKDVDM---ALKSIGESSKKLLVDSLP-----PSTKSFQEAQSELNQAAEDLNQSAGEVVHASRGQSGELAAASGKFSQDFDEFLDAGIEMAGQTQNKDDQMQVIGSLKTISMASSKLLLAAKSLSVDSGAPSAK---NLLAAAARAVTESINQLITLCTQQAP-GQKECDNALRELETVKGML--ENPNEPASDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVSVASKALCGLTEAAVQAAYLVGISDPNSQAGQQGLV-DPIQFARANQAIQMACQNLVDPASSPSQVLSA---ATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKTLDGDFSEENRNKCSIATSPLISAVENLTAFA-----SNPEFASIPAQISSEGARAQEPILVSAVTMLESSSSLIKTARSLAINPKDPPTWSSLAGHSRIVSDSIKSLITSIRDKAPGQRECDQSIDSINRFIRDIEQASL--ASVSQDLAM----RDDISLEALQEQLTSVVQEIGHLIDPITT--AARGEAAQLGHKVTQLARYFEPLVLAAVGLVSKVLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAFHTHDAIAEAAQLMKEAVDDLMITLNEAASEVGMVGGMVDSIAEAMSKLDEGTPPEP-----TGTFVDYQTTGV-------KYSKAIAVT--AQEMMTKSVTNPEELGGLA-----------SQVTSDYGNL--AVQGRMAAATAEPKEVGFQIKSRIQDLGHGCIFLVQKAGALQICPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITASSAVSGIIADLDTTIMF-----ATAGTLNAENKE----SFADHRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDP------------ETQVVLINAIKDVAKALGDLIEATKCAAGKAAD-DPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEHIKQELTVFQSKDIP-----------------------------EKTSSPEESIRMTKGITTATAKAVAAGNSCRQEDVIATANLSRKAVSEMLTACKQAVYHPDVNADTR--------QRAF--------------------------RYGTECTFAYLEMLEHV-LSILQKPSLET-KQQLSIFSKRIAAAVTELIQTTETMKGTEWVDPQDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPRQ-ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIAANAA--DDGQWSQGLISAARMVAAATSNLCESANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFSKAEEDDVVVKT------KFVGGIAQIIAAQEEMLKKERELEEARKKLAQIRQQQYKFLP 2537          
BLAST of Talin vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 969.148 bits (2504), Expect = 0.000e+0
Identity = 840/2769 (30.34%), Postives = 1421/2769 (51.32%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNV-------------QPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLIAEVPN--NQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMS-KNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVEN-DEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLS--LKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQDLMENVSSL-KIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENW-IPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDL-------VHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKP-SENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE---HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            +L+I +   N   +++ +  T VYD CR + +R+ + ++    +FGLF+SD D  +  WL+  + + YY L  GD   VL +K + R   IR +D   K + VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +  +T TLK+ +T +RD  K+EK+K KL T+DELNWL H +T R+ G+DE + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A +  GIQ Q + G     K K     LKEFLPKEY+K +G +KKI  +++     ++ + KV Y +L RSL+TYG++FFLVKEK++ KNKLVPRL+GI+K+ VMRVDEKTKE++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K+ ++    I +                P + ++G V       A P  IR+ S  G    NV             Q  +  +  L+  ++ALM  I  ++  ++ A  DL +   +  LG+D +SR + +  +D +K  +   + ++T  T +++ +   D       DY  +  AI TI  N  ++ + ++ +  +    ++E  +G  L+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L+  AK +AN  + +V  +K  +VA + T+ T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV+N +       E   ++ +Q+    +++ ++++ L QH  +    +  +P+          +S +E + +++G++ EMV QA++LA+A ++L + +             S + + +D D  ++L+ AA+ L D+  ++V A K      E   + QQ L +AA  +    +  A   I++++   LE A +Q A  A Q + +SQ A+ + +  A++ Q+    + + + + P+++      +    D +AQ  L+ + Q  +Q   +++ S++A  P V D +    L+   +N  TSLA+L+   Q+A     P  + +  N     +QTL + +  A  + +  +L PLPGET+E  +  +GS+SK       +L       N + +       G+      +A+E  ++++ L + ARG+AA  S   +  ++ +   DV++    +I+  +  +     A I+      L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TKS  + QSE   A    NQ+ G++++++   S  L   + + ++  D  L  G+++  +  N  +Q Q+   LK++S  S+ LL   K L   SG+         L  AA  V++SIN L++ C    P  Q+ C+++ R+LE +K  L  E P+ P ++ SY  C++SV E S+ L   M  I    KTGD   F   + V S +   + ++  QA Y +G+   N+       V +PI  +    A  M+ +N +  ASS +  +     AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S EN ++ + A   +++ VE LT  A     +NP   +I  Q    G +AQ  I  +++ M+E S SL++ A +L  + K  P   +   + +     +  L   ++  APGQRE  +  + + + +R++++A++   SV++   M     D I+ +  + QL+  ++++ + I PI    + + +   LG  V +   Y  P+  ++  L   +   + +  V++ TKT+ E+ L M+   +E        +  D +   + L K   DDLM  ++  AS  G +  M+ SI ++ ++L E     P       T +     G+         +K I+VT            A E      ++++ D+ +    LV        G +QI  + ++  ++    L +C  AV +                   +++ ++  LQ+ ++GTQ CI A+++V+ ++ADLDT I+F          +N+EN +    S A  +E+I K  K+LV D + +V      QE LA A  ++     QL   VK  A ++GS+                Q +L+NA++DVA AL D    TK       D +     LKS+ + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++  IP                             +K  S E  + MTK +  A+ KA+AA  + +QED++  AN+ RKA++++       V+H  V  D +         R F                           +G     A ++M E++  S+ +    E+ K Q+++ S+RIA ++ E+ ++   +K T   D +DP     IAE ELL AA+ IE AAKK+  LKPR   ++   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   + N +  ++ QWS GLISAAR+VAAAT NL +SA A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LV+ A +    +  +D  +  T        V  +  +I AQ +++ KERELE  R K   IRQ      P
Sbjct:    5 SLKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQSGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGD---VLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRETMEEKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQQITR----------------PGKPELGTV-------ALPAIIRSGSS-GPETFNVGSMPSAQQQLTTGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAHSDLSQVDNLPPLGHDMASRVWIQNKVDESKHEIHSQVDAITAGTASVVNLTAGD---PTETDYTAVGCAITTISSNLTEMSKGVKLLAAL---MEDEVGSGEKLLGAARTLAGAVSDLLTAVQPSSGE-----------------PRQTVLTAAGSIGQASGELLRQIGENE---ADERFQ--DVLMNLAKAVANAAAMLV--LKAKNVA-QVTEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVHACHSATEDIELL-KQVSAAASVVSQALNDLLQH--VRQFASRGEPIGRYDQATDTIMSVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEIDMDNSKKLLAAAKLLADSTARMVEAAKGAAANPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKIVNRLEAAAKQAAAAATQTIAASQNASLSNKNTAAHQQLVQSCKTVADHI-PQLVQGVRSSQAQAEDLSAQLTLIVSSQNFLQPGSKMVASAKAAVPTVTDQAAAMQLSQCAKNLATSLAELRTAAQKAHEACGPMEIDSALNA----VQTLKNELQDAKMAASDRQLKPLPGETLEKCAQDLGSTSKTVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALKTLAQAARGVAASTSDPQAASDMLDSARDVMEGSANLIQEAKQALVAPGDAEIQ----QRLAQVAKAVSHSLNNCVNCLPGQKDVDM---ALKSIGESSKKLLVDSLP-----PSTKSFQEAQSELNQAAEDLNQSAGEVVHASRGQSGELAAASGKFSQDFDEFLDAGIEMAGQTQNKDDQMQVIGSLKTISMASSKLLLAAKSLSVDSGAPSAK---NLLAAAARAVTESINQLITLCTQQAP-GQKECDNALRELETVKGML--ENPNEPASDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVSVASKALCGLTEAAVQAAYLVGISDPNSQAGQQGLV-DPIQFARANQAIQMACQNLVDPASSPSQVLSA---ATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKTLDGDFSEENRNKCSIATSPLISAVENLTAFA-----SNPEFASIPAQISSEGARAQEPILVSAVTMLESSSSLIKTARSLAINPKDPPTWSSLAGHSRIVSDSIKSLITSIRDKAPGQRECDQSIDSINRFIRDIEQASL--ASVSQDLAM----RDDISLEALQEQLTSVVQEIGHLIDPITT--AARGEAAQLGHKVTQLARYFEPLVLAAVGLVSKVLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAFHTHDAIAEAAQLMKEAVDDLMITLNEAASEVGMVGGMVDSIAEAMSKLDEGTPPEP-----TGTFVDYQTTGV-------KYSKAIAVT------------AQEMVGFQIKSRIQDLGHGCIFLVQK-----AGALQICPTDSYTKRE----LIECARAVTE-------------------KVSLVLSALQAGNKGTQACITASSAVSGIIADLDTTIMF-----ATAGTLNAENKE----SFADHRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDP------------ETQVVLINAIKDVAKALGDLIEATKCAAGKAAD-DPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEHIKQELTVFQSKDIP-----------------------------EKTSSPEESIRMTKGITTATAKAVAAGNSCRQEDVIATANLSRKAVSEMLTACKQAVYHPDVNADTR--------QRAF--------------------------RYGTECTFAYLEMLEHV-LSILQKPSLET-KQQLSIFSKRIAAAVTELIQTTETMKGTEWVDPQDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPRQ-ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIAANAA--DDGQWSQGLISAARMVAAATSNLCESANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFSKAEEDDVVVKT------KFVGGIAQIIAAQEEMLKKERELEEARKKLAQIRQQQYKFLP 2495          
BLAST of Talin vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 967.607 bits (2500), Expect = 0.000e+0
Identity = 841/2782 (30.23%), Postives = 1421/2782 (51.08%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNV-------------QPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLIAEVPN--NQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMS-KNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVEN-DEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQDLMENVSSL-KIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENW-IPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDL-------VHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKP-SENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE---HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            +L+I +   N   +++ +  T VYD CR + +R+ + ++    +FGLF+SD D  +  WL+  + + YY L  GD   VL +K + R   IR +D   K + VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +  +T TLK+ +T +RD  K+EK+K KL T+DELNWL H +T R+ G+DE + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A +  GIQ Q + G     K K     LKEFLPKEY+K +G +KKI  +++     ++ + KV Y +L RSL+TYG++FFLVKEK++ KNKLVPRL+GI+K+ VMRVDEKTKE++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K+ ++    I +                P + ++G V       A P  IR+ S  G    NV             Q  +  +  L+  ++ALM  I  ++  ++ A  DL +   +  LG+D +SR + +  +D +K  +   + ++T  T +++ +   D       DY  +  AI TI  N  ++ + ++ +  +    ++E  +G  L+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L+  AK +AN  + +V  +K  +VA + T+ T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV+N +       E   ++ +Q+    +++ ++++ L QH  +    +  +P+          +S +E + +++G++ EMV QA++LA+A ++L + +             S + + +D D  ++L+ AA+ L D+  ++V A K      E   + QQ L +AA  +    +  A   I++++   LE A +Q A  A Q + +SQ A+ + +  A++ Q+    + + + + P+++      +    D +AQ  L+ + Q  +Q   +++ S++A  P V D +    L+   +N  TSLA+L+   Q+A     P  + +  N     +QTL + +  A  + +  +L PLPGET+E  +  +GS+SK       +L       N + +       G+      +A+E  ++++ L + ARG+AA  S   +  ++ +   DV++    +I+  +  +     A I+      L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TKS  + QSE   A    NQ+ G++++++   S  L   + + ++  D  L  G+++  +  N  +Q Q+   LK++S  S+ LL   K L   SG+         L  AA  V++SIN L++ C    P  Q+ C+++ R+LE +K  L  E P+ P ++ SY  C++SV E S+ L   M  I    KTGD   F   + V S +   + ++  QA Y +G+   N+       V +PI  +    A  M+ +N +  ASS +  +     AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S EN ++ + A   +++ VE LT  A     +NP   +I  Q    G +AQ  I  +++ M+E S SL++ A +L  + K  P   +   + +     +  L   ++  APGQRE  +  + + + +R++++A++   SV++   M     D I+ ++   Q                         LG  V +   Y  P+  ++  L   +   + +  V++ TKT+ E+ L M+   +E        +  D +   + L K   DDLM  ++  AS  G +  M+ SI ++ ++L E     P       T +     G+         +K I+VT   ++  TK +   E+   L+            ++  DY +L   V   M++     ++   ++K  +  +G  C+ L++            Y ++E I   R+   +++ ++  LQ+ ++GTQ CI A+++V+ ++ADLDT I+F          +N+EN +    S A  +E+I K  K+LV D + +V      QE LA A  ++     QL   VK  A ++GS+                Q +L+NA++DVA AL D    TK       D +     LKS+ + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++  IP                             +K  S E  + MTK +  A+ KA+AA  + +QED++  AN+ RKA++++       V+H  V  D +         R F                           +G     A ++M E++  S+ +    E+ K Q+++ S+RIA ++ E+ ++   +K T   D +DP     IAE ELL AA+ IE AAKK+  LKPR   ++   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   + N +  ++ QWS GLISAAR+VAAAT NL +SA A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LV+ A +    +  +D  +  T        V  +  +I AQ +++ KERELE  R K   IRQ      P
Sbjct:    9 SLKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQSGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGD---VLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRETMEEKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQQITR----------------PGKPELGTV-------ALPAIIRSGSS-GPETFNVGSMPSAQQQLTTGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAHSDLSQVDNLPPLGHDMASRVWIQNKVDESKHEIHSQVDAITAGTASVVNLTAGD---PTETDYTAVGCAITTISSNLTEMSKGVKLLAAL---MEDEVGSGEKLLGAARTLAGAVSDLLTAVQPSSGE-----------------PRQTVLTAAGSIGQASGELLRQIGENE---ADERFQ--DVLMNLAKAVANAAAMLV--LKAKNVA-QVTEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVHACHSATEDIELL-KQVSAAASVVSQALNDLLQH--VRQFASRGEPIGRYDQATDTIMSVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEIDMDNSKKLLAAAKLLADSTARMVEAAKGAAANPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKIVNRLEAAAKQAAAAATQTIAASQNASLSNKNTAAHQQLVQSCKTVADHI-PQLVQGVRSSQAQAEDLSAQLTLIVSSQNFLQPGSKMVASAKAAVPTVTDQAAAMQLSQCAKNLATSLAELRTAAQKAHEACGPMEIDSALNA----VQTLKNELQDAKMAASDRQLKPLPGETLEKCAQDLGSTSKTVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALKTLAQAARGVAASTSDPQAASDMLDSARDVMEGSANLIQEAKQALVAPGDAEIQ----QRLAQVAKAVSHSLNNCVNCLPGQKDVDM---ALKSIGESSKKLLVDSLP-----PSTKSFQEAQSELNQAAEDLNQSAGEVVHASRGQSGELAAASGKFSQDFDEFLDAGIEMAGQTQNKDDQMQVIGSLKTISMASSKLLLAAKSLSVDSGAPSAK---NLLAAAARAVTESINQLITLCTQQAP-GQKECDNALRELETVKGML--ENPNEPASDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVSVASKALCGLTEAAVQAAYLVGISDPNSQAGQQGLV-DPIQFARANQAIQMACQNLVDPASSPSQVLSA---ATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKTLDGDFSEENRNKCSIATSPLISAVENLTAFA-----SNPEFASIPAQISSEGARAQEPILVSAVTMLESSSSLIKTARSLAINPKDPPTWSSLAGHSRIVSDSIKSLITSIRDKAPGQRECDQSIDSINRFIRDIEQASL--ASVSQDLAM----RDDISLEVSAAQ-------------------------LGHKVTQLARYFEPLVLAAVGLVSKVLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAFHTHDAIAEAAQLMKEAVDDLMITLNEAASEVGMVGGMVDSIAEAMSKLDEGTPPEP-----TGTFVDYQTTGV-------KYSKAIAVT--AQEMMTKSVTNPEELGGLA-----------SQVTSDYGNL--AVQGRMAAATAEPKEVGFQIKSRIQDLGHGCIFLVQKAGALQICPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITASSAVSGIIADLDTTIMF-----ATAGTLNAENKE----SFADHRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDP------------ETQVVLINAIKDVAKALGDLIEATKCAAGKAAD-DPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEHIKQELTVFQSKDIP-----------------------------EKTSSPEESIRMTKGITTATAKAVAAGNSCRQEDVIATANLSRKAVSEMLTACKQAVYHPDVNADTR--------QRAF--------------------------RYGTECTFAYLEMLEHV-LSILQKPSLET-KQQLSIFSKRIAAAVTELIQTTETMKGTEWVDPQDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPRQ-ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIAANAA--DDGQWSQGLISAARMVAAATSNLCESANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFSKAEEDDVVVKT------KFVGGIAQIIAAQEEMLKKERELEEARKKLAQIRQQQYKFLP 2514          
BLAST of Talin vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 810.061 bits (2091), Expect = 0.000e+0
Identity = 709/2434 (29.13%), Postives = 1241/2434 (50.99%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNV-------------QPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLIAEVPN--NQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMS-KNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVEN-DEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLS--LKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQDLMENVSSL-KIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENW-IPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDL-------VHHIRVTIDMK 7196
            +L+I +   N   +++ +  T VYD CR + +R+ + ++    +FGLF+SD D  +  WL+  + + YY L + + VL +K + R   IR +D   K + VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +  +T TLK+ +T +RD  K+EK+K KL T+DELNWL H +T R+ G+DE + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A +  GIQ Q + G     K K     LKEFLPKEY+K +G +KKI  +++     ++ + KV Y +L RSL+TYG++FFLVKEK++ KNKLVPRL+GI+K+ VMRVDEKTKE++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K+ ++    I +                P + ++G V       A P  IR+ S  G    NV             Q  +  +  L+  ++ALM  I  ++  ++ A  DL +   +  LG+D +SR + +  +D +K  +   + ++T  T +++ +   D       DY  +  AI TI  N  ++ + ++ +  +    ++E  +G  L+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L+  AK +AN  + +V  +K  +VA + T+ T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV+N +       E   ++ +Q+    +++ ++++ L QH  +    +  +P+          +S +E + +++G++ EMV QA++LA+A ++L + +             S + + +D D  ++L+ AA+ L D+  ++V A K      E   + QQ L +AA  +    +  A   I++++   LE A +Q A  A Q + +SQ A+ + +  A++ Q+    + + + + P+++      +    D +AQ  L+ + Q  +Q   +++ S++A  P V D +    L+   +N  TSLA+L+   Q+A     P  + +  N     +QTL + +  A  + +  +L PLPGET+E  +  +GS+SK       +L       N + +       G+      +A+E  ++++ L + ARG+AA  S   +  ++ +   DV++    +I+  +  +     A I+      L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TKS  + QSE   A    NQ+ G++++++   S  L   + + ++  D  L  G+++  +  N  +Q Q+   LK++S  S+ LL   K L   SG+         L  AA  V++SIN L++ C    P  Q+ C+++ R+LE +K  L  E P+ P ++ SY  C++SV E S+ L   M  I    KTGD   F   + V S +   + ++  QA Y +G+   N+       V +PI  +    A  M+ +N +  ASS +  +     AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S EN ++ + A   +++ VE LT  A     +NP   +I  Q    G +AQ  I  +++ M+E S SL++ A +L  + K  P   +   + +     +  L   ++  APGQRE  +  + + + +R++++A++   SV++   M     D I+ +  + QL+  ++++ + I PI    + + +   LG  V +   Y  P+  ++  L   +   + +  V++ TKT+ E+ L M+   +E        +  D +   + L K   DDLM  ++  AS  G +  M+ SI ++ ++L E     P       T +     G+         +K I+VT   ++  TK +   E+   L+            ++  DY +L   V   M++     ++   ++K  +  +G  C+ L++            Y ++E I   R+   +++ ++  LQ+ ++GTQ CI A+++V+ ++ADLDT I+F          +N+EN +    S A  +E+I K  K+LV D + +V      QE LA A  ++     QL   VK  A ++GS+                Q +L+NA++DVA AL D    TK       D +     LKS+ + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++  IP                             +K  S E  + MTK +  A+ KA+AA  + +QED++  AN+ RKA++++       V+H  V  D +
Sbjct:    5 SLKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQSGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGD-VLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRETMEEKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQQITR----------------PGKPELGTV-------ALPAIIRSGSS-GPETFNVGSMPSAQQQLTTGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAHSDLSQVDNLPPLGHDMASRVWIQNKVDESKHEIHSQVDAITAGTASVVNLTAGDP---TETDYTAVGCAITTISSNLTEMSKGVKLLAAL---MEDEVGSGEKLLGAARTLAGAVSDLLTAVQPSSGE-----------------PRQTVLTAAGSIGQASGELLRQIGENE---ADERFQ--DVLMNLAKAVANAAAMLV--LKAKNVA-QVTEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVHACHSATEDIELL-KQVSAAASVVSQALNDLLQH--VRQFASRGEPIGRYDQATDTIMSVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEIDMDNSKKLLAAAKLLADSTARMVEAAKGAAANPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKIVNRLEAAAKQAAAAATQTIAASQNASLSNKNTAAHQQLVQSCKTVADHI-PQLVQGVRSSQAQAEDLSAQLTLIVSSQNFLQPGSKMVASAKAAVPTVTDQAAAMQLSQCAKNLATSLAELRTAAQKAHEACGPMEIDSALNA----VQTLKNELQDAKMAASDRQLKPLPGETLEKCAQDLGSTSKTVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALKTLAQAARGVAASTSDPQAASDMLDSARDVMEGSANLIQEAKQALVAPGDAEIQ----QRLAQVAKAVSHSLNNCVNCLPGQKDVDM---ALKSIGESSKKLLVDSLP-----PSTKSFQEAQSELNQAAEDLNQSAGEVVHASRGQSGELAAASGKFSQDFDEFLDAGIEMAGQTQNKDDQMQVIGSLKTISMASSKLLLAAKSLSVDSGAPSAK---NLLAAAARAVTESINQLITLCTQQAP-GQKECDNALRELETVKGML--ENPNEPASDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVSVASKALCGLTEAAVQAAYLVGISDPNSQAGQQGLV-DPIQFARANQAIQMACQNLVDPASSPSQVLSA---ATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKTLDGDFSEENRNKCSIATSPLISAVENLTAFA-----SNPEFASIPAQISSEGARAQEPILVSAVTMLESSSSLIKTARSLAINPKDPPTWSSLAGHSRIVSDSIKSLITSIRDKAPGQRECDQSIDSINRFIRDIEQASL--ASVSQDLAM----RDDISLEALQEQLTSVVQEIGHLIDPITT--AARGEAAQLGHKVTQLARYFEPLVLAAVGLVSKVLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAFHTHDAIAEAAQLMKEAVDDLMITLNEAASEVGMVGGMVDSIAEAMSKLDEGTPPEP-----TGTFVDYQTTGV-------KYSKAIAVT--AQEMMTKSVTNPEELGGLA-----------SQVTSDYGNL--AVQGRMAAATAEPKEVGFQIKSRIQDLGHGCIFLVQKAGALQICPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITASSAVSGIIADLDTTIMF-----ATAGTLNAENKE----SFADHRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDP------------ETQVVLINAIKDVAKALGDLIEATKCAAGKAAD-DPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEHIKQELTVFQSKDIP-----------------------------EKTSSPEESIRMTKGITTATAKAVAAGNSCRQEDVIATANLSRKAVSEMLTACKQAVYHPDVNADTR 2235          
BLAST of Talin vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 716/2490 (28.76%), Postives = 1237/2490 (49.68%), Query Frame = 3
Query:  948 DVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNV-------------QPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLIAEVPN--NQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMS-KNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVEN-DEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLS--LKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQDLMENVSSL-KIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENW-IPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDL-------VHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKP-SENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE---HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            + KV Y +L RSL+TYG++FFLVKEK++ KNKLVPRL+GI+K+ VMRVDEKTKE++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K+ ++    I +                P + ++G V       A P  IR+ S  G    NV             Q  +  +  L+  ++ALM  I  ++  ++ A  DL +   +  LG+D +SR + +  +D +K  +   + ++T  T +++ +   D       DY  +  AI TI  N  ++ + ++ +  +    ++E  +G  L+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L+  AK +AN  + +V  +K  +VA + T+ T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV+N +       E   ++ +Q+    +++ ++++ L QH  +    +  +P+          +S +E + +++G++ EMV QA++LA+A ++L + +             S + + +D D  ++L+ AA+ L D+  ++V A K      E   + QQ L +AA  +    +  A   I++++   LE A +Q A  A Q + +SQ A+ + +  A++ Q+    + + + + P+++      +    D +AQ  L+ + Q  +Q   +++ S++A  P V D +    L+   +N  TSLA+L+   Q+A     P  + +  N     +QTL + +  A  + +  +L PLPGET+E  +  +GS+SK       +L       N + +       G+      +A+E  ++++ L + ARG+AA  S   +  ++ +   DV++    +I+  +  +     A I+      L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TKS  + QSE   A    NQ+ G++++++   S  L   + + ++  D  L  G+++  +  N  +Q Q+   LK++S  S+ LL   K L   SG+         L  AA  V++SIN L++ C    P  Q+ C+++ R+LE +K  L  E P+ P ++ SY  C++SV E S+ L   M  I    KTGD   F   + V S +   + ++  QA Y +G+   N+       V +PI  +    A  M+ +N +  ASS +  +     AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S EN ++ + A   +++ VE LT  A     +NP   +I  Q    G +AQ  I  +++ M+E S SL++ A +L  + K  P   +   + +     +  L   ++  APGQRE  +  + + + +R++++A++   SV++   M     D I+ +  + QL+  ++++ + I PI    + + +   LG  V +   Y  P+  ++  L   +   + +  V++ TKT+ E+ L M+   +E        +  D +   + L K   DDLM  ++  AS  G +  M+ SI ++ ++L E     P       T +     G+         +K I+VT   ++  TK +   E+   L+            ++  DY +L   V   M++     ++   ++K  +  +G  C+ L++            Y ++E I   R+   +++ ++  LQ+ ++GTQ CI A+++V+ ++ADLDT I+F          +N+EN +    S A  +E+I K  K+LV D + +V      QE LA A  ++     QL   VK  A ++GS+                Q +L+NA++DVA AL D    TK       D +     LKS+ + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++  IP                             +K  S E  + MTK +  A+ KA+AA  + +QED++  AN+ RKA++++       V+H  V  D +         R F                           +G     A ++M E++  S+ +    E+ K Q+++ S+RIA ++ E+ ++   +K T   D +DP     IAE ELL AA+ IE AAKK+  LKPR   ++   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   + N +  ++ QWS GLISAAR+VAAAT NL +SA A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LV+ A +    +  +D  +  T        V  +  +I AQ +++ KERELE  R K   IRQ      P
Sbjct:   20 EAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQQITR----------------PGKPELGTV-------ALPAIIRSGSS-GPETFNVGSMPSAQQQLTTGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAHSDLSQVDNLPPLGHDMASRVWIQNKVDESKHEIHSQVDAITAGTASVVNLTAGD---PTETDYTAVGCAITTISSNLTEMSKGVKLLAAL---MEDEVGSGEKLLGAARTLAGAVSDLLTAVQPSSGE-----------------PRQTVLTAAGSIGQASGELLRQIGENE---ADERFQ--DVLMNLAKAVANAAAMLV--LKAKNVA-QVTEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVHACHSATEDIELL-KQVSAAASVVSQALNDLLQH--VRQFASRGEPIGRYDQATDTIMSVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEIDMDNSKKLLAAAKLLADSTARMVEAAKGAAANPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKIVNRLEAAAKQAAAAATQTIAASQNASLSNKNTAAHQQLVQSCKTVADHI-PQLVQGVRSSQAQAEDLSAQLTLIVSSQNFLQPGSKMVASAKAAVPTVTDQAAAMQLSQCAKNLATSLAELRTAAQKAHEACGPMEIDSALNA----VQTLKNELQDAKMAASDRQLKPLPGETLEKCAQDLGSTSKTVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALKTLAQAARGVAASTSDPQAASDMLDSARDVMEGSANLIQEAKQALVAPGDAEIQ----QRLAQVAKAVSHSLNNCVNCLPGQKDVDM---ALKSIGESSKKLLVDSLP-----PSTKSFQEAQSELNQAAEDLNQSAGEVVHASRGQSGELAAASGKFSQDFDEFLDAGIEMAGQTQNKDDQMQVIGSLKTISMASSKLLLAAKSLSVDSGAPSAK---NLLAAAARAVTESINQLITLCTQQAP-GQKECDNALRELETVKGML--ENPNEPASDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVSVASKALCGLTEAAVQAAYLVGISDPNSQAGQQGLV-DPIQFARANQAIQMACQNLVDPASSPSQVLSA---ATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKTLDGDFSEENRNKCSIATSPLISAVENLTAFA-----SNPEFASIPAQISSEGARAQEPILVSAVTMLESSSSLIKTARSLAINPKDPPTWSSLAGHSRIVSDSIKSLITSIRDKAPGQRECDQSIDSINRFIRDIEQASL--ASVSQDLAM----RDDISLEALQEQLTSVVQEIGHLIDPITT--AARGEAAQLGHKVTQLARYFEPLVLAAVGLVSKVLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAFHTHDAIAEAAQLMKEAVDDLMITLNEAASEVGMVGGMVDSIAEAMSKLDEGTPPEPTG-----TFVDYQTTGV-------KYSKAIAVTA--QEMMTKSVTNPEELGGLA-----------SQVTSDYGNL--AVQGRMAAATAEPKEVGFQIKSRIQDLGHGCIFLVQKAGALQICPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITASSAVSGIIADLDTTIMF-----ATAGTLNAENKE----SFADHRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDP------------ETQVVLINAIKDVAKALGDLIEATKCAAGKAAD-DPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEHIKQELTVFQSKDIP-----------------------------EKTSSPEESIRMTKGITTATAKAVAAGNSCRQEDVIATANLSRKAVSEMLTACKQAVYHPDVNADTR--------QRAF--------------------------RYGTECTFAYLEMLEHV-LSILQKPSLET-KQQLSIFSKRIAAAVTELIQTTETMKGTEWVDPQDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPRQ-ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIAANAA--DDGQWSQGLISAARMVAAATSNLCESANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFSKAEEDDVVVKT------KFVGGIAQIIAAQEEMLKKERELEEARKKLAQIRQQQYKFLP 2259          
BLAST of Talin vs. Ensembl Mouse
Match: Tln1 (talin 1 [Source:MGI Symbol;Acc:MGI:1099832])

HSP 1 Score: 1004.2 bits (2595), Expect = 0.000e+0
Identity = 852/2768 (30.78%), Postives = 1402/2768 (50.65%), Query Frame = 3
Query:   69 MHTLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYEL-DENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQP--IAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITA----HQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASN------YQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLN-NYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAV---AIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPN--NQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG-VLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLA-QLLPHSRDRGEVIELTKTVLEAFLAMVQECETLS-----TTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDA-ASAHTLIFQSIKGITDTVTD----------------NSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFI---GQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            M  L + I   N   +++ +  T+VYD CR + +RIP+       +FGLF+SD D  +  WL+  K + YY L  GD    + ++ + R L IR +D T KT+ VDDSK++ ++++ IC ++GI+NH+EYSL+ EL +E +   T TL++ KT +RD  K+EK+KQKL TDDELNWL HG+TLR+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A + AG QCQ + G     K K+   +LK+FLPKEYVK KG ++KI   ++     S+ + KV Y +L RSLKTYG++FFLVKEK++ KNKLVPRL+GI+KE VMRVDEKTKE+IQ W LT ++R+AA+   F+LDFGDY D  Y +QTTEGE+IAQLI GYIDII+KK+K+KD+   + +EE+ M+E++V+P K+ V+   +          N +  + H    G + + +  R G++ P    + +     Q   + Q  +  +  L+  ++AL   I  +++ ++AA   LD    +  LG D +S+ +RK  +D +K  +   + ++T  T +++ +   D       DY  +  A+ TI  N   L E  R V  +    ++E  NG  L++AAK L  A  +LL +++P + E                   + L++A   VG+AS  LL  I       SD +   +D L+  AK +A+  +    ++K  SVA + T+ +  Q  +I AA     +TS L++  KVVA +I  P+ Q+QL  + + V  +V+  +   Q   E   ++ + +      + +++++L QH+  ++  A      D      L+ +E + +++G++ EMV QA+ILA+A ++L + +   A  +S            D +  R+L+ AA+ L DA  K+V A K      + + E QQ L +AA  +    +  A   I+++L + LE A +Q A +A Q + ++Q AA   +AS        Q C    E     +P ++      +  P  P+AQ  L+ A Q  +Q   +++ +++A  P ++D +    L+   +N  T+LA+L+   Q+A     P  + +  ++    +Q L   +     +   G+L PLPGET+E  +  +G+S+KA S    KL   +   N NY         G+      +A+++   +  L + ARG+AAL S           Q  V+D    ++     +I+  K AS       +   L +    + + ++  V  +P  +++D   + L++  +   + + ++ P       T +  + QS    A A  NQ   +L+  S  T   L   + +  +     L  G+++  + P+  ++ Q+ S LK +S +S+ LL   K L     S ++     +  +A   V+DSIN L++ C    P  Q+ C+++ RQLE ++   L E P  PIN+ SY  C+ SV E S+ L   M  I    K G+  +F  AI   S +     ++  QA Y +G+   N+       V  P   +    A  M+  C S+     ++      AT +    S++C   +     +++P  + + + + K VA +T NL+KTI +     + EN    +A    +L  V+ L+  A     +NP   ++  Q    GR A   I  ++  M+E +  L++ A AL  + +  P       + +T    + +L   ++  APGQ E       L   LR+LD+A++   S   + +    S +++++   +M  +++++ + I P+ +  + +++   LG  V +   Y  P++ ++   A + L H +    +++ TKT+ E+ L ++   +             + L E V  +    +DL   ++  AS  G +  M+ SI ++  +L E     P  +     T + ++ K I  TV +                N L  D      Q K +     A E+ +I      A + +  ++L H   +LVT       +GA                    C     Y +KE I    +V  +++ ++  LQ+ +RGTQ CI AA++V+ ++ADLDT I+FA +G+     +N E  +    + A  +E I K  K LV D + +V +  G QE LA A  ++V    +L   VK            LG + +  E    Q +L+NAV+DVA AL D  + TK       D +     LK+S + MV +V  L+K+VK++ED   +GTRALE + E +R+E     +  P                              K  + E+ + MTK + +A+ KA+AA  + +QED++  AN+ R+AI D++                K +    E AP V               ++ + +G+      +++ +++  ++   K N   K Q+T  S+R+A S+ E+ ++A  +K T   D EDP     IAENELL AA+ IE AAKK+  LKPR    K+  E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LVK A +    +D           + MV  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:    1 MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGD---TMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKG-ERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQY----------NRVGKVEH----GSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPA---ETDYTAVGCAVTTISSN---LTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEP-----------------RQNLLQAAGNVGQASGELLQQIGE-----SDTDPHFQDVLMQLAKAVASAAA--ALVLKAKSVA-QRTEDSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLL-RGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGES------------DLENSRKLLSAAKILADATAKMVEAAKGAAAHPD-SEEQQQRLREAAEGLRMATNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASAPKASAGPQPLLVQSCKAVAEQ----IPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSV----VQNLEKDLQEIKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAKLLGEIAQGNENYA--------GI------AARDVAGGLRSLAQAARGVAALTSDP-------AVQAIVLDTASDVLDKASSLIEEAKKASGHPGDPESQQRLAQVAKAVTQALNRCVSCLPGQRDVD---NALRAVGDASKRLLSDSLP-----PSTGTFQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPASPNLKSQLAAAARA---VTDSINQLITMCTQQAP-GQKECDNALRQLETVRE--LLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLV-EPTQFARANQAIQMA--CQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFA-----SNPEFSSVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPR-EGISQEALHT---QMLTAVQEISHLIEPLAS--AARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMA-LLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAV---AAENEEI-----GAHIKHRVQELGHGCSALVT------KAGALQ------------------CSPSDVYTKKELIECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGT-----LNREGAE----TFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVK------------LGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGD-DPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPA----------------------------KTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLR-------------ACKEAAFHPEVAPDVR--------------LRALHYGRECANGYLELLDHVLLTLQ--KPNPDLKQQLTGHSKRVAGSVTELIQAAEAMKGTEWVDPEDPT---VIAENELLGAAAAIEAAAKKLEQLKPRAK-PKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAL---DDGQWSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFEDQENETVV--VKEKMVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQ 2527          
BLAST of Talin vs. Ensembl Mouse
Match: Tln2 (talin 2 [Source:MGI Symbol;Acc:MGI:1917799])

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 835/2759 (30.26%), Postives = 1421/2759 (51.50%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIG-QGNVNV-QPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLI--AEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLS--LKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQD----LMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLI-FQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENW-IPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE----HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            +L+I +   N   +++ +  T VYD CR + +R+P+ +     ++GLF+SD D  +  WL+  + + YY L  GD   +L +K + R   IR +D + KT+ VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +   T TLK+ +T +RD  K+EK+K KL TDD+LNWL H +T R+ G+DE + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ E+A +  G Q Q + G     K K    +LKEFLPKEY+K +G +K+I  +++     S+ + KV Y +L RSL+TYG++FFLVKEK++ KNKLVPRL+GI+K+ VMRVDEKTKE++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K+ ++   F          N      H    G + + +  R GS+ P      S    Q  V V Q  +  +  L+  ++ALM  I  ++  ++ A +DL +   +  LG D +SR + +  +D +K  +   + ++T  T +++ +   D     + DY  +  AI TI  N  ++ + ++ +  +    D++  +G +L+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L++ AK +AN  + +V  +K  +VA +  + T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV+N ++  Q    + S + +Q+    +++ +++  L QH  +    +  +P+          +  +E + +++G++ EMV QA++LA+A ++L + +             S + + +D +  ++L+ AA+ L D+  ++V A K      E   + QQ L +AA  +    +  A   I++++   LE A +Q A  A Q + +SQ AA + +  ++  Q+    + + + + P+++      +    D +AQ  L+ + Q  +Q   +++ S++A  P V D +    L+   +N  TSLA+L+   Q+A     P  + +  N     +QTL + +  A  + A  +L PLPGET+E  +  +GS+SK       +L       N + +       G+      +A+E  ++++ L + ARG+AA  +  ++   + +   DV++    +I+  +  +    +A     +   L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TK   + QSE   A A  NQ+ G+++++    S  L   + + ++  D  L  G+++   A+   +Q Q+   LK++S  S+ LL   K L    G+      K  L  AA  V++SIN L+  C    P  Q+ C+++ R+LE +K  L  E P+ P+++ SY  C++SV E S+ L   M  I    KTGD   F   + + S +   + ++  QA Y +G+   N+       V +PI  +    A  M+  C ++    +S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S +N    + A   ++  VE LT  A     +NP   +I  Q    G QAQ  I  ++  M+E S  L+R A +L  + K  P       +  T    +  L   ++  APGQRE     + + + +R++++A++   S + +++      D I+ +  + QL+  ++++ + I PI    + + +   LG  V +  SY  P+  ++  +A  +   + +  V++ TKT+ E+ L M+   +        Q     + E    +K   DD+M  ++  AS  G +  M+ +I ++ ++L E     P       T + +Q+      TV   S  K I+VT   ++  TK +   E+   L+            ++  DY  L   +   M++     ++   +++  V  +G  C+ L++            Y ++E I   RS   +++ ++  LQ+ ++GTQ CI AA +V+ ++ADLDT I+F          +N+EN +    + A  +E+I K  K+LV D + +V       + LA A  ++     QL   VK  A ++GSN                Q +L+NA++DVA AL D    TK   +   D +     LK + + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++  IP                             +K  S E  + MTK + +A+ KA+AA  + +QED++  AN+ RKA++D++                    I  ++A    D      E V+  +++   +G       +D+ E++   V   K     K Q+   S+R+A ++ E+ ++A  +K T   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++  S   +  ++ QWS GLISAAR+VAAAT +L ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LV+ A +      D  D  +   +       V  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:    5 SLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGD---ILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQF----------NRTGKAEH----GSVALPAVMRSGSSGPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAGDP---ADTDYTAVGCAITTISSNLTEMSKGVKLLAAL---MDDDVGSGEDLLRAARTLAGAVSDLLKAVQPTSGE-----------------PRQTVLTAAGSIGQASGDLLRQIGENE---TDERFQ--DVLMSLAKAVANAAAMLV--LKAKNVA-QVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAAT-SDSELLKQVSAAASVVSQALHDLLQH--VRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAISNKNPSAQQQLVQSCKAVADHI-PQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNT----VQTLKNELQDAKMAAAESQLKPLPGETLEKCAQDLGSTSKGVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALKTLAQAARGVAASTNDPEAAHAMLDSARDVMEGSAMLIQEAKQAL----IAPGDTESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDV---ALKSIGEASKKLLVDSLP-----PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQMQVIGNLKNISMASSKLLLAAKSLSVDPGAP---NAKNLLAAAARAVTESINQLIMLCTQQAP-GQKECDNALRELETVKGML--ENPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLV-DPIQFARANQAIQMA--CQNLVDPGSSPSQVLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATTPLIEAVENLTAFA-----SNPEFASIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLATR------DDISVEALQEQLTSVVQEIGHLIDPIAT--AARGEAAQLGHKVTQLASYFEPLILAAVGVASKMLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEP-----KGTFVDYQT------TVVKYS--KAIAVT--AQEMMTKSVTNPEELGGLA-----------SQMTTDYGHL--ALQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARSVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMF-----ATAGTLNAENGE----TFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSNDP------------ETQVVLINAIKDVAKALSDLIGATKGAASKPAD-DPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQELTVFQSKDIP-----------------------------EKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDML--------------------IACKQASFYPD----VSEEVRTRALR---YGTECTLGYLDLLEHV--LVILQKPTPELKHQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVG-SIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKF-------VGGIAQIIAAQEEMLKKERELEEARKKLAQIRQ 2527          
BLAST of Talin vs. Ensembl Mouse
Match: Tln2 (talin 2 [Source:MGI Symbol;Acc:MGI:1917799])

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 835/2759 (30.26%), Postives = 1421/2759 (51.50%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIG-QGNVNV-QPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLI--AEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLS--LKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQD----LMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLI-FQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENW-IPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE----HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            +L+I +   N   +++ +  T VYD CR + +R+P+ +     ++GLF+SD D  +  WL+  + + YY L  GD   +L +K + R   IR +D + KT+ VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +   T TLK+ +T +RD  K+EK+K KL TDD+LNWL H +T R+ G+DE + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ E+A +  G Q Q + G     K K    +LKEFLPKEY+K +G +K+I  +++     S+ + KV Y +L RSL+TYG++FFLVKEK++ KNKLVPRL+GI+K+ VMRVDEKTKE++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K+ ++   F          N      H    G + + +  R GS+ P      S    Q  V V Q  +  +  L+  ++ALM  I  ++  ++ A +DL +   +  LG D +SR + +  +D +K  +   + ++T  T +++ +   D     + DY  +  AI TI  N  ++ + ++ +  +    D++  +G +L+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L++ AK +AN  + +V  +K  +VA +  + T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV+N ++  Q    + S + +Q+    +++ +++  L QH  +    +  +P+          +  +E + +++G++ EMV QA++LA+A ++L + +             S + + +D +  ++L+ AA+ L D+  ++V A K      E   + QQ L +AA  +    +  A   I++++   LE A +Q A  A Q + +SQ AA + +  ++  Q+    + + + + P+++      +    D +AQ  L+ + Q  +Q   +++ S++A  P V D +    L+   +N  TSLA+L+   Q+A     P  + +  N     +QTL + +  A  + A  +L PLPGET+E  +  +GS+SK       +L       N + +       G+      +A+E  ++++ L + ARG+AA  +  ++   + +   DV++    +I+  +  +    +A     +   L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TK   + QSE   A A  NQ+ G+++++    S  L   + + ++  D  L  G+++   A+   +Q Q+   LK++S  S+ LL   K L    G+      K  L  AA  V++SIN L+  C    P  Q+ C+++ R+LE +K  L  E P+ P+++ SY  C++SV E S+ L   M  I    KTGD   F   + + S +   + ++  QA Y +G+   N+       V +PI  +    A  M+  C ++    +S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S +N    + A   ++  VE LT  A     +NP   +I  Q    G QAQ  I  ++  M+E S  L+R A +L  + K  P       +  T    +  L   ++  APGQRE     + + + +R++++A++   S + +++      D I+ +  + QL+  ++++ + I PI    + + +   LG  V +  SY  P+  ++  +A  +   + +  V++ TKT+ E+ L M+   +        Q     + E    +K   DD+M  ++  AS  G +  M+ +I ++ ++L E     P       T + +Q+      TV   S  K I+VT   ++  TK +   E+   L+            ++  DY  L   +   M++     ++   +++  V  +G  C+ L++            Y ++E I   RS   +++ ++  LQ+ ++GTQ CI AA +V+ ++ADLDT I+F          +N+EN +    + A  +E+I K  K+LV D + +V       + LA A  ++     QL   VK  A ++GSN                Q +L+NA++DVA AL D    TK   +   D +     LK + + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++  IP                             +K  S E  + MTK + +A+ KA+AA  + +QED++  AN+ RKA++D++                    I  ++A    D      E V+  +++   +G       +D+ E++   V   K     K Q+   S+R+A ++ E+ ++A  +K T   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++  S   +  ++ QWS GLISAAR+VAAAT +L ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LV+ A +      D  D  +   +       V  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:    5 SLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGD---ILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQF----------NRTGKAEH----GSVALPAVMRSGSSGPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAGDP---ADTDYTAVGCAITTISSNLTEMSKGVKLLAAL---MDDDVGSGEDLLRAARTLAGAVSDLLKAVQPTSGE-----------------PRQTVLTAAGSIGQASGDLLRQIGENE---TDERFQ--DVLMSLAKAVANAAAMLV--LKAKNVA-QVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAAT-SDSELLKQVSAAASVVSQALHDLLQH--VRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAISNKNPSAQQQLVQSCKAVADHI-PQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNT----VQTLKNELQDAKMAAAESQLKPLPGETLEKCAQDLGSTSKGVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALKTLAQAARGVAASTNDPEAAHAMLDSARDVMEGSAMLIQEAKQAL----IAPGDTESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDV---ALKSIGEASKKLLVDSLP-----PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQMQVIGNLKNISMASSKLLLAAKSLSVDPGAP---NAKNLLAAAARAVTESINQLIMLCTQQAP-GQKECDNALRELETVKGML--ENPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLV-DPIQFARANQAIQMA--CQNLVDPGSSPSQVLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATTPLIEAVENLTAFA-----SNPEFASIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLATR------DDISVEALQEQLTSVVQEIGHLIDPIAT--AARGEAAQLGHKVTQLASYFEPLILAAVGVASKMLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEP-----KGTFVDYQT------TVVKYS--KAIAVT--AQEMMTKSVTNPEELGGLA-----------SQMTTDYGHL--ALQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARSVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMF-----ATAGTLNAENGE----TFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSNDP------------ETQVVLINAIKDVAKALSDLIGATKGAASKPAD-DPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQELTVFQSKDIP-----------------------------EKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDML--------------------IACKQASFYPD----VSEEVRTRALR---YGTECTLGYLDLLEHV--LVILQKPTPELKHQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVG-SIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKF-------VGGIAQIIAAQEEMLKKERELEEARKKLAQIRQ 2527          
BLAST of Talin vs. Ensembl Mouse
Match: Tln2 (talin 2 [Source:MGI Symbol;Acc:MGI:1917799])

HSP 1 Score: 974.541 bits (2518), Expect = 0.000e+0
Identity = 835/2759 (30.26%), Postives = 1421/2759 (51.50%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIG-QGNVNV-QPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLI--AEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLS--LKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQD----LMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLI-FQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENW-IPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE----HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            +L+I +   N   +++ +  T VYD CR + +R+P+ +     ++GLF+SD D  +  WL+  + + YY L  GD   +L +K + R   IR +D + KT+ VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +   T TLK+ +T +RD  K+EK+K KL TDD+LNWL H +T R+ G+DE + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ E+A +  G Q Q + G     K K    +LKEFLPKEY+K +G +K+I  +++     S+ + KV Y +L RSL+TYG++FFLVKEK++ KNKLVPRL+GI+K+ VMRVDEKTKE++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K+ ++   F          N      H    G + + +  R GS+ P      S    Q  V V Q  +  +  L+  ++ALM  I  ++  ++ A +DL +   +  LG D +SR + +  +D +K  +   + ++T  T +++ +   D     + DY  +  AI TI  N  ++ + ++ +  +    D++  +G +L+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L++ AK +AN  + +V  +K  +VA +  + T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV+N ++  Q    + S + +Q+    +++ +++  L QH  +    +  +P+          +  +E + +++G++ EMV QA++LA+A ++L + +             S + + +D +  ++L+ AA+ L D+  ++V A K      E   + QQ L +AA  +    +  A   I++++   LE A +Q A  A Q + +SQ AA + +  ++  Q+    + + + + P+++      +    D +AQ  L+ + Q  +Q   +++ S++A  P V D +    L+   +N  TSLA+L+   Q+A     P  + +  N     +QTL + +  A  + A  +L PLPGET+E  +  +GS+SK       +L       N + +       G+      +A+E  ++++ L + ARG+AA  +  ++   + +   DV++    +I+  +  +    +A     +   L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TK   + QSE   A A  NQ+ G+++++    S  L   + + ++  D  L  G+++   A+   +Q Q+   LK++S  S+ LL   K L    G+      K  L  AA  V++SIN L+  C    P  Q+ C+++ R+LE +K  L  E P+ P+++ SY  C++SV E S+ L   M  I    KTGD   F   + + S +   + ++  QA Y +G+   N+       V +PI  +    A  M+  C ++    +S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S +N    + A   ++  VE LT  A     +NP   +I  Q    G QAQ  I  ++  M+E S  L+R A +L  + K  P       +  T    +  L   ++  APGQRE     + + + +R++++A++   S + +++      D I+ +  + QL+  ++++ + I PI    + + +   LG  V +  SY  P+  ++  +A  +   + +  V++ TKT+ E+ L M+   +        Q     + E    +K   DD+M  ++  AS  G +  M+ +I ++ ++L E     P       T + +Q+      TV   S  K I+VT   ++  TK +   E+   L+            ++  DY  L   +   M++     ++   +++  V  +G  C+ L++            Y ++E I   RS   +++ ++  LQ+ ++GTQ CI AA +V+ ++ADLDT I+F          +N+EN +    + A  +E+I K  K+LV D + +V       + LA A  ++     QL   VK  A ++GSN                Q +L+NA++DVA AL D    TK   +   D +     LK + + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++  IP                             +K  S E  + MTK + +A+ KA+AA  + +QED++  AN+ RKA++D++                    I  ++A    D      E V+  +++   +G       +D+ E++   V   K     K Q+   S+R+A ++ E+ ++A  +K T   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++  S   +  ++ QWS GLISAAR+VAAAT +L ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LV+ A +      D  D  +   +       V  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:    7 SLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGD---ILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQF----------NRTGKAEH----GSVALPAVMRSGSSGPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAGDP---ADTDYTAVGCAITTISSNLTEMSKGVKLLAAL---MDDDVGSGEDLLRAARTLAGAVSDLLKAVQPTSGE-----------------PRQTVLTAAGSIGQASGDLLRQIGENE---TDERFQ--DVLMSLAKAVANAAAMLV--LKAKNVA-QVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAAT-SDSELLKQVSAAASVVSQALHDLLQH--VRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAISNKNPSAQQQLVQSCKAVADHI-PQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNT----VQTLKNELQDAKMAAAESQLKPLPGETLEKCAQDLGSTSKGVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALKTLAQAARGVAASTNDPEAAHAMLDSARDVMEGSAMLIQEAKQAL----IAPGDTESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDV---ALKSIGEASKKLLVDSLP-----PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQMQVIGNLKNISMASSKLLLAAKSLSVDPGAP---NAKNLLAAAARAVTESINQLIMLCTQQAP-GQKECDNALRELETVKGML--ENPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLV-DPIQFARANQAIQMA--CQNLVDPGSSPSQVLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATTPLIEAVENLTAFA-----SNPEFASIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLATR------DDISVEALQEQLTSVVQEIGHLIDPIAT--AARGEAAQLGHKVTQLASYFEPLILAAVGVASKMLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEP-----KGTFVDYQT------TVVKYS--KAIAVT--AQEMMTKSVTNPEELGGLA-----------SQMTTDYGHL--ALQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARSVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMF-----ATAGTLNAENGE----TFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSNDP------------ETQVVLINAIKDVAKALSDLIGATKGAASKPAD-DPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQELTVFQSKDIP-----------------------------EKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDML--------------------IACKQASFYPD----VSEEVRTRALR---YGTECTLGYLDLLEHV--LVILQKPTPELKHQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVG-SIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKF-------VGGIAQIIAAQEEMLKKERELEEARKKLAQIRQ 2529          
BLAST of Talin vs. Ensembl Mouse
Match: Tln2 (talin 2 [Source:MGI Symbol;Acc:MGI:1917799])

HSP 1 Score: 433.721 bits (1114), Expect = 7.623e-125
Identity = 442/1560 (28.33%), Postives = 757/1560 (48.53%), Query Frame = 3
Query: 3633 SAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLI--AEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLS--LKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQD----LMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLI-FQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENW-IPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE----HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            +A+E  ++++ L + ARG+AA  +  ++   + +   DV++    +I+  +  +    +A     +   L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TK   + QSE   A A  NQ+ G+++++    S  L   + + ++  D  L  G+++   A+   +Q Q+   LK++S  S+ LL   K L    G+      K  L  AA  V++SIN L+  C    P  Q+ C+++ R+LE +K  L  E P+ P+++ SY  C++SV E S+ L   M  I    KTGD   F   + + S +   + ++  QA Y +G+   N+       V +PI  +    A  M+  C ++    +S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S +N    + A   ++  VE LT  A     +NP   +I  Q    G QAQ  I  ++  M+E S  L+R A +L  + K  P       +  T    +  L   ++  APGQRE     + + + +R++++A++   S + +++      D I+ +  + QL+  ++++ + I PI    + + +   LG  V +  SY  P+  ++  +A  +   + +  V++ TKT+ E+ L M+   +        Q     + E    +K   DD+M  ++  AS  G +  M+ +I ++ ++L E     P       T + +Q+      TV   S  K I+VT   ++  TK +   E+   L+            ++  DY  L   +   M++     ++   +++  V  +G  C+ L++            Y ++E I   RS   +++ ++  LQ+ ++GTQ CI AA +V+ ++ADLDT I+FA +G+     +N+EN +    + A  +E+I K  K+LV D + +V       + LA A  ++     QL   VK  A ++GSN                Q +L+NA++DVA AL D    TK   +   D +     LK + + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++  IP                             +K  S E  + MTK + +A+ KA+AA  + +QED++  AN+ RKA++D++                    I  ++A    D      E V+  +++   +G       +D+ E++   V   K     K Q+   S+R+A ++ E+ ++A  +K T   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++  S   +  ++ QWS GLISAAR+VAAAT +L ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LV+ A +      D  D  +   +       V  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:   32 AARETAQALKTLAQAARGVAASTNDPEAAHAMLDSARDVMEGSAMLIQEAKQAL----IAPGDTESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDV---ALKSIGEASKKLLVDSLP-----PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQMQVIGNLKNISMASSKLLLAAKSLSVDPGAP---NAKNLLAAAARAVTESINQLIMLCTQQAP-GQKECDNALRELETVKGML--ENPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLV-DPIQFARANQAIQMA--CQNLVDPGSSPSQVLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATTPLIEAVENLTAFA-----SNPEFASIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLATR------DDISVEALQEQLTSVVQEIGHLIDPIAT--AARGEAAQLGHKVTQLASYFEPLILAAVGVASKMLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEP-----KGTFVDYQT------TVVKYS--KAIAVTA--QEMMTKSVTNPEELGGLA-----------SQMTTDYGHL--ALQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARSVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMFATAGT-----LNAENGE----TFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSNDP------------ETQVVLINAIKDVAKALSDLIGATKGAASKPAD-DPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQELTVFQSKDIP-----------------------------EKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDML--------------------IACKQASFYPD----VSEEVRTRALR---YGTECTLGYLDLLEHV--LVILQKPTPELKHQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVG-SIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKF-------VGGIAQIIAAQEEMLKKERELEEARKKLAQIRQ 1437          
BLAST of Talin vs. UniProt/SwissProt
Match: sp|Q9Y490|TLN1_HUMAN (Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3)

HSP 1 Score: 1010.36 bits (2611), Expect = 0.000e+0
Identity = 852/2769 (30.77%), Postives = 1407/2769 (50.81%), Query Frame = 3
Query:   69 MHTLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMK-TMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQP--IAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITA----HQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASN------YQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLN-NYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVI--QGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPN--NQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG-VLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLA-QLLPHSRDRGEVIELTKTVLEAFLAMVQECETLS-----TTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDA-ASAHTLIFQSIKGITDTVTD----------------NSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVT--GVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFI---GQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            M  L + I   N   +++ +  T+VYD CR + +RIP+       +FGLF+SD D  +  WL+  K + YY L  GD    + ++ + R L IR +D T KT+ VDDSK++ ++++ IC ++GI+NH+EYSL+ EL E ++ + T TL++ KT +RD  K+EK+KQKL TDDELNWL HG+TLR+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A + AG QCQ + G     K K+   +LK+FLPKEYVK KG ++KI   ++     S+ + KV Y +L RSLKTYG++FFLVKEK++ KNKLVPRL+GI+KE VMRVDEKTKE+IQ W LT ++R+AA+   F+LDFGDY D  Y +QTTEGE+IAQLI GYIDII+KK+K+KD+   + +EE+ M+E++V+P K+ V+   +          N +  + H    G + + +  R G++ P    + +     Q   + Q  +  +  L+  ++AL   I  +++ ++AA   LD    +  LG D +S+ +RK  +D +K  +   + ++T  T +++ +   D       DY  +  A+ TI  N   L E  R V  +    ++E  +G  L++AAK L  A  +LL +++P + E                   + L++A   VG+AS  LL  I       SD +   +D L+  AK +A+  +    ++K  SVA + T+ +  Q  +I AA     +TS L++  KVVA +I  P+ Q+QL  + + V  +V+  +   Q   E   ++ + +      + +++++L QH+  ++  A      D      L+ +E + +++G++ EMV QA+ILA+A ++L + +   A  +S            D +  R+L+ AA+ L DA  K+V A K      + + E QQ L +AA  +    +  A   I+++L + LE A +Q A +A Q + ++Q AA T +AS        Q C    E     +P ++      +  P  P+AQ  L+ A Q  +Q   +++ +++A  P ++D +    L+   +N  T+LA+L+   Q+A     P  + +  ++    +Q L   +     +   G+L PLPGET+E  +  +G+S+KA S    +L   +   N NY         G+      +A+++   +  L + ARG+AAL S       + +   DV+D    +I   +      G   +  R   + ++ K++ +    ++  V  +P  +++D   + L++  +   + + ++ P       T +  + QS    A A  NQ   +L+  S  T   L   + +  +     L  G+++  + P+  ++ Q+ S LK +S +S+ LL   K L     + ++      L  AA  V+DSIN L++ C    P  Q+ C+++ R+LE ++   L E P  PIN+ SY  C+ SV E S+ L   M  I    K G+  +F  AI   S +     ++  QA Y +G+   N+       V  P   +    A  M+  C S+     ++      AT +    S++C   +     +++P  + + + + K VA +T NL+KTI +   + + EN    +A    +L  V+ L+  A     +NP   +I  Q    GR A   I  ++  M+E +  L++ A AL  + +  P+      + +T    + +L   ++  APGQ E       L   LR+LD+A++   S   + +    S +++++   +M  +++++ + I P+ N  + +++   LG  V +   Y  P++ ++   A + L H +    +++ TKT+ E+ L ++   +             + L E V  +    +DL   ++  AS  G +  M+ SI ++  +L E     P  +     T + ++ K I  TV +                N L  D    RL   E+     A E+ +I S      + +  ++L H   +LVT  G +Q   S A                          Y +KE I    +V  +++ ++  LQ+ +RGTQ CI AA++V+ ++ADLDT I+F          +N E  +    + A  +E I K  K LV D + +V +  G QE LA A  ++V    +L   VK            LG + +  E    Q +L+NAV+DVA AL D  + TK       D +     LK+S + MV +V  L+K+VK++ED   +GTRALE + E +R+E     +  P                              K  + E+ + MTK + +A+ KA+AA  + +QED++  AN+ R+AI D++           KE    P     E AP V               ++ + +G+      +++ +++  ++   K +   K Q+T  S+R+A S+ E+ ++A  +K T   D EDP     IAENELL AA+ IE AAKK+  LKPR    K+  E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LVK A +    ++           + MV  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:    1 MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGD---TMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKG-ERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQY----------NRVGKVEH----GSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGD---PAETDYTAVGCAVTTISSN---LTEMSRGVKLLAALLEDEGGSGRPLLQAAKGLAGAVSELLRSAQPASAE-----------------PRQNLLQAAGNVGQASGELLQQIGE-----SDTDPHFQDALMQLAKAVASAAA--ALVLKAKSVA-QRTEDSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLL-RGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGES------------DLENSRKLLSAAKILADATAKMVEAAKGAAAHPD-SEEQQQRLREAAEGLRMATNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVAEQ----IPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSV----VQNLEKDLQEVKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYA--------GI------AARDVAGGLRSLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQR---LAQVAKAVTQA---LNRCVSCLPGQRDVD---NALRAVGDASKRLLSDSLP-----PSTGTFQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPAAPNLK---SQLAAAARAVTDSINQLITMCTQQAP-GQKECDNALRELETVRE--LLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLV-EPTQFARANQAIQMA--CQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRAATAPLLEAVDNLSAFA-----SNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPR-EGISQEALHT---QMLTAVQEISHLIEPLAN--AARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMA-LLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYG--RL-ASEAKPAAVAAENEEIGSH-----IKHRVQELGHGCAALVTKAGALQCSPSDA--------------------------YTKKELIECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMF-----ATAGTLNREGTE----TFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVK------------LGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGD-DPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPA----------------------------KTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLR--------ACKEAAYHP-----EVAPDV--------------RLRALHYGRECANGYLELLDHVLLTLQ--KPSPELKQQLTGHSKRVAGSVTELIQAAEAMKGTEWVDPEDPT---VIAENELLGAAAAIEAAAKKLEQLKPRAK-PKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAL---DDGQWSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFEEQENETVV--VKEKMVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQ 2527          
BLAST of Talin vs. UniProt/SwissProt
Match: sp|P26039|TLN1_MOUSE (Talin-1 OS=Mus musculus OX=10090 GN=Tln1 PE=1 SV=2)

HSP 1 Score: 1004.2 bits (2595), Expect = 0.000e+0
Identity = 852/2768 (30.78%), Postives = 1402/2768 (50.65%), Query Frame = 3
Query:   69 MHTLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYEL-DENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQP--IAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITA----HQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASN------YQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLN-NYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAV---AIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPN--NQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG-VLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLA-QLLPHSRDRGEVIELTKTVLEAFLAMVQECETLS-----TTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDA-ASAHTLIFQSIKGITDTVTD----------------NSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFI---GQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            M  L + I   N   +++ +  T+VYD CR + +RIP+       +FGLF+SD D  +  WL+  K + YY L  GD    + ++ + R L IR +D T KT+ VDDSK++ ++++ IC ++GI+NH+EYSL+ EL +E +   T TL++ KT +RD  K+EK+KQKL TDDELNWL HG+TLR+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A + AG QCQ + G     K K+   +LK+FLPKEYVK KG ++KI   ++     S+ + KV Y +L RSLKTYG++FFLVKEK++ KNKLVPRL+GI+KE VMRVDEKTKE+IQ W LT ++R+AA+   F+LDFGDY D  Y +QTTEGE+IAQLI GYIDII+KK+K+KD+   + +EE+ M+E++V+P K+ V+   +          N +  + H    G + + +  R G++ P    + +     Q   + Q  +  +  L+  ++AL   I  +++ ++AA   LD    +  LG D +S+ +RK  +D +K  +   + ++T  T +++ +   D       DY  +  A+ TI  N   L E  R V  +    ++E  NG  L++AAK L  A  +LL +++P + E                   + L++A   VG+AS  LL  I       SD +   +D L+  AK +A+  +    ++K  SVA + T+ +  Q  +I AA     +TS L++  KVVA +I  P+ Q+QL  + + V  +V+  +   Q   E   ++ + +      + +++++L QH+  ++  A      D      L+ +E + +++G++ EMV QA+ILA+A ++L + +   A  +S            D +  R+L+ AA+ L DA  K+V A K      + + E QQ L +AA  +    +  A   I+++L + LE A +Q A +A Q + ++Q AA   +AS        Q C    E     +P ++      +  P  P+AQ  L+ A Q  +Q   +++ +++A  P ++D +    L+   +N  T+LA+L+   Q+A     P  + +  ++    +Q L   +     +   G+L PLPGET+E  +  +G+S+KA S    KL   +   N NY         G+      +A+++   +  L + ARG+AAL S           Q  V+D    ++     +I+  K AS       +   L +    + + ++  V  +P  +++D   + L++  +   + + ++ P       T +  + QS    A A  NQ   +L+  S  T   L   + +  +     L  G+++  + P+  ++ Q+ S LK +S +S+ LL   K L     S ++     +  +A   V+DSIN L++ C    P  Q+ C+++ RQLE ++   L E P  PIN+ SY  C+ SV E S+ L   M  I    K G+  +F  AI   S +     ++  QA Y +G+   N+       V  P   +    A  M+  C S+     ++      AT +    S++C   +     +++P  + + + + K VA +T NL+KTI +     + EN    +A    +L  V+ L+  A     +NP   ++  Q    GR A   I  ++  M+E +  L++ A AL  + +  P       + +T    + +L   ++  APGQ E       L   LR+LD+A++   S   + +    S +++++   +M  +++++ + I P+ +  + +++   LG  V +   Y  P++ ++   A + L H +    +++ TKT+ E+ L ++   +             + L E V  +    +DL   ++  AS  G +  M+ SI ++  +L E     P  +     T + ++ K I  TV +                N L  D      Q K +     A E+ +I      A + +  ++L H   +LVT       +GA                    C     Y +KE I    +V  +++ ++  LQ+ +RGTQ CI AA++V+ ++ADLDT I+FA +G+     +N E  +    + A  +E I K  K LV D + +V +  G QE LA A  ++V    +L   VK            LG + +  E    Q +L+NAV+DVA AL D  + TK       D +     LK+S + MV +V  L+K+VK++ED   +GTRALE + E +R+E     +  P                              K  + E+ + MTK + +A+ KA+AA  + +QED++  AN+ R+AI D++                K +    E AP V               ++ + +G+      +++ +++  ++   K N   K Q+T  S+R+A S+ E+ ++A  +K T   D EDP     IAENELL AA+ IE AAKK+  LKPR    K+  E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LVK A +    +D           + MV  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:    1 MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGD---TMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKG-ERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQY----------NRVGKVEH----GSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPA---ETDYTAVGCAVTTISSN---LTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEP-----------------RQNLLQAAGNVGQASGELLQQIGE-----SDTDPHFQDVLMQLAKAVASAAA--ALVLKAKSVA-QRTEDSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLL-RGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGES------------DLENSRKLLSAAKILADATAKMVEAAKGAAAHPD-SEEQQQRLREAAEGLRMATNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASAPKASAGPQPLLVQSCKAVAEQ----IPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSV----VQNLEKDLQEIKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAKLLGEIAQGNENYA--------GI------AARDVAGGLRSLAQAARGVAALTSDP-------AVQAIVLDTASDVLDKASSLIEEAKKASGHPGDPESQQRLAQVAKAVTQALNRCVSCLPGQRDVD---NALRAVGDASKRLLSDSLP-----PSTGTFQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPASPNLKSQLAAAARA---VTDSINQLITMCTQQAP-GQKECDNALRQLETVRE--LLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLV-EPTQFARANQAIQMA--CQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFA-----SNPEFSSVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPR-EGISQEALHT---QMLTAVQEISHLIEPLAS--AARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMA-LLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAV---AAENEEI-----GAHIKHRVQELGHGCSALVT------KAGALQ------------------CSPSDVYTKKELIECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGT-----LNREGAE----TFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVK------------LGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGD-DPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPA----------------------------KTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLR-------------ACKEAAFHPEVAPDVR--------------LRALHYGRECANGYLELLDHVLLTLQ--KPNPDLKQQLTGHSKRVAGSVTELIQAAEAMKGTEWVDPEDPT---VIAENELLGAAAAIEAAAKKLEQLKPRAK-PKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAL---DDGQWSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFEDQENETVV--VKEKMVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQ 2527          
BLAST of Talin vs. UniProt/SwissProt
Match: sp|P54939|TLN1_CHICK (Talin-1 OS=Gallus gallus OX=9031 GN=TLN1 PE=1 SV=2)

HSP 1 Score: 998.808 bits (2581), Expect = 0.000e+0
Identity = 854/2779 (30.73%), Postives = 1414/2779 (50.88%), Query Frame = 3
Query:   69 MHTLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNF--IDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIG---QGNVNV---QPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKL----KQHLIINSITAHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLN-NYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVI--QGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPN--NQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRE-----LATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG-VLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLS-----TTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGE--DKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVR---SRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLA--SRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            M  L + I   N   +++ +  T+VYD CR + +R+P+ +     +FGLF+SD D  +  WL+  K + YY L  GD    + +K + R L IR +D T KT+ VDDSK++ +++  IC ++GI+N++EYSL+ E ++E +   T TLK+ KT +RD  K+EK+KQKL TDDELNWL HG+TLR+ GID+ + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A + AG QCQ + G     K K     LK+FLPKEY+K KG ++KI   ++     S+ + KV Y +L RSLKTYG++FFLVKEK++ KNKLVPRL+GI+KE VMRVDEKTKE+IQ W LT ++R+AA+   F+LDFGDY D  Y +QTTEGE+IAQLI GYIDII+KK+K+KD+   + +EE+ M+E++V+P K+ V+   F  + K  L                G + + +  R G+  P     + ++G   Q  + +   Q  +  +  L+  ++AL   I  +++ + AA   LD    +  LG D +S+ +RK  +D +K  +     ++T  T +++ +   D     + DY  +  A+ TI  N  ++ + ++ +  +    ++E  NG  L++AAK L +A  DLL  ++P + E                   + L++A   VG+ S  LL  I       SD + + +D L+  AK +A+  +    ++K  +VA K T+ +  Q  +I AA     +TS L++  KVVA +I  P+ Q+QL  + + V  S +  ++  +       ++ +Q+      + ++++ L    KQH          D      L+ +E + +++G++ EMV QA+ILA+A ++L + +             + +    D +  R+L+ AA+ L DA  K+V A K      + + E QQ L +AA  +    +  A   I+++L   LE A +Q A +A Q + ++Q AA + +  A+  Q+    + + + + P ++      +  P  P+AQ  L+ A Q  +Q   +++ +++A  P + D +    L+   +N   +LA+L+   Q+A     P  + +      G +Q+L   +  A  +   G+L PLPGET+E  +  +G+S+KA +     L   +   N NY         G+      +A+E+ +++  L + ARG+AA  S   +   + E   DV+D    +I      +   G   +  R V   ++ K++ +    ++  V  +P  +++D  +  +  +     K ++++      +NKT    + QS+   A A  NQ+  +L+  S  T   L   + +  +  +  L  G+++ +  P   +Q Q+ S LKS+S +S+ LL   K L A   S ++      L  AA  V+DSIN L++ C    P  Q+ C+++ R+LE +K   L E P+  +N+ SY  C+ SV E S+ L   M  I    K     +F  +I   S +   + ++  QA Y +G+   N+       V +P      Q A   +   I MA  N  +  C +      AT +    S++C   +   + +++P  + + +   K VA +T NL+KTI +   + + EN E  +A    ++  V+ LT  A     +NP   T+  Q    GR+A   I  ++  M+E S  L++ A +L  + K  P       + +T    + +L   ++  APGQRE  E  + L + +R +D+A++   S   + +    S +++++   +M  +++++ N I P+ +  + +++   LG  V +   Y  P+  ++   A   P+ + +  +++ TKT+ E+ L M+   +             + L E V  +K   +DL   ++  AS  G +  M+ SI ++  +L E     P+       + +Q+      T+   +    ++V  +  K +T     N D   +  N          +L +DY  L     Q     A   ++ E    +K+ V  +G  C  L+             Y +KE I   R    +++ ++  LQ+ +RGTQ CI AA++V+ ++ADLDT I+F          +N EN +    + A  +E I K  K+LV D + +V +    QE LA A  ++V    +L   VK  A ++GS            E    Q +L+NAV+DVA AL D    TK       D +     LK+S + MV +V  L+K+VK++ED   +GTRALE ++E +R+E     + +P  +                            + + E+ + MTK + +A+ KA+AA  + +QED++  AN+ R+AI D++           KE    P         + +D  +R +   KE +               D Y  L + V    +  +H+++  LA  S+R+A S+ E+ ++A  +K T   D EDP     IAENELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LVK A +    QD           + MV  +  +I AQ +++ KERELE  R K   IRQ      P
Sbjct:    1 MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERVPEAQMGQPNDFGLFLSDEDPKKGIWLEAGKALDYYMLRNGD---TMEYKKKQRPLKIRMLDGTVKTVMVDDSKTVTDMLTTICARIGITNYDEYSLVREIMEEKKEEVTGTLKKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGIDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIKQKG-ERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQFNRVGKAEL----------------GSVALPAIMRTGAGGP----ENFQVGTMPQAQMQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVNAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQADAITAGTASVVNLTAGDP---ADTDYTAVGCAVTTISSNLTEMSKGVKLLAAL---MEDEGGNGRQLLQAAKNLASAVSDLLKTAQPASAE-----------------PRQNLLQAAGLVGQTSGELLQQIGE-----SDTDPRFQDMLMQLAKAVASAAA--ALVLKAKNVAQK-TEDSALQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLIEAGKLVAKSAEGCVEASKAATNDDQLL-KQVGVAATAVTQALNDLLQHIKQHATGGQPIGRYDQATDTILNVTENIFSSMGDAGEMVRQARILAQATSDLVNAIK------------ADAEGETDLENSRKLLSAAKILADATAKMVEAAKGAAAHPD-SEEQQQRLREAAEGLRMATNAAAQNAIKKKLVHKLEHAAKQAAASATQTIAAAQHAAASNKNPAAQQQLVQSCKVVADQI-PMLVQGVRGSQSQPDSPSAQLALIAASQNFLQPGGKMVAAAKATVPTITDQASAMQLSQCAKNLAAALAELRTAAQKAQEACGPLEIDSAL----GLVQSLERDLKEAKAAARDGKLKPLPGETMEKCAQDLGNSTKAVTSAIAHLLGEVAQGNENY--------TGI------AAREVAQALRSLSQAARGVAANSSDPQAQNAMLECASDVMDKANNLIEEARKAVAKPGDPDSQQRLV---QVAKAVSQA---LNRCVNCLPGQRDVDAAIRMVGEA----SKRLLSDS--FPPSNKT--FQEAQSQLNRAAAGLNQSANELVQASRGTPQDLAKSSGKFGQDFNEFLQAGVEMASLSPTKEDQAQVVSNLKSISMSSSKLLLAAKALSADPTSPNLK---SQLAAAARAVTDSINQLITMCTQQAP-GQKECDNALRELETVKE--LLENPTQTVNDMSYFSCLDSVMENSKVLGESMAGISQNAKNSKLPEFGESISAASKALCGLTEAAAQAAYLVGVSDPNSQAGQQGLV-DP-----TQFAR--ANQAIQMACQNLVDPACTQSQVLSAATIVAKHTSALCNTCRLASSRTANPVAKRQFVQPAKEVANSTANLVKTIKALDGAFNEENRERCRAATAPLIEAVDNLTAFA-----SNPEFATVPAQISPEGRRAMEPIVTSAKTMLESSAGLIQTARSLAVNPKDPPQWSVLAGHSRTVSDSIKKLITNMRDKAPGQRECDEAIDVLNRCMREVDQASLAAISQQLAPR-EGISQEALHN---QMITAVQEINNLIEPVAS--AARAEASQLGHKVSQMAQYFEPLILAAIGAASKTPNHQQQMNLLDQTKTLAESALQMLYTAKEAGGNPKQAAHTQEALEEAVQMMKEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDE----GPMGEPEGTFVDYQT------TMVKTAKAIAVTVQEMVTKSTT-----NPDELGILAN----------QLTNDYGQLA----QQAKPAALTAENEEIGSHIKRRVQELGHGCAALVTKAGALQCSPSDAYTKKELIESARKVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMF-----ATAGTLNRENSE----TFADHREGILKTAKALVEDTKVLVQNATASQEKLAQAAQSSVSTITRLAEVVKLGAASLGS------------EDPETQVVLINAVKDVAKALGDLIGATKAAAGKAGD-DPAVYQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATIEHIRQELAVFSSPVPPAQ----------------------------VSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLR--------ACKEAAYHPE--------VSADVRQRALRFGKECA---------------DGYLELLEHVLVILQKPTHELKQQLAGYSKRVASSVTELIQAAEAMKGTEWVDPEDPT---VIAENELLGAAAAIEAAAKKLEQLKPRAKPKQ-ADESLDFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGVIPANAV---DDGQWSQGLISAARMVAAATNNLCEAANAAVQGHASEEKLISSAKQVAASTAQLLVACKVKADHDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFQDHDETVVV---KEKMVGGIAQIIAAQEEMLRKERELEEARKKLAMIRQQQYKFLP 2532          
BLAST of Talin vs. UniProt/SwissProt
Match: sp|Q9Y4G6|TLN2_HUMAN (Talin-2 OS=Homo sapiens OX=9606 GN=TLN2 PE=1 SV=4)

HSP 1 Score: 974.156 bits (2517), Expect = 0.000e+0
Identity = 835/2763 (30.22%), Postives = 1420/2763 (51.39%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIG-QGNVNV-QPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLI--AEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLS--LKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQD----LMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLI-FQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE----HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            +L+I +   N   +++ +  T VYD CR + +R+P+ +     ++GLF+SD D  +  WL+  + + YY L + + +L +K + R   IR +D + KT+ VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +   T TLK+ +T +RD  K+EK+K KL TDD+LNWL H +T R+ G+DE + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ E+A +  G Q Q + G     K K    +LKEFLPKEY+K +G +K+I  +++     S+ + KV Y +L RSL+TYG++FFLVKEK++ KNKLVPRL+GI+K+ VMRVDEKTKE++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K+ ++   F          N      H    G + + +  R GS+ P      S    Q  V V Q  +  +  L+  ++ALM  I  ++  ++ A +DL +   +  LG D +SR + +  +D +K  +   + ++T  T +++ +   D     + DY  +  AI TI  N  ++ + ++ +  +    D+E  +G +L+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L++ AK +AN  + +V  +K  +VA +  + T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV+N ++  Q    T S + +Q+    +++ +++  L QH  +    +  +P+          +  +E + +++G++ EMV QA++LA+A ++L + +             S + + +D +  ++L+ AA+ L D+  ++V A K      E   + QQ L +AA  +    +  A   I++++   LE A +Q A  A Q + +SQ AA + +  A+  Q+    + + + + P+++      +    D +AQ  L+ + Q  +Q   +++ S++A  P V D +    L+   +N  TSLA+L+   Q+A     P  + +  N     +QTL + +  A  +    +L PLPGET+E  +  +GS+SKA      +L       N + +       G+      +A+E  ++++ L + ARG+AA  +   +   + +   DV++    +I+  +  +    +A   A     L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TK   + QSE   A A  NQ+ G+++++    S  L   + + ++  D  L  G+++   A+   +Q Q+   LK++S  S+ LL   K L    G+      K  L  AA  V++SIN L++ C    P  Q+ C+++ R+LE +K  L  + P+ P+++ SY  C++SV E S+ L   M  I    KTGD   F   + + S +   + ++  QA Y +G+   N+       V +PI  +    A  M+  C ++    +S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S +N    + A   ++  VE LT  A     +NP   +I  Q    G QAQ  I  ++  M+E S  L+R A +L  + K  P       +  T    +  L   ++  APGQRE     + + + +R++++A++   S + +++      D I+ +  + QL+  ++++ + I PI    + + +   LG  V +  SY  P+  ++  +A  +   + +  V++ TKT+ E+ L M+   +        Q     + E    +K   DD+M  ++  AS  G +  M+ +I ++ ++L E     P       T + +Q+      TV   S  K I+VT   ++  TK +   E+   L+            ++  DY  L       M++     ++   +++  V  +G  C+ L++            Y ++E I   R+   +++ ++  LQ+ ++GTQ CI AA +V+ ++ADLDT I+F          +N+EN +    + A  +E+I K  K+LV D + +V       + LA A  ++     QL   VK  A ++GS+                Q +L+NA++DVA AL D  + TK   +   D +     LK + + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++     +DV                        +K  S E  + MTK + +A+ KA+AA  + +QED++  AN+ RKA++D++   +                  +   P VSD  R           + +  G       +D+ E++   V   K     K Q+   S+R+A ++ E+ ++A  +K T   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++  S   +  ++ QWS GLISAAR+VAAAT +L ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LV+ A +      D  D  +   +       V  +  +I AQ +++ KERELE  R K   IRQ      P
Sbjct:    5 SLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGD-ILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQF----------NRTGKAEH----GSVALPAVMRSGSSGPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAGDP---ADTDYTAVGCAITTISSNLTEMSKGVKLLAAL---MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGE-----------------PRQTVLTAAGSIGQASGDLLRQIGENE---TDERFQ--DVLMSLAKAVANAAAMLV--LKAKNVA-QVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAAT-TDSELLKQVSAAASVVSQALHDLLQH--VRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKAVADHI-PQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNT----VQTLKNELQDAKMAAVESQLKPLPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALKTLAQAARGVAASTTDPAAAHAMLDSARDVMEGSAMLIQEAKQAL----IAPGDAERQQRLAQVAKAVSHSLNNCVNCLPGQKDVDV---ALKSIGESSKKLLVDSLP-----PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLAAKSLSVDPGAP---NAKNLLAAAARAVTESINQLITLCTQQAP-GQKECDNALRELETVKGML--DNPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLV-DPIQFARANQAIQMA--CQNLVDPGSSPSQVLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATAPLIEAVENLTAFA-----SNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLATR------DDISVEALQEQLTSVVQEIGHLIDPIAT--AARGEAAQLGHKVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEP-----KGTFVDYQT------TVVKYS--KAIAVT--AQEMMTKSVTNPEELGGLA-----------SQMTSDYGHL--AFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMF-----ATAGTLNAENSE----TFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDP------------ETQVVLINAIKDVAKALSDLISATKGAASKPVD-DPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQS-----KDV-----------------------PEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQ-----------------ASFHPDVSDEVR----------TRALRFGTECTLGYLDLLEHV--LVILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVG-SIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKF-------VGGIAQIIAAQEEMLKKERELEEARKKLAQIRQQQYKFLP 2534          
BLAST of Talin vs. UniProt/SwissProt
Match: sp|Q71LX4|TLN2_MOUSE (Talin-2 OS=Mus musculus OX=10090 GN=Tln2 PE=1 SV=3)

HSP 1 Score: 685.641 bits (1768), Expect = 0.000e+0
Identity = 564/1888 (29.87%), Postives = 992/1888 (52.54%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIG-QGNVNV-QPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLI--AEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLS--LKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV 5675
            +L+I +   N   +++ +  T VYD CR + +R+P+ +     ++GLF+SD D  +  WL+  + + YY L + + +L +K + R   IR +D + KT+ VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +   T TLK+ +T +RD  K+EK+K KL TDD+LNWL H +T R+ G+DE + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ E+A +  G Q Q + G     K K    +LKEFLPKEY+K +G +K+I  +++     S+ + KV Y +L RSL+TYG++FFLVKEK++ KNKLVPRL+GI+K+ VMRVDEKTKE++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K + I         L  + N      H    G + + +  R GS+ P      S    Q  V V Q  +  +  L+  ++ALM  I  ++  ++ A +DL +   +  LG D +SR + +  +D +K  +   + ++T  T +++ +   D     + DY  +  AI TI  N  ++ + ++ +  +    D++  +G +L+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L++ AK +AN  + +V  +K  +VA +  + T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV+N ++  Q    + S + +Q+    +++ +++  L QH  +    +  +P+          +  +E + +++G++ EMV QA++LA+A ++L + +             S + + +D +  ++L+ AA+ L D+  ++V A K      E   + QQ L +AA  +    +  A   I++++   LE A +Q A  A Q + +SQ AA + +  ++  Q+    + + + + P+++      +    D +AQ  L+ + Q  +Q   +++ S++A  P V D +    L+   +N  TSLA+L+   Q+A     P  + +  N     +QTL + +  A  + A  +L PLPGET+E  +  +GS+SK       +L       N + +       G+      +A+E  ++++ L + ARG+AA  +  ++   + +   DV++    +I+  +  +    +A     +   L +    +   ++  V  +P  +++D     LKS  E   K ++++ P       TK   + QSE   A A  NQ+ G+++++    S  L   + + ++  D  L  G+++   A+   +Q Q+   LK++S  S+ LL   K L    G+      K  L  AA  V++SIN L+  C    P  Q+ C+++ R+LE +K  L  E P+ P+++ SY  C++SV E S+ L   M  I    KTGD   F   + + S +   + ++  QA Y +G+   N+       V +PI  +    A  M+  C ++    +S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S +N    + A   ++  VE LT  A     +NP   +I  Q    G QAQ  I  ++  M+E S  L+R A +L  + K  P       +  T    +  L   ++  APGQRE     + + + +R++++A++   S + +++      D I+ +  + QL+  ++++ + I PI    + + +   LG  V +  SY  P+  ++  +A  +   + +  V++ TKT+ E+ L M+
Sbjct:    5 SLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGD-ILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKRSTI---------LQQQFNRTGKAEH----GSVALPAVMRSGSSGPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAGDP---ADTDYTAVGCAITTISSNLTEMSKGVKLLAAL---MDDDVGSGEDLLRAARTLAGAVSDLLKAVQPTSGE-----------------PRQTVLTAAGSIGQASGDLLRQIGENE---TDERFQ--DVLMSLAKAVANAAAMLV--LKAKNVA-QVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAAT-SDSELLKQVSAAASVVSQALHDLLQH--VRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAISNKNPSAQQQLVQSCKAVADHI-PQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNT----VQTLKNELQDAKMAAAESQLKPLPGETLEKCAQDLGSTSKGVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALKTLAQAARGVAASTNDPEAAHAMLDSARDVMEGSAMLIQEAKQAL----IAPGDTESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDV---ALKSIGEASKKLLVDSLP-----PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQMQVIGNLKNISMASSKLLLAAKSLSVDPGAP---NAKNLLAAAARAVTESINQLIMLCTQQAP-GQKECDNALRELETVKGML--ENPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLV-DPIQFARANQAIQMA--CQNLVDPGSSPSQVLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATTPLIEAVENLTAFA-----SNPEFASIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLATR------DDISVEALQEQLTSVVQEIGHLIDPIAT--AARGEAAQLGHKVTQLASYFEPLILAAVGVASKMLDHQQQMTVLDQTKTLAESALQML 1779          

HSP 2 Score: 276.944 bits (707), Expect = 6.304e-73
Identity = 217/626 (34.66%), Postives = 335/626 (53.51%), Query Frame = 3
Query: 6180 VGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENW-IPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAV 8009
            +G  C+ L++            Y ++E I   RS   +++ ++  LQ+ ++GTQ CI AA +V+ ++ADLDT I+FA +G+     +N+EN +    + A  +E+I K  K+LV D + +V       + LA A  ++     QL   VK  A ++GSN                Q +L+NA++DVA AL D    TK   +   D +     LK + + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++  IP                             +K  S E  + MTK + +A+ KA+AA  + +QED++  AN+ RKA++D++                    I  ++A    D      E V+  +++   +G       +D+ E++   V   K     K Q+   S+R+A ++ E+ ++A  +K T   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++  S   +  ++ QWS GLISAAR+VAAAT +L ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AV
Sbjct: 1835 LGHGCIFLVQKAGALQVCPTDSYTKRELIECARSVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMFATAGT-----LNAENGE----TFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSNDP------------ETQVVLINAIKDVAKALSDLIGATKGAASKPAD-DPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQELTVFQSKDIP-----------------------------EKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDML--------------------IACKQASFYPD----VSEEVRTRALR---YGTECTLGYLDLLEHV--LVILQKPTPELKHQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVG-SIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAV 2375          
BLAST of Talin vs. TrEMBL
Match: V4BLR4 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_218488 PE=4 SV=1)

HSP 1 Score: 1135.55 bits (2936), Expect = 0.000e+0
Identity = 899/2764 (32.53%), Postives = 1464/2764 (52.97%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGD--IGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHL-----IINSITAHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQ-AAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQICSEAQEMTEIV---LPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSALTLLAKQLNESHDC--------MLMTGLQLIAEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXX--XXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVEN-DEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEA---FLAMVQECETLSTTTNNQDLMENVS-SLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNE-TQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRD-VQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHPELF 8237
            +L+I +V +N   +++ +  T+VYD CR + +RI + +     EFGLF++D D  +  WL+  + + YY L + +L L ++ + R L +RT+D   KTL+VDDS ++  L++ IC +MGI+NHEEYSL+ EL E+E+ KT+TLKR K+  +D  KLE+MK+KL TDD++NWL H KTLR+ GID+ + LLLRRK+FFSDQNVDARDPIQLNLLYVQ ++AI++GTHPV++EEAI   GIQCQ + G+    K KS   +LKEFLPKEY+K KG +KKI  +++K  G ++ + KV Y   CRSLKTYGITFFLVKEK++ KNKLVPRL+GI+KE V+RVDEKTKE+++ WPLTTVRR+AA+ + F+LDFGDYSD  Y +QTTEGE+I+QLI GYIDII+ K+KAKD+L  D ++ + M+E+NVAP+KA +I HN    +  S    ++  +     +G+   GV   G + S Q   + N +  G    +          LS+ ++AL+I I + L  + AA   L+   ++  LG+D +S+ +R+  LD+++ +V   L +M  AT  L+ +   ++   D  DY  + +A+  I  N ++   ++R +  +     +ED NG  L+ AA+ L  AF DLL A++P               G K    N  L+ A  ++GEAS+ ++  +     +  D++   +DTLL  AK +AN  + +V  +K  +VA K T+    Q  +I +A     ATS L++  KVVA +I  P  Q+QL  +A+ V  SV+ +++  Q       V+ Q L      + ++++ L QH+        +   H++  V + ++ +++L +++G++ EMV  A++LA+A ++L   +              Q+ S  DSD Q+RL+ AA+ L DA   LV A K C      +  NQQ +++ AA  + S  +  A   ++++L K LE A RQ    + QL+ SS++A KT R  N     +     ++V   +P ++ +    + +    +AQ  L+N+ Q+ IQ   +L+  + +  P V D S    LN +++   T+LA+L+    +A        V +  +    QL  L   +D    S   G L PLPGET ES +  +G++SK  +    +L       N        + +G+ S      ++   +++ L    RG+AA  +      N+     DV+D   +++   +  ++    +   +  + ++ KS+      +   +  +P  +++D  + ++ +S +M         P     NKT  + ++Q++   +    NQ   D++ +  +  A + LA   N   +C        + M GL    E    Q Q+  GLKSVS  S+       LL A S S+D N         +AA  V++SIN L++ C  + P  Q+ C+++ RQ++ ++  L  + P+ P+++ +Y  C++SV E S++L   M  I    K  D +DFC +++  + S   + ++  QA Y +G+    +       V         Q   +  +N  + ASS    +     AT +    S++C   +   + +S+P  +   + + K VA +T NL+K I +  +  + +N  +  +A   ++  VE+LT  A      +   K I+ + RQAQ  I  A   M++G+ S+L+AA  L  + K  P  Q +  + K+    + +L + +K SAPGQRE  +  E++ QV+R LD+A++   S N    +  ++  S+ +  +++  S +++   I  + N  + + + E LG       SY  P++ S+   A    +S+ +  +++LTKTV E+   FL   +E       T+    ++N +  +K    DL++ ++  AS  G + +MI SI KS A++ E   VA  + AS             D  T+        + RL K+ +    ++ +D    S   ++++ +   ++  DY  LV+     +SS   NV D   +++  V  +G+S +++++            Y QK+     RS   +++ ++  LQ+ SRGTQ CI A+++V+ ++ DLDT I+F          +N E D+    S A  +E I K  K+LV D + +V      QE LA A   AV+   +L   VK  A ++GS            E   AQ LL+NAV+DVA AL D  + TK N +     +    +LK S + MV +V  L+K+VK++ED   RGTRALE+++EA+ +E +       D  D    K                        S E+L+  TKP+  A+ KA+AA  + KQEDI+ A+N+GRKAI DL+H+ +                                   +++ ++        A K L++        VA  K ++  +  +++ SR++A+++ E+ +SA  +K     D +DP     IAENELL AA+ IE AAKK+A LKPR++ ++   E   F+ QI+ A   I +AT+ LVK AS +Q+ELV+QG++  + +    +E  QWS GLISAA++VAAAT +L +SA A+VQG    ++LI+++KQVA  TA LL+AC+VK+D  S   QRLQAAG+AVKRATEALV+ A + +D V D S+  T D   K +V  +   I AQ +++ KE+EL   R K   +R+      P+ +
Sbjct:    5 SLKISVVQSNAVKTMQFEPSTIVYDACRMIRERIAEAQQGNPSEFGLFLADEDPKKGVWLEQGRSLEYYLLRNGDL-LEYRKKHRILKVRTLDGALKTLQVDDSHTVGGLMVTICTRMGITNHEEYSLVRELAEDEKEKTLTLKRDKSIAKDQKKLEEMKKKLHTDDDMNWLDHSKTLREQGIDQNEVLLLRRKFFFSDQNVDARDPIQLNLLYVQSRDAILNGTHPVSLEEAIMFGGIQCQVQFGDHVDSKHKSGFLDLKEFLPKEYLKVKGAEKKIFQEHKKHVGLTEIEAKVKYTHQCRSLKTYGITFFLVKEKLKGKNKLVPRLLGITKESVVRVDEKTKEIMKTWPLTTVRRWAASPNSFTLDFGDYSDTYYSVQTTEGEQISQLIAGYIDIILGKKKAKDHLGIDGDDNSMMLEDNVAPAKATIIQHNTSKVSHASSGNVAIPAVIRDGGQGESQYGV---GSMQSTQYTQVSNQAISGHSAAH---------RLSKAQKALLITIEEGLSSVNAAQSQLEHQADLPTLGSDPASKKWREDALDVSRQKVGSQLSAMNAATAQLVTLTSGNQ---DEIDYTAVGSAVNQISSNLNEFSGDVRMLAAL-----QED-NGNKLMNAARRLAGAFSDLLQAAQP---------------GSKEPRLN--LLAAAGKIGEASQDVMDNVG---ETTEDMDKAYQDTLLALAKAVANATAALV--LKAKTVANK-TEDPGLQNKVISSATQCALATSQLVACTKVVAPTIGHPACQEQLIEAAKLVAKSVEGIVEAAQGACRDDYVL-QDLGGAATQVTKALNDLLQHIKKAAGPTKATEVHEEA-VDQIITTTDKLFSSVGDAHEMVKNARLLAQATSQLVTAIRG------------QAESHPDSDVQKRLLAAAKQLADATANLVEAAKGCASSPNDS--NQQMMLRSAAEELRSATNTAASNALKKKLVKRLENAARQAVSASTQLINSSKQANKTNR--NAASQQQLAAQCQVVDEEIPNLVQSIKGAQRHYDSASAQLGLINSSQEFIQPCSRLMAQANSAAPTVTDQSSVLTLNNNIKAMATALAELRTSAAKAAEACHSLEVDSALD----QLHALDKELDDVQRSAESGNLLPLPGETAESAALQLGATSKTVASSMSQLLTAAAQGNE-------DYVGIAS------RDTANALKVLTSAVRGVAATTNDQQIQRNIIGSAHDVMDKSIRLLEEAKSALENPN-SPENSQRLTQVAKSVATA---LSNCINCLPGQRDVDNAIQQITASSQML------ANPSFPGTNKT--YPEVQTDMNNSAVNLNQAASDIVTA--SRGATSQLATSSNRYSECYQQFVHNGLTMAGLTKDYET---QNQIVGGLKSVSMVSS-----KLLLAAKSVSADPNAPNAKNLLAQAARAVTESINHLINICTVSAP-GQKECDNALRQIQMMRNVL--DNPNEPVSDQTYFDCLESVMERSKALGDAMTGISNHAKRNDIDDFCDSVRNFANSVCGLTEASAQAAYLVGIADPASEPGRPGIVDQSQFSRANQAIQMACQNLTNPASSQQQVLSA---ATVVAKHTSALCNACRVASSKTSNPVAKRHFVQSAKDVANSTANLVKAIKALDQDFTDQNRQKCAEAARPLVEAVEELTTFASSPEFASKPAK-ISPKARQAQEPITHAGKGMIDGASSMLQAAKQLAVNPKDPPTYQMYSHHSKSVSDSIKQLVSSIKESAPGQRECDDGIEKINQVIRQLDQASLAAISQN----LAPQNEKSLKAFQEQLINSAREILEKIDFVRN--AAKREPENLGHLSTTIASYFEPLAYSAIGTASRNLNSKQQMNILDLTKTVAESALQFLYASKEGGGNQKATHAHQPIDNAADDMKDVLIDLLQTMEEAASQTGVVSSMIDSISKSIAKIDE--RVAVGEKAS-----------FVDYQTE--------MVRLAKQIA----RSAQDMTGKSTTDVSELGHLANQMTRDYSQLVSNSRGAVSS-TTNV-DVSHRIQSTVQDLGKSLIEIVQDAGNLQMNPSDTYAQKDLSDHARSISEKVSFILAALQAGSRGTQACINASSTVSGIIGDLDTTIMF-----ATAGTLNPEGDE----SFADHRESILKTAKALVEDTKTLVAGAASNQEQLASAAQQAVKTITRLADVVKFGAGSLGS------------EQPEAQVLLINAVKDVASALSDLISATK-NASGKDAHDPAMHHLKDSAKVMVTNVTSLLKTVKTVEDEAVRGTRALESTVEAINQEIKAY-----DTTDTFGKKA-----------------------SAEDLIRYTKPITAATAKAVAAANSMKQEDIIAASNMGRKAIMDLLHNCKAAAATA-------------------------ETAEIRQRAINAGRMCGTAYKELLEYVH-----VALAKPSQESRQNLSMVSRKVANAVTELIQSAEAIKGQEWVDPDDPT---VIAENELLGAANSIEAAAKKLASLKPRQAARQ-ADENLNFEEQILDAAKCIAAATAALVKSASAAQRELVAQGKVGSTFHRHTLDEDGQWSQGLISAAKMVAAATHSLCESANAMVQGHATEEKLIASAKQVAGSTAQLLMACKVKADPGSVAMQRLQAAGNAVKRATEALVRSAQQAQDYVDDTSV--TVD---KRLVGGIARDIMAQEEVLRKEKELADARKKLALVRRERYKDRPDEY 2537          
BLAST of Talin vs. TrEMBL
Match: A0A1S3HJY6 (talin-1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106155859 PE=4 SV=1)

HSP 1 Score: 1113.21 bits (2878), Expect = 0.000e+0
Identity = 876/2762 (31.72%), Postives = 1451/2762 (52.53%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRV----GS-AQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAM---LIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHL---IINSITAHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRV-ANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLN-NYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLI-NSNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPNN--QQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXX--XXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKN------CISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVEN-DEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQ-LKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQD----LMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAA----RLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIK-ANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTG-----EEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISE--QNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            +L++ IV +N   +++ +  T++YD CR + +RI +       ++GLF++D D  +  WL+  + + YY L + +L L +K + R L +R +D T KTL+VDDS ++ +L++ IC ++G++NH+E+SL+ +L E E+ KT+TL+RG++  RD  KL+++K+KL TDDELNWL H K+LR+ G++E + LLLRRK+FFSDQNVDARDP+QLNLLYVQ ++ I++GTHPV  EEA+Q  GIQCQ + G+    K KS    LKEFLPKEY+K KGI+KKI A++ KL G S+ D KV Y  LCRSLKTYGITFFLVKEK++ KNKLVPRL+GI+K+ V+RVDEKTKE+++ WPLTTVRR+AA+ + F+LDFGDYSD  Y +QTTEGE+I+QLI GYIDII+KK+KAKD+L  + +EE+ M+EE+V+P+KA +I H           K   A  G++     +    QG+     GS  QP   +  ++  QG+     Q  Q++ +S  +R L   +   +  ++     + +  E+  LG D +S+ +++  LD++K  +   L +M  AT  ++ M        D+ DY  + +A++TI  N  +  +++R    M     E D  G NL++AA+ L  AF DLL A++P + E                   + L+ A +++GEAS     ++    +   +++   +D LL  AK +AN  + +V  +K   VA K     + QA+   +I +A     ATS L++  KVVA ++  P  Q+QL  +A+ V  SV+ +++  Q   +   ++ Q+L      + ++++ L QH+           Q+  V   L A++RL +++G++ EMV QA++LA+A ++L + +              Q+    + D Q+RL+ AA+ L DA  ++V A K C      +   QQ L  AA  + S  +  A   ++++L K LE A +Q A  A QL+ +SQ A K+ R  AS  Q+ +  +   + + P+++        +P  P AQ NL+NA + +IQ   +L+ S++A  P V D +   +L  + +N   +LA+L+    +A        +   +A+I D     L   ++   ++   G+L PLPGET+ES +  +G +SK       +L       N NY         G+      +AK+   ++  L    RG+AA        +N+ +   DV+D   ++I   +  +        +      L +    +   ++  V  +P  +++D  + ++ S  +             +  +  KS S++Q+E + A    NQ   D++  +  T   L   +   ++S+  ++  G+           Q Q+ SGLKSVS  S+       LL A S S+D N         +AA  V+DSIN L+  C ++ P  Q+ C+++ RQ++ +   L  + P+ P+++ SY  C+ SV E S++L   M  I    K G   +FC +++  + S   + ++  QA Y +G+         S   + P    L+  +     N      C ++   ++++      AT +    S++C + +   + +++P  +   + + K VA +T NL+K I +     S +N      A + ++  VE+LT  A     T+   K I+ + R+AQ  I  +   M++G+C +++AA  L    K  P    +  + K+    +  L   +K SAPGQ+E  +  E++   +++LD+A +   S +  ++     ND+     Q+  +S  Q + + I P+    + + + E LG  V    SYL P+++++   A  + +S+ +  V++ TKTV E+ L ++   +  +    + D    + +   ++K    DL++ ++  ++  G +  M+ ++ K+ A    R+    N++ +D  +    + + I  I   +   S N    +  L  + + +  + A+E     S +  A++ +  K+ V D   L   ++Q   +G      G+   K+          DL+ + +      V  +++ ++  LQ+ +RGTQ CI AA++V+ ++ DLDT I+F          +N + D  +    A  +E I K  K+LV D + +V      QE LA A  +AVR   +L   VK  A ++GS            E   AQ LL+NAV+DVA AL D  +CTK N      ++   SNLK S +TMV +V  L+K+VK++ED   RGTRALE+++E + +E R  E+                            +  SD   + E+L+  TK +  A+ KA+AA  + +QEDI++AAN+GRKA+ D++      +  K   + ++   I             RT+ S ++ +    E        L+D+       +A  K    +K  +  AS+++A+++ EI +SA  +K T   D +DP     IAENELL AA+ IE AAKK+A LKPR+  K+  G     E   F+ QI+ A  SI +AT+ LVK A  +Q+ELV QG++  +   S     + QWS GLISAA++VAAAT NL ++A ++VQG    ++LIS++KQVA+ TA LL+AC+VK+D DS + QRLQ AG+AVKRATEALV+ A + +++ +     T    NK MV  M  +I AQ +I+ KE+ELE  R++   IR+     +P
Sbjct:    5 SLKVSIVGSNIVKTMQFEPSTIIYDACRMIRERIQEANQGNPADYGLFLADEDPKKGVWLEQGRTLEYYLLRNGDL-LEYKKKQRILRVRMLDGTVKTLQVDDSHTLGQLMVTICTRIGVTNHDEFSLVRDLSEEEKEKTLTLRRGQSLARDQKKLDELKKKLHTDDELNWLDHSKSLREEGVEENETLLLRRKFFFSDQNVDARDPVQLNLLYVQSRDGILNGTHPVTQEEAVQFGGIQCQIQFGDHNEQKHKSGFLELKEFLPKEYMKIKGIEKKIFAEHRKLIGSSEIDAKVRYCSLCRSLKTYGITFFLVKEKMKGKNKLVPRLLGITKDSVVRVDEKTKEILKTWPLTTVRRWAASPNSFTLDFGDYSDSYYSVQTTEGEQISQLIAGYIDIILKKKKAKDHLGIEGDEESTMLEESVSPAKATIIQHQ--------SSKTGQAVTGNVAMPAVLRAGGQGQAQFSHGSMQQPQYGKIQNQFHQGHAPPAGQNAQMQGMSHAQRGLWSSMNSAITDIETVEGSMHQRAELPPLGPDHASKKWKENALDVSKHHIGSQLSAMNAATAQVVTMT---SGGPDDTDYTAVGSAVSTITANMTEFAKDVR----MLAALQESDEVGDNLLDAARRLAGAFSDLLKAAQPGSSE-----------------PRQNLLTAASKIGEASN---EVMKTAGDGTDEVDKAFQDALLALAKAVANATAALV--LKAKGVASK----CDDQALQNRVISSATQCALATSQLVACTKVVAPTVSNPACQEQLVEAAKLVAKSVEGIVETAQTACKDDRLL-QELGAAATAVTKALNDLLQHIKQGSGGGQGGQQEVAVEAILGATDRLFSSMGDAPEMVRQARVLAQATSQLVNAIKG------------QAEGHSEPDMQKRLLAAAKVLADATARMVEAAKGCASNPNDS-SQQQHLKAAAEDLRSATNKAASNALKKKLIKTLEVAAKQAASAATQLINASQAAEKSNRNPASQNQLNASCKSTADEI-PKLVQGIRGTLHSPDSPTAQLNLINASEDMIQVSSRLVNSAKAATPTVSDQATALSLTNATKNMSAALAELRTAAAKAQEACGTLEIDGALAHIND-----LERELEEIEQTCQAGKLLPLPGETMESSALQLGHTSKTVGSSMAQLLTAAAQGNENY--------TGI------AAKDTANALGVLTNAVRGVAACSDDRKVQQNIIDAARDVMDKSARLIEEAKRAVSSPNSPDNQ----QRLAQVAKAVSHALNNCVNCLPGQRDVDAAIKEISSMSQTISSG--------QFPHTDKSFSEVQNEMSAAANNLNQATTDVVAAAQGTPQQLASASNSYSKSYSELVNEGMTFAGMTKEREVQSQIVSGLKSVSMVSS-----KLLLAAKSLSADPNAPNARNLLSQAARAVTDSINQLIDICTTSAP-GQKECDNALRQIQVMHNVL--DNPTEPVSDASYFDCVDSVMEKSKALGDSMLGITDHAKRGALEEFCGSVKQFAGSVCGLTEAAAQAAYLVGI---------SDRASEPGKPGLVDQSQFSRANQAIQMACETLTDPSSTQQQVLSAATVVAKHTSALCNICRVASSKTTNPVAKRHFVQSAKDVANSTANLVKAIKALDSDFSEQNRKRCADAAKPLIGAVEELTTFASSPEFTSVPAK-ISREARKAQEPIISSGKAMIDGACHMVKAAKQLAAHPKDPPTYLLYSNHSKSVSDAIKSLVAAMKESAPGQKECDDAIEKVTSTIKDLDQAALAAISNSLPAR-----NDNNQQGFQQQMISCAQEIADRIDPVRT--AGKGEAEKLGHLVTNMASYLDPLADAAVGTASKIMNSKRQMAVLDQTKTVAESALQLIYVAKEGAGNPKSNDAHTAIDDAADNMKEVMADLLQTMEEASATAGVVTAMVDNLGKAIAKTDDRIVVHENLSFVDYQTNMVRLAKKIAQIAQDMVGKSSNNPEELGGLGNQLTREYGELASESQGATSCSSTAEIGHQIKRTVQDLGRLCIELVQ--DAGHLQSSPGDSFAKR----------DLVEHARA-----VSEKVSHVLAALQAGARGTQACINAAHTVSGIIGDLDTTIMF-----ATAGTLNPDADTEQ---FADHREAILKTAKALVEDTKTLVAGAAANQEQLAGAAQSAVRTITRLTDVVKFGAASLGS------------EQPEAQVLLINAVKDVASALADLISCTK-NAAGKPVQDPSMSNLKDSAKTMVTNVTSLLKTVKTVEDEAARGTRALESTIEGIAQEIRAYES----------------------------SDKSDLKATPEDLIRHTKAISNATAKAVAAGNSGRQEDIIVAANMGRKAVFDIL------VVCKAAAQSAETEEI-----------KHRTLRSGRDCAHNFRE--------LLDLVH-----LAIQKPTYENKQSLGQASKKVANAVTEIVQSAEAIKGTEWVDPDDPT---VIAENELLTAANSIEAAAKKLAALKPRQPAKRADGSQEADESLNFEEQILEAARSIAAATAALVKAAGTAQKELVLQGKVTAAYRASSFLDEDGQWSQGLISAAKMVAAATHNLCEAANSMVQGNASEEKLISSAKQVASSTAQLLVACKVKADTDSVSMQRLQGAGNAVKRATEALVRAAQQAKELSEEEQSLTI---NKRMVGGMAQIIMAQEEIIRKEKELEAARSRLAMIRKEKYKDNP 2551          
BLAST of Talin vs. TrEMBL
Match: A0A1S3HMQ0 (talin-1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106155859 PE=4 SV=1)

HSP 1 Score: 1112.06 bits (2875), Expect = 0.000e+0
Identity = 875/2757 (31.74%), Postives = 1450/2757 (52.59%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRV----GS-AQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAM---LIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHL---IINSITAHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRV-ANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLN-NYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLI-NSNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPNN--QQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXX--XXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKN------CISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVEN-DEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQ-LKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQD----LMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAA----RLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIK-ANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISE--QNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            +L++ IV +N   +++ +  T++YD CR + +RI +       ++GLF++D D  +  WL+  + + YY L + +L L +K + R L +R +D T KTL+VDDS ++ +L++ IC ++G++NH+E+SL+ +L E E+ KT+TL+RG++  RD  KL+++K+KL TDDELNWL H K+LR+ G++E + LLLRRK+FFSDQNVDARDP+QLNLLYVQ ++ I++GTHPV  EEA+Q  GIQCQ + G+    K KS    LKEFLPKEY+K KGI+KKI A++ KL G S+ D KV Y  LCRSLKTYGITFFLVKEK++ KNKLVPRL+GI+K+ V+RVDEKTKE+++ WPLTTVRR+AA+ + F+LDFGDYSD  Y +QTTEGE+I+QLI GYIDII+KK+KAKD+L  + +EE+ M+EE+V+P+KA +I H           K   A  G++     +    QG+     GS  QP   +  ++  QG+     Q  Q++ +S  +R L   +   +  ++     + +  E+  LG D +S+ +++  LD++K  +   L +M  AT  ++ M        D+ DY  + +A++TI  N  +  +++R    M     E D  G NL++AA+ L  AF DLL A++P + E                   + L+ A +++GEAS     ++    +   +++   +D LL  AK +AN  + +V  +K   VA K     + QA+   +I +A     ATS L++  KVVA ++  P  Q+QL  +A+ V  SV+ +++  Q   +   ++ Q+L      + ++++ L QH+           Q+  V   L A++RL +++G++ EMV QA++LA+A ++L + +              Q+    + D Q+RL+ AA+ L DA  ++V A K C      +   QQ L  AA  + S  +  A   ++++L K LE A +Q A  A QL+ +SQ A K+ R  AS  Q+ +  +   + + P+++        +P  P AQ NL+NA + +IQ   +L+ S++A  P V D +   +L  + +N   +LA+L+    +A        +   +A+I D     L   ++   ++   G+L PLPGET+ES +  +G +SK       +L       N NY         G+      +AK+   ++  L    RG+AA        +N+ +   DV+D   ++I   +  +        +      L +    +   ++  V  +P  +++D  + ++ S  +             +  +  KS S++Q+E + A    NQ   D++  +  T   L   +   ++S+  ++  G+           Q Q+ SGLKSVS  S+       LL A S S+D N         +AA  V+DSIN L+  C ++ P  Q+ C+++ RQ++ +   L  + P+ P+++ SY  C+ SV E S++L   M  I    K G   +FC +++  + S   + ++  QA Y +G+         S   + P    L+  +     N      C ++   ++++      AT +    S++C + +   + +++P  +   + + K VA +T NL+K I +     S +N      A + ++  VE+LT  A     T+   K I+ + R+AQ  I  +   M++G+C +++AA  L    K  P    +  + K+    +  L   +K SAPGQ+E  +  E++   +++LD+A +   S +  ++     ND+     Q+  +S  Q + + I P+    + + + E LG  V    SYL P+++++   A  + +S+ +  V++ TKTV E+ L ++   +  +    + D    + +   ++K    DL++ ++  ++  G +  M+ ++ K+ A    R+    N++ +D  +    + + I  I   +   S N    +  L  + + +  + A+E     S +  A++ +  K+ V D   L   ++Q   +G      G+   K+          DL+ + +      V  +++ ++  LQ+ +RGTQ CI AA++V+ ++ DLDT I+F          +N + D  +    A  +E I K  K+LV D + +V      QE LA A  +AVR   +L   VK  A ++GS            E   AQ LL+NAV+DVA AL D  +CTK N      ++   SNLK S +TMV +V  L+K+VK++ED   RGTRALE+++E + +E R  E+                            +  SD   + E+L+  TK +  A+ KA+AA  + +QEDI++AAN+GRKA+ D++      +  K   + ++   I             RT+ S ++ +    E        L+D+       +A  K    +K  +  AS+++A+++ EI +SA  +K T   D +DP     IAENELL AA+ IE AAKK+A LKPR+   K+  E   F+ QI+ A  SI +AT+ LVK A  +Q+ELV QG++  +   S     + QWS GLISAA++VAAAT NL ++A ++VQG    ++LIS++KQVA+ TA LL+AC+VK+D DS + QRLQ AG+AVKRATEALV+ A + +++ +     T    NK MV  M  +I AQ +I+ KE+ELE  R++   IR+     +P
Sbjct:    5 SLKVSIVGSNIVKTMQFEPSTIIYDACRMIRERIQEANQGNPADYGLFLADEDPKKGVWLEQGRTLEYYLLRNGDL-LEYKKKQRILRVRMLDGTVKTLQVDDSHTLGQLMVTICTRIGVTNHDEFSLVRDLSEEEKEKTLTLRRGQSLARDQKKLDELKKKLHTDDELNWLDHSKSLREEGVEENETLLLRRKFFFSDQNVDARDPVQLNLLYVQSRDGILNGTHPVTQEEAVQFGGIQCQIQFGDHNEQKHKSGFLELKEFLPKEYMKIKGIEKKIFAEHRKLIGSSEIDAKVRYCSLCRSLKTYGITFFLVKEKMKGKNKLVPRLLGITKDSVVRVDEKTKEILKTWPLTTVRRWAASPNSFTLDFGDYSDSYYSVQTTEGEQISQLIAGYIDIILKKKKAKDHLGIEGDEESTMLEESVSPAKATIIQHQ--------SSKTGQAVTGNVAMPAVLRAGGQGQAQFSHGSMQQPQYGKIQNQFHQGHAPPAGQNAQMQGMSHAQRGLWSSMNSAITDIETVEGSMHQRAELPPLGPDHASKKWKENALDVSKHHIGSQLSAMNAATAQVVTMT---SGGPDDTDYTAVGSAVSTITANMTEFAKDVR----MLAALQESDEVGDNLLDAARRLAGAFSDLLKAAQPGSSE-----------------PRQNLLTAASKIGEASN---EVMKTAGDGTDEVDKAFQDALLALAKAVANATAALV--LKAKGVASK----CDDQALQNRVISSATQCALATSQLVACTKVVAPTVSNPACQEQLVEAAKLVAKSVEGIVETAQTACKDDRLL-QELGAAATAVTKALNDLLQHIKQGSGGGQGGQQEVAVEAILGATDRLFSSMGDAPEMVRQARVLAQATSQLVNAIKG------------QAEGHSEPDMQKRLLAAAKVLADATARMVEAAKGCASNPNDS-SQQQHLKAAAEDLRSATNKAASNALKKKLIKTLEVAAKQAASAATQLINASQAAEKSNRNPASQNQLNASCKSTADEI-PKLVQGIRGTLHSPDSPTAQLNLINASEDMIQVSSRLVNSAKAATPTVSDQATALSLTNATKNMSAALAELRTAAAKAQEACGTLEIDGALAHIND-----LERELEEIEQTCQAGKLLPLPGETMESSALQLGHTSKTVGSSMAQLLTAAAQGNENY--------TGI------AAKDTANALGVLTNAVRGVAACSDDRKVQQNIIDAARDVMDKSARLIEEAKRAVSSPNSPDNQ----QRLAQVAKAVSHALNNCVNCLPGQRDVDAAIKEISSMSQTISSG--------QFPHTDKSFSEVQNEMSAAANNLNQATTDVVAAAQGTPQQLASASNSYSKSYSELVNEGMTFAGMTKEREVQSQIVSGLKSVSMVSS-----KLLLAAKSLSADPNAPNARNLLSQAARAVTDSINQLIDICTTSAP-GQKECDNALRQIQVMHNVL--DNPTEPVSDASYFDCVDSVMEKSKALGDSMLGITDHAKRGALEEFCGSVKQFAGSVCGLTEAAAQAAYLVGI---------SDRASEPGKPGLVDQSQFSRANQAIQMACETLTDPSSTQQQVLSAATVVAKHTSALCNICRVASSKTTNPVAKRHFVQSAKDVANSTANLVKAIKALDSDFSEQNRKRCADAAKPLIGAVEELTTFASSPEFTSVPAK-ISREARKAQEPIISSGKAMIDGACHMVKAAKQLAAHPKDPPTYLLYSNHSKSVSDAIKSLVAAMKESAPGQKECDDAIEKVTSTIKDLDQAALAAISNSLPAR-----NDNNQQGFQQQMISCAQEIADRIDPVRT--AGKGEAEKLGHLVTNMASYLDPLADAAVGTASKIMNSKRQMAVLDQTKTVAESALQLIYVAKEGAGNPKSNDAHTAIDDAADNMKEVMADLLQTMEEASATAGVVTAMVDNLGKAIAKTDDRIVVHENLSFVDYQTNMVRLAKKIAQIAQDMVGKSSNNPEELGGLGNQLTREYGELASESQGATSCSSTAEIGHQIKRTVQDLGRLCIELVQ--DAGHLQSSPGDSFAKR----------DLVEHARA-----VSEKVSHVLAALQAGARGTQACINAAHTVSGIIGDLDTTIMF-----ATAGTLNPDADTEQ---FADHREAILKTAKALVEDTKTLVAGAAANQEQLAGAAQSAVRTITRLTDVVKFGAASLGS------------EQPEAQVLLINAVKDVASALADLISCTK-NAAGKPVQDPSMSNLKDSAKTMVTNVTSLLKTVKTVEDEAARGTRALESTIEGIAQEIRAYES----------------------------SDKSDLKATPEDLIRHTKAISNATAKAVAAGNSGRQEDIIVAANMGRKAVFDIL------VVCKAAAQSAETEEI-----------KHRTLRSGRDCAHNFRE--------LLDLVH-----LAIQKPTYENKQSLGQASKKVANAVTEIVQSAEAIKGTEWVDPDDPT---VIAENELLTAANSIEAAAKKLAALKPRQP-AKEADESLNFEEQILEAARSIAAATAALVKAAGTAQKELVLQGKVTAAYRASSFLDEDGQWSQGLISAAKMVAAATHNLCEAANSMVQGNASEEKLISSAKQVASSTAQLLVACKVKADTDSVSMQRLQGAGNAVKRATEALVRAAQQAKELSEEEQSLTI---NKRMVGGMAQIIMAQEEIIRKEKELEAARSRLAMIRKEKYKDNP 2545          
BLAST of Talin vs. TrEMBL
Match: A0A224Z8Y2 (Talin OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 1108.21 bits (2865), Expect = 0.000e+0
Identity = 882/2793 (31.58%), Postives = 1452/2793 (51.99%), Query Frame = 3
Query:   63 IEMHTLRILIVPTNKTI-SLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRA-YWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYEL-DENER--MKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIG--HLPNRGDIGVVSQGRVGSAQPI-----AIRNDSKIGQG----NVNVQPQKFQIRDL-SQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINS-------ITAHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQICSEAQEMTEI-----VLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIE-----DGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAA----LKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLIAEVPNNQ--QQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHA---SVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDE-WTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV----QECETLSTTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNS-LNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLV-------HDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGS-NPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDR---SNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMK-LKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIR 8204
            + M +L+I  VP NK I +++ +  T+VYD CR +  ++P       +E+GLF++D D  ++  WL+N K + YY L  GD    L ++ ++R L +R +D + KT+ VDDS+ IA L++ IC K+GI+NH+E+SL+ +L DEN+     T+TL+R K +     K+E++K+KLKTDD+LNW+ H KTLR+LG+DE + L LRRKYFFSD NVD+RDP+QLNLLYVQ ++AI++ THPV +EEA + AG+QCQ + G+    K K+   +LKEFLPK+Y K KGI+KKI A++ K  G S+ D KV Y  L RSLKTYG+TFFLVKEK++ KNKLVPRL+G++K+ VMR+DE+TKE+++ WPLTTVRR+AA+ + F+LDFGDYS+  Y +QTTEGE+I+QLI GYIDII+KK+KAKD+L  D +E + M+E++V+P+KA ++ H           K S   +G   LP     GVV  G  G   P+     A +   + GQ     +     Q+  +R+L S+P+RAL+  +G     ++A+ ++L+      +LG+D +S  +R+  LD  +  V   + +M  AT  ++ +     +  D    G   AAI TI  N  ++ ++++ +  +    D+ED +G  L++AA+ L NAF DLL A++P N E                   + L+ A +RVGEAS  +L+ I  E    +D+E Q  D LL  AKQ+AN  + +V   K  +    + QG   Q  +I AA     ATS L++ AK+VA +I  P  Q+QL  ++++V  SVD ++   +       ++   L    A +  ++++L   L+I          T  QD  +   L A++RL +  G++ EMV QA++LA A  +L   +   A  +             DSD+Q+RL+ AA+ L DA  +++ A K C      + ENQ  L +AA  +    ++ A   +++++   LE A R  +  A Q + ++Q A       N  I  + + M+       V+P V+         P  P A + LL +CQ+LI    Q++ +S+   P + +P+    L+ S +   ++L+DL+  + +A       +    + +E     D +L  +H        +    +L PLPGE  E  +  +G++SK       +L       N   +               +A++   ++++L+   RG+ A     K   +    + E+   +++  +Q +   ++  +  +LA +         KS+      ++  +  +P  +++D ++  +  S +  +          E  N  +S+S++Q+    A A  N+  G ++ S+  ++A L    +    +   +L  G+++ ++  + +   Q+   LK+VS  S+ LL   K + A   + +       L  AA  V++SIN L++ C S  P  Q+ C+S+ R ++ ++  L  + P+ P+N+ +Y  C+ +V E S+SL   M  I    K G+   F  +++ +S +   ++++  QA Y +G   S      SS    P L  L   A     +   C  +++  +S+      AT I    SS+C   +   + +++P  +   + + K VA AT +L+K I    +  S  N +   +A   +++ V+ LT  A          K I+ + R AQ  I  A   +++GSC+++ +A +LV + K  PA Q+   + K     + RL + +K  APGQ+E  E  ++L   +R LDRA+++  S   + + +   +  + +  ++M+ S  ++ + I P+    + + + E LG  V +A  YL P+ ++    A    HS+ +  +++ TKTV E  L +V    Q          + D+ E   + +    +L++ ++  A+  G +  ++ S+ K+  RL E + +              +I G+  + + +S +  ++S    Q    T+ +++ ++   ++Q+ +   ++   +L        H Y SL       M++       G  +++  V  +G++C+ L +            Y Q+E     RS   +++ +M  LQ+ SRGTQ CI AA++V+ ++ DLDT I+F          ++SE + ++       +E+I K  K+LV D + +V      QE LA+A  NAV    QL  AVK  A ++G+ NP              AQ LL+NAV+DVA AL D    TK    A + K  D    ++LK S + MV +V  L+K+V+++ED   RGTRALE+++EA+ +E R  ++  P          Q G                      E+LV  T+P+ LA+ KA+AA  + +Q DI++AAN+GRKAI DL   + VT     L E +   SR+ S               S +E +++  E        L  + E + K  AEGK+       +   SR IA ++ EI  +A  LK T   D  DPN    IAE ELL AAS IE AA+K+A L+PR+SI K+  E   FD  I+ A  SI +ATS LV+ AS +Q+ELV+ G+L      S  +  QWS GL+SAARLVAAAT +L +SA  +VQG+   ++LIS++KQVA+ TA LL+AC+VK++ DS + + LQAAG+AVK+AT+ LV+ A +    Q+          N+ MV  +   I A+ +I+ KERELE    + + +R
Sbjct:   10 MAMLSLKI-SVPDNKVIKTIQFEPGTLVYDACRVIRDKVPDSALGDAKEYGLFLTDDDPKKSGCWLENGKALGYYLLKSGD---TLEYRKKLRPLRVRMLDGSVKTVLVDDSQPIANLMVVICTKIGITNHDEFSLVRDLPDENKEPNTGTLTLRREKKEKDRDQKMEQLKKKLKTDDDLNWVDHSKTLRELGVDEDEMLTLRRKYFFSDSNVDSRDPVQLNLLYVQARDAILNTTHPVTLEEACKFAGLQCQIQFGDHNETKHKAGFLDLKEFLPKDYAKIKGIEKKIFAEHRKNIGTSELDAKVKYVALARSLKTYGVTFFLVKEKMKGKNKLVPRLLGVTKDSVMRLDERTKEIMKVWPLTTVRRWAASPNSFTLDFGDYSESYYSVQTTEGEQISQLIAGYIDIILKKKKAKDHLGIDGDEGSTMVEDSVSPAKATILQHT-------PAAKPSQPAVGLVALP-----GVVRPGTKGPQVPVKGHMPAPQQQMETGQAISAHSATTPAQQPHVRELQSEPQRALLGSLGAGRDAVQASLQELEVPQARPQLGSDPASLQWRQSHLDTHRQNVSSQIAAMNAATAQVVTLTAAPPEEMDQPAVG---AAITTIASNLPEMSKDVKMIAAL---MDDED-SGEKLLDAARRLCNAFSDLLRAAEPQNKE-----------------PRQNLLNAASRVGEASHAVLYTIGEEDE--ADMELQ--DQLLAAAKQVANATAALVLQAKNVASTCDD-QGQ--QNRVIGAATQGALATSQLVACAKIVAPTITSPSCQEQLTEASKEVGKSVDAIVASCEEATRQEPLL-SDLRAAAAQVSRALEELL--LLIRGAPERRARATLAQDGALDTILDATDRLFSCTGDAPEMVRQAKVLARATAQLIQAIKGEAQAEP------------DSDQQKRLLAAAKVLADATARMIEAAKGCASNPHDS-ENQAALRKAAEELRHATNVAASNALKRKIIVRLENAARHASSAATQNIAAAQNAGPY----NSNIMLQEELMSSCRDVAGVIPRVVQGIKGTVAEPDSPMAHHKLLTSCQELIPPAGQMVSASKGCVPTIVEPACAVQLSNSTKQMSSALSDLRSALDKAQETCGRQQQEIDSALERIRELDQELVDIH-------RAALANQLRPLPGENSELCALKLGATSKVVGSSMAQLLTAASQGNESYTGT-------------AARDTASALQQLVEAVRGVVASSGEAKRLVEPARQVLERSCQLLEEARQAVLRPDEPDKQQRLAHV--------AKSVSAA---LNACINCLPGQKDVDDVIRTITESSQALNAR--------EFPNSNRSYSELQANLNEAAAELNEATGHMVQSSRGNAAQLASSVRHFGTAFGSLLGCGMEMASQTQDQEVRSQMVVSLKNVSMVSSKLLVAAKSVAADPSAPNAK---NQLAVAARNVTESINHLVNVCTSAAP-GQKECDSAVRAIQMMRPML--DQPNEPVNDLTYYDCLDTVLERSQSLGDAMTGIANHAKHGEHEQFSESVREVSTTICTLVEASAQAAYLVGASDS------SSMAGKPGLVDLSHFARASQAIQMACQQLSNPASSQPQILSAATVIAKHTSSLCNACRVASSKTTNPVAKRHFVQSAKDVASATASLVKEIKVLDQEPSDANRQRCGEATRPLIDAVDSLTTFASSPEFAGVPAK-ISHKARVAQEPILAAGRSIIDGSCNMILSAKSLVLNPKDPPAWQSLGAHSKEVSDGIKRLVSSIKDEAPGQKECDEAIDKLNAAIRELDRASLNILSQESTHQAD---SSLLKTYQEQMESSASEILDIIEPLR--YAAKGEAEKLGHTVNQAVGYLGPLVQNVIAGASHTLHSKRQMALLDQTKTVAEGMLQLVYASKQAAGNPKAVHVHGDVDEAADNTRDALQELLRTLESAATEAGVVTGLVDSVSKAMYRLEERSTI--------------TISGLRSSGSYSSAVEPELSYVDYQ----TRMVRSAKEVARVAQDMVTHASHDPSRLTPLAADLSHHYASLAGDARGAMATSTSVEVPG--RIRAGVQDLGKACISLTKSAGACQSSPGDIYTQRELAENARSVSEKVSHIMAALQAGSRGTQACINAASTVSGIIGDLDTTIMF-----ATAGTLHSEKEGDQ---FVDHRENILKTAKALVEDTKTLVAGAASSQEQLAVAAQNAVSTIVQLAEAVKLGAASLGAHNP-------------EAQVLLVNAVKDVAAALGDLVQATK----AASGKGIDHPAMAHLKDSAKVMVTNVTSLLKTVRAVEDEHARGTRALESTVEAISQEVRAFDSSEPPLR-------QAGP---------------------EDLVRATQPVTLATAKAVAAGNSGQQGDIIVAANMGRKAIFDL---LSVTKSASCLAETQELKSRVLS---------------SGRECAIRYRE-------LLQLVLEVVQKPTAEGKQ------ALVSTSRNIAVAVTEIVAAAEALKGT---DWADPNDPTVIAETELLGAASSIEAAARKLANLQPRRSI-KEADESLNFDEMILEAAKSITAATSALVRAASAAQRELVAAGKLGERLPCSSAD-GQWSEGLVSAARLVAAATHSLVESANWLVQGQASEEKLISSAKQVASSTAQLLVACKVKAEPDSSSMRGLQAAGNAVKQATDHLVR-AAQRSIAQEQEFRLVI---NQRMVGGIAQEIGAREEILRKERELEEAHERLRQLR 2565          
BLAST of Talin vs. TrEMBL
Match: A0A131YM95 (Talin OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 1107.82 bits (2864), Expect = 0.000e+0
Identity = 883/2794 (31.60%), Postives = 1453/2794 (52.00%), Query Frame = 3
Query:   63 IEMHTLRILIVPTNKTI-SLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRA-YWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYEL-DENER--MKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIG--HLPNRGDIGVVSQGRVGSAQPI-----AIRNDSKIGQG----NVNVQPQKFQIRDL-SQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETH-SVIYQQLDETVAMICESIDKLKQHLIINS-------ITAHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQICSEAQEMTEI-----VLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIE-----DGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAA----LKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSA-LTLLAKQLNESHDCMLMTGLQLIAEVPNNQ--QQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHA---SVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDE-WTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV----QECETLSTTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNS-LNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLV-------HDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGS-NPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDR---SNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMK-LKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIR 8204
            + M +L+I  VP NK I +++ +  T+VYD CR +  ++P       +E+GLF++D D  ++  WL+N K + YY L  GD    L ++ ++R L +R +D + KT+ VDDS+ IA L++ IC K+GI+NH+E+SL+ +L DEN+     T+TL+R K +     K+E++K+KLKTDD+LNW+ H KTLR+LG+DE + L LRRKYFFSD NVD+RDP+QLNLLYVQ ++AI++ THPV +EEA + AG+QCQ + G+    K K+   +LKEFLPK+Y K KGI+KKI A++ K  G S+ D KV Y  L RSLKTYG+TFFLVKEK++ KNKLVPRL+G++K+ VMR+DE+TKE+++ WPLTTVRR+AA+ + F+LDFGDYS+  Y +QTTEGE+I+QLI GYIDII+KK+KAKD+L  D +E + M+E++V+P+KA ++ H           K S   +G   LP     GVV  G  G   P+     A +   + GQ     +     Q+  +R+L S+P+RAL+  +G     ++A+  +L+      +LG+D +S ++R+  LD  +  V   + +M  AT  ++ +     +  D    G   AAI TI  N  ++ ++++ +  +    D+ED +G  L++AA+ L NAF DLL A++P N E                   + L+ A +RVGEAS  +L+ I  E    +D+E Q  D LL  AKQ+AN  + +V   K  +    + QG   Q  +I AA     ATS L++ AK+VA +I  P  Q+QL  ++++V  SVD ++   +    TH   +   L    A +  ++++L   L+I          T  QD  +   L A++RL ++ G++ EMV QA++LA A  +L   +   A  +             DSD+Q+RL+ AA+ L DA  +++ A K C      + ENQ  L +AA  +    ++ A   +++++   LE A R  +  A Q + ++Q A       N  I  + + M+       V+P V+         P  P A + LL +CQ+LI    Q++ +S+   P + +P+    L+ S +   ++L+DL+  + +A       +    + +E     D +L  +H        +    +L PLPGE  E  +  +G++SK       +L       N   +               +A++   ++++L+   RG+ A     K   +    + E+   +++  +Q +   ++  +  +LA +         KS+      ++  +  +P  +++D ++  +  S +  +          E  +  +S+S++Q+    A A  N+  G ++ S+  ++A L    +    +   +L  G+++  +  + +   Q+   LK+VS  S+ LL   K + A   + +       L  AA  V++SIN L++ C S  P  Q+ C+S+ R ++ ++  L  + P+ P+N+ +Y  C+ +V E S+SL   M  I    K G+   F  +++ +S +   ++++  QA Y +G   S      SS    P L  L   A     +   C  +++  +S+      AT I    SS+C   +   + +++P  +   + + K VA AT +L+K I    +  S  N +   +A   +++ V+ LT  A          K I+ + R AQ  I  A   +++GSCS++ +A +LV + K  PA Q+   + K     + RL + +K  APGQ+E  E  ++L   +R LDRA+++  S   + + +   +  + +  ++M+ S  ++ + I P+    + + + E LG  V +A  YL P+ ++    A    HS+ +  +++ TKTV E  L +V    Q          + D+ E   + +    +L++ ++  A+  G +  ++ S+ K+  RL E + +              +I G+  + + +S +  ++S    Q    T+ +++ ++   ++Q+ +   ++   +L        H Y SL       M++       G  +++  V  +G++C+ L +            Y Q+E     RS   +++ +M  LQ+ SRGTQ CI AA++V+ ++ DLDT I+F          ++SE + ++       +E+I K  K+LV D + +V      QE LA+A  NAV    QL  AVK  A ++G+ NP              AQ LL+NAV+DVA AL D    TK    A + K  D    ++LK S + MV +V  L+K+V+++ED   RGTRALE+++EA+ +E R  ++  P          Q G                      E+LV  T+P+ LA+ KA+AA  + +Q DI++AAN+GRKAI DL   + VT     L E +   SR+ S               S +E +++  E        L  + E + K  AEGK+       +   SR IA ++ EI  +A  LK T   D  DPN    IAE ELL AAS IE AA+K+A L+PR+S+ K+  E   FD  I+ A  SI +ATS LV+ AS +Q+ELV+ G+L      S  +  QWS GL+SAARLVAAAT +L +SA  +VQG+   ++LIS++KQVA+ TA LL+AC+VK++ DS + + LQAAG+AVK+AT+ LV+ A +    Q+          N+ MV  +   I A+ +I+ KERELE    + + +R
Sbjct:    1 MAMLSLKI-SVPDNKVIKTIQFEPGTLVYDACRVIRDKVPDSALGDAKEYGLFLTDDDPKKSGCWLENGKALGYYLLKSGD---TLEYRKKLRPLRVRMLDGSVKTVLVDDSQPIANLMVVICTKIGITNHDEFSLVRDLPDENKEPNTGTLTLRREKKEKDRDQKMEQLKKKLKTDDDLNWVDHSKTLRELGVDEDEMLTLRRKYFFSDSNVDSRDPVQLNLLYVQARDAILNTTHPVTLEEACKFAGLQCQIQFGDHNETKHKAGFLDLKEFLPKDYAKIKGIEKKIFAEHRKNIGTSELDAKVKYVALARSLKTYGVTFFLVKEKMKGKNKLVPRLLGVTKDSVMRLDERTKEIMKVWPLTTVRRWAASPNSFTLDFGDYSESYYSVQTTEGEQISQLIAGYIDIILKKKKAKDHLGIDGDEGSTMVEDSVSPAKATILQHT-------PAAKPSQPAVGLVALP-----GVVRPGTKGPQVPVKGHMPAPQQQMETGQAISAHSATTPAQQPHVRELQSEPQRALLGSLGAGRDAVQASLRELEVPQARPQLGSDPASLHWRQSHLDTHRQNVSSQIAAMNAATAQVVTLTAAPPEEMDQPAVG---AAITTIASNLPEMSKDVKMIAAL---MDDED-SGEKLLDAARRLCNAFSDLLRAAEPQNKE-----------------PRQNLLNAASRVGEASHAVLYTIGEEDE--ADMELQ--DQLLAAAKQVANATAALVLQAKNVASTCDD-QGQ--QNRVIGAATQGALATSQLVACAKIVAPTITSPSCQEQLTEASKEVGKSVDAIVASCEE--ATHQEPLLSDLRAAAAQVSRALEELL--LLIRGAPERRARATLAQDGALDTILDATDRLFSSTGDAPEMVRQAKVLARATAQLIQAIKGEAQAEP------------DSDQQKRLLAAAKVLADATARMIEAAKGCASNPHDS-ENQAALRKAAEELRHATNVAASNALKRKIIVRLENAARHASSAATQNIAAAQNAGPY----NSNIMLQEELMSSCRDVAGVIPRVVQGIKGTVAEPDSPMAHHKLLTSCQELIPPAGQMVSASKGCVPTIVEPACAVQLSNSTKQMSSALSDLRSALDKAQETCGRQQQEIDSALERIRELDQELVDIH-------RAALANQLRPLPGENSELCALKLGATSKVVGSSMAQLLTAASQGNESYTGT-------------AARDTASALQQLVEAVRGVVASSGEAKRLVEPARQVLERSCQLLEEARQAVLRPDEPDKQQRLAHV--------AKSVSAA---LNACINCLPGQKDVDDVIRTITESSQALNAR--------EFPSSNRSYSELQANLNEAAAELNEATGHMVQSSRGNAAQLASSVRHFGTAFGSLLGCGMEMAGQTQDQEVRSQMVVSLKNVSMVSSKLLVAAKSVAADPSAPNAK---NQLAVAARNVTESINHLVNVCTSAAP-GQKECDSAVRAIQMMRPML--DQPNEPVNDLTYYDCLDTVLERSQSLGDAMTGIANHAKHGEHEQFSESVREVSTTICTLVEASAQAAYLVGASDS------SSMAGKPGLVDLSHFARASQAIQMACQQLSNPASSQPQILSAATVIAKHTSSLCNACRVASSKTTNPVAKRHFVQSAKDVASATASLVKEIKVLDQEPSDANRQRCGEATRPLIDAVDSLTTFASSPEFAGVPAK-ISHKARVAQEPILAAGRSIIDGSCSMILSAKSLVLNPKDPPAWQSLGAHSKEVSDGIKRLVSSIKDEAPGQKECDEAIDKLNAAIRELDRASLNILSQESTHQAD---SSLLKTYQEQMESSASEILDIIEPLR--YAAKGEAEKLGHTVNQAVGYLGPLVQNVIAGASHTLHSKRQMALLDQTKTVAEGMLQLVYASKQAAGNPKAVHVHGDVDEAADNTRDALQELLRTLESAATEAGVVTGLVDSVSKAMYRLEERSTI--------------TISGLRSSGSYSSAVEPELSYVDYQ----TRMVRSAKEVARVAQDMVTHASHDPSRLTPLAADLSHHYASLAGDARGAMATSTSVEVPG--RIRAGVQDLGKACISLTKSAGACQSSPGDIYTQRELAENARSVSEKVSHIMAALQAGSRGTQACINAASTVSGIIGDLDTTIMF-----ATAGTLHSEKEGDQ---FVDHRENILKTAKALVEDTKTLVAGAASSQEQLAVAAQNAVSTIVQLAEAVKLGAASLGAHNP-------------EAQVLLVNAVKDVAAALGDLVQATK----AASGKGIDHPAMAHLKDSAKVMVTNVTSLLKTVRAVEDEHARGTRALESTVEAISQEVRAFDSSEPPLR-------QAGP---------------------EDLVRATQPVTLATAKAVAAGNSGQQGDIIVAANMGRKAIFDL---LSVTKSASCLAETQELKSRVLS---------------SGRECAIRYRE-------LLQLVLEVVQKPTAEGKQ------ALVSTSRNIAVAVTEIVAAAEALKGT---DWADPNDPTVIAETELLGAASSIEAAARKLANLQPRRSV-KEADESLNFDEMILEAAKSITAATSALVRAASAAQRELVAAGKLGERLPCSSAD-GQWSEGLVSAARLVAAATHSLVESANWLVQGQASEEKLISSAKQVASSTAQLLVACKVKAEPDSSSMRGLQAAGNAVKQATDHLVR-AAQRSIAQEQEFRLVI---NQRMVGGIAQEIGAREEILRKERELEEAHERLRQLR 2556          
BLAST of Talin vs. Ensembl Cavefish
Match: tln1 (talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48])

HSP 1 Score: 964.911 bits (2493), Expect = 0.000e+0
Identity = 848/2772 (30.59%), Postives = 1393/2772 (50.25%), Query Frame = 3
Query:   69 MHTLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTM-TLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQ--PQKFQ-----------IRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLN-NYMSDNSPENIGLQS-DFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPN--NQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXX--XXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRE-----LATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG-VLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQD-LMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDA-ASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRS---NLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHR-DVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            M  L + I   N   +++ +  T+VYD CR + +R+P+ +     ++GLF+SD D  +  WL+  K + YY L  GD    L +K + R L IR +D T KT+ VDDSK ++++++ IC ++GI+N++EYSL+ ++ E ++ +T  TLKR KT +RD  K+EK+KQKL TDDELNWL HG+TLR+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A + AG QCQ + G+    K K    +LKEFLPKEY+K KG +KKI   ++     ++ + KV Y +L RSLKTYG++FFLVKEK++ KNKLVPRL+GI+KE VMRVDEKTKE++Q W LT ++R+AA+   F+LDFGDY D  Y +QTTEGE+IAQLI GYIDII+KK+K+KD+   + +EE+ M+E++V+P K+ V+   F                        +G V  G V  A P+ +R+ +  GQG+  +   PQ  Q           +  L+  ++AL   I  +++ ++AA   LD    +  LG D +S+ +RK  +D +K  +   + ++T  T +++ +   D       DY  +  A+ TI  N  ++ + ++ +  +    ++E   G  L+ AA+ L  A  D+L  ++P + E                   + L++A   VG+AS  LL  I       SD + Q +D L+  AK +AN  +    ++K  +VA K T+ +  Q  +I AA     +TS L++  +VVA +I  P+ Q+QL  + + V  SV+  ++  Q       ++ +Q+      + +++++L QH  I    +   P+        + L  +E + +++G++ EMV QA+ILA+A ++L + +             + +    D +  R+L+ AA+ L DA  ++V A K      + + E QQ L +AA  +    +  A   I++RL   LE A +Q A  A Q + ++Q AA + +  A+  Q+    + + + + P+++      +  P  P+AQ  L+ + Q  +Q   +++ +++A  P + D +    L+   +N  ++LA+L+   Q+A     P  + N   +  G    L   +  A  + A G+L PLPGET+E  S  +GS++KA S    +L +     N NY         GL + D  ++ + L  +   +        A  +  D   ++ +K  ++I+  K+ +    D     +LA +       L +S++ +           P  +++D   + +++  E   K + +  P        KS  + Q+    A A  NQ+  +L+  S  T   L   + +  +     L  G+ +  +  +  +Q Q+ + LK++S +S+       LL A + S+D N    K  L  AA  V+DSIN L++ C    P  Q+ C+++ R+LE ++  L  E P+  +N+  Y  C+ SV E S+ L   M  I    K  +  +F  A+   S +   + ++ TQ  Y +G+   N+       V +P      Q A   +K  I MA  N  +  C +      AT +    S++C   +   + +S+P  + + + + K VA +T NL+K+I +   + + EN +  KA  G ++  V+ LT  A     +NP   ++  Q    G  A   I  A+  M+E S  +++ A +L  + K  P       + +T    + +L   ++  APGQRE  E  E L   +R +D+A++       S ++  + + S  +  ++M  S++++ + I P+   ++ +S    LG  V +  SY  P+  ++   A  + +S+ +  V++ TKT+ E+ L ++   +E        + Q+ L E V  +K   DDL   +   A   G +  M+ +I ++  R+ E   V P  +     T + ++ K I  TV +                                     +    KK V +     TG+  +  +GA      +   KK          +LI   +K     V  +++ ++  LQ+ +RGTQ CI AA++V  ++ADLDT I+F          +N EN +    + A  +E I K  K LV D + +V      QE LA A  ++V    +L   VK  A ++GS            E    Q +L+NAV+DVA AL D    TK    A   K  D      LK+S + MV +V  L+K+VK++ED   +GTRALE ++E +++E     +  P                              K  + E  + MTK + LA+ KA+AA  + +QED++  AN+ R+AI D++H  +                  +   P VS+  R           + +  GK      + + E++   V   K     K Q+   S+R+A S+ E+ ++A  +K T   D EDP     IAENELL AA+ IE AAKK+  LKPR +  K+  E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A + VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+T +RLQAAG+AVK+A++ LVK A +   + QD             MV  +  +I AQ +++ KERELE  R K   IRQ      P
Sbjct:    1 MVALSLKIGVGNVVKTMQFEPSTMVYDACRIIRERVPEAQLGQPNDYGLFLSDEDPKKGIWLEAGKALDYYMLRNGD---TLDYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIGITNYDEYSLVRDIGEEKKEETTGTLKRDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTLREQGVEETEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGDHNESKHKPGFLDLKEFLPKEYIKNKG-EKKIFQAHKNCQNMTEIEAKVSYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVMQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVMQQQF----------------------NKVGKVETGSV--AMPVIMRSGAG-GQGSFQMGSIPQAKQQITSGQMHTGHMPPLTSAQQALTGTINSSMQAVQAAQASLDDFDALPPLGTDAASQAWRKNKMDESKHEIHSQVDAITAGTASMVNLTAGDP---AETDYTAVGCAVTTISSNLTEMSKGVKLLAAL---MEDEGGTGQQLLGAARNLACAVSDMLKTAQPASTE-----------------PRQNLLQAAGNVGQASGELLQQIGE-----SDADQQFQDMLMKLAKAVANAAA--ALVLKAKNVAQK-TEDSAQQNRVIAAATQCALSTSQLVACTRVVAPTISSPVCQEQLIEAGKLVAKSVEGCVEASQGATGDEHLL-KQVGAAATGVTQALNELLQH--IKQYASGGQPIGRHGEATDRILDVTENIFSSMGDAGEMVRQARILAQATSDLVNAIK------------ADAEGETDLENSRKLLSAAKLLADATARMVEAAKGAAANPD-SEEQQQKLREAAEGLRMATNAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASSNKNPAAQQQLVQSCKVVADQI-PQLVQGVRGSQAQPDSPSAQLALIGSSQNFLQPGAKMVTAAKATVPTISDQASAMQLSQCAKNLASALAELRTAAQKAQEACGPLEIDNALTVVRG----LERDIQEAKAAAAEGKLRPLPGETLEKCSQDLGSNTKAVSSAVAQLLSEAAQGNENY--------TGLAARDVAQALRSLAAAARGVAATTEDPQARNAMLDCTGDVMDKSANLIEETKRAVAKPGDPDCQQRLAQVAKALSQALNRSVNCL-----------PGQRDVD---NAIRTVGEASKKLLSDQFPA-----SGKSFQEAQAGLNQAAAGLNQSANELVQASRGTTQDLAKASGKFGKDFSHFLEAGVDMAGQSQSKEDQTQVVTNLKTISMSSS-----KLLLAAKALSTDPNSPNLKNQLAAAARAVTDSINQLITMCTQQAP-GQKECDNALRELETVRGML--ENPTEAVNDLGYFDCIDSVMENSKVLGEAMAGISHNAKNSNLPEFGDAVSSASKALCGLTEAATQGAYLVGVSDPNSHAGQKGLV-DP-----AQFAK--AKQSIQMACQNLVDPACTQSQVLSAATIVAKHTSALCNACRLASSKTSNPVAKRQFVQSAKEVANSTANLVKSIKALDGAFNQENRQKCKAATGPLIEAVDNLTAFA-----SNPEFASVPAQISPEGLAAMEPIVAAAKTMLESSTGMIQTARSLAVNPKDPPKWSVLAGHSRTVSDSIKKLITNMRDKAPGQRECDEAIEVLNNCIREVDQASLAAI----SQQLTPRDDISHEALHEQMAASVQEISHLIDPV--AIAARSDASQLGHKVSQMASYFEPLIMAAIGTASKILNSQQQMSVLDQTKTLAESALQILYTAKEAGGNPKAAHTQEALEEAVQMMKEAVDDLGGTLTEAAGAAGAVGGMVDTITQAINRM-EDQAVEPEGSFVDYQTTMVKTAKAIAVTVQEM------------------------------------IGSHIKKQVTELGYSCTGL--VTKAGALQCSPNDSITKK----------ELIDSARK-----VSEKVSHVLAALQAGNRGTQACITAASAVAGIIADLDTTIMF-----ATAGTLNRENAE----TFADHREHILKTAKVLVEDTKLLVSGAGASQEKLAQAAQSSVNTITKLADVVKLGAASLGS------------EDPETQVVLINAVKDVAKALGDLIRATK----AAAGKPHDDPAMLQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATIEHIKQELAVFSSADP----------------------------PPKTATPEEFIRMTKGITLATAKAVAAGNSCRQEDVIATANLSRRAIADMLHSCKQ-----------------AAYHPEVSNEVR----------TRALRFGKECAHGYLGLLEHV--LVIIQKPTHDLKQQLASFSKRVAGSVTELIQAAEAMKGTEWVDPEDPT---VIAENELLGAAAAIEAAAKKLEQLKPR-AKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAV---DDGQWSQGLISAARMVAAATNNLCEAANSAVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSQTMKRLQAAGNAVKKASDNLVKAAQKAAFEAQDDQAVMV----KSKMVGGIAQIIAAQEEMLRKERELEEARRKLAQIRQQQYKFLP 2490          
BLAST of Talin vs. Ensembl Cavefish
Match: tln2a (talin-2-like [Source:NCBI gene;Acc:103042966])

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 677/2430 (27.86%), Postives = 1199/2430 (49.34%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTM-TLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQ-----------IRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKE----TQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVI----------QLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDI----DELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQLIAEV--PNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXX----XXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVEN-DEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECE----TLSTTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARL-TETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVT 7184
            +L+I +   N   +++    T VYD CR + +R+P+ +     EFGLF+SD D  +  WL++ + + YY L + + VL ++ + R   ++ +D   KT+ VDDSK++ EL+L IC+++GI+N++EYS++ E  E  R + M TL++ +T +RD  K+EK+K KL TDDELNWL HG+T R+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A +  GIQ Q + G     K ++   +LKEFLPKEYVK +G +KKI  +++     ++ + KV Y +L RSLKTYG++FFLVKEK+++KNKLVPRL+G++KE VMRVDEKTKE++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+K+KD    + +EE  M+E++V+P K+ ++   +          NS   + H    G + +    R  S  P  +         NV   P   Q           +  LS  ++AL+  I  +++ ++    DL++  E+  LG+D +S+ + +  +D +K  +   + ++T  T +++ +        +  DY  +  AI TI  N  ++ + ++ +  +    ++E  +G +L+ AA+TL  A  DLLNA +P + E                   + ++ A   +G+AS  LL  I  ++   +D  +Q  D L+       NL   +        +  K     ++ T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV   +          +L++ +     V+ Q L + +A +       + +          D      ++ +E + +++G++ EMV QA++LA+A ++L   +             S + + +D D  ++L+ AA+ L DA  ++V A K      E   + QQ L +AA  +       A   I+++L   LE   +Q A  A Q + ++Q AA + +  A++ Q+    + + + + P+++      +  P D +A   L+ A Q  +Q   +++ S+++  P V D +    L+   +N  TSLA+L+     A     P  + +        +QTL + +  A  +  + +L PLPGE++E     +GS+SKA      +L       N + +       G+      +A+E  ++++ L               +     E  + ++D  +++++  E +I   K A +      E ++++ +M   +    +  V  +P  +++D     LKS  E   K ++   P       +KS  + QS+     A  NQ+ GD+++ S  T S L   + + +E  D  L  G+++       ++Q Q+   LK++S +S+ LL        A+ S  VN    +       AA  V+DSIN L++ C    P  Q+ C+++ R+LEA+   +L + P+ P+N  SY  C++SV E S+ L   M  I   CKTGD   F   + V S +   + +   Q +Y +G+   N+       V +PI  +    A  M+  C ++A   +S       AT +    S++C   +     +++P  +   + + K VA +T  L+KTI +     S EN D+   A   ++  V+ LT +   +P        I+ +G  AQ  I Q++  M++ S  LL  A +LV + K          +  T    +  L   V+  APGQRE     + +++ +R +++A +   S N    +  + + S+ +  +++  S++++ + I PI    + + +   LG  V +  SY  P+S ++  +A  + H +++  +++ ++T+ E+ L M+   +        T  +  + E    ++   DDLM  ++  AS  G +  M+ SI ++  +L   T +          T++ +  + I  T  D  + K +S                E   + SQ            +  DY  L   +   +++     ++   ++K  V  +G  CM L++              ++E +   R+   +++ ++  LQ+ ++GTQ CI AA++V+ ++ADLDT I+F      +   +N+END    +S A+ +E+I K  K+LV D + +V       E LA A  ++ +   QL   VK  A +IG +                Q +L+NAV+DVA AL +  + TK       + +     LK + + MV +V  L+K+VK++ED   RGTRALE ++E +R+E    +                               + DK  + E  + MTK +  A+ KA+AA  + +QED++  AN+ R+ I+D++   +V+
Sbjct:    5 SLKICVRQCNVVKTMQFKPATAVYDACRVIRERVPEAQTGPASEFGLFLSDEDPRKGIWLESGRTLDYYMLRNGD-VLEYRRKQRPQKVKMLDGAVKTVMVDDSKTVGELLLTICSRIGITNYDEYSVVRETGEERRDEGMSTLRKDRTLLRDERKMEKLKAKLHTDDELNWLDHGRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQTQIQFGPHIEQKHRTGLLDLKEFLPKEYVKQRGAEKKIFQEHKACGEMTEIEAKVKYVKLARSLKTYGVSFFLVKEKMKSKNKLVPRLLGVTKESVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKKSKDRFGLEGDEEATMLEDSVSPKKSTILQQQY----------NSAGRVEH----GSVALPGVLRTSSVGPETL---------NVGTMPSPQQQITTGQMHLGHMPPLSAAQQALVGTINTSMQTVQQVQADLEEVEELPPLGDDLASKVWIQNKVDESKHEIHSQVGAITAGTASVVNLT---AGGPEETDYTAVGCAITTISSNLSEMSKGVKLLAAL---VEDEVGSGQDLMRAARTLTGAVSDLLNAVEPTSGE-----------------PRQTVLNAAGSIGQASGDLLRQIGEKE---TDERFQ--DVLM-------NLAKAVANAAAMMVLKAKNVAQVSEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLMEAGKLVDRSVQGCVNACLSATDDGELLKAVSAAAGVVTQALADLLAHV-------RNYDSCGEPIGRYDQATDTIMNVTENIFSSMGDAGEMVRQARVLAQATSDLVGAMR------------SDAEAEIDVDNSKKLLAAAKLLADATARMVEAAKGAAAFPENE-DQQQKLREAAEGLRVATSAAAQNAIKKKLITRLEVRAKQAAAAATQAIAAAQNAAASNKNTAAHQQLVQSCKAVADHI-PQLVQGVRGSQGQPEDDSAHLALIIASQNFLQPGSKMVASAKSSVPTVTDQAAAMQLSQCAKNLSTSLAELRTAAHMAHEACGPMEIDSALTA----VQTLRNELQDARTAAVKHQLKPLPGESLEKCGQDLGSTSKAVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALKSL-------GQAARGVAAATADAEAAVLMLDSAREVMQGSEMLISKAKEA-LETPGDTESQQTLAQMARSVSHSLNSCVNCLPGQKDVDL---ALKSIGEASKKLLMETLPPC-----SKSFQEAQSDLNQTAAGLNQSAGDVVHASRGTSSQLADASGKFSEDFDEFLDAGIEMAGHTQRKDDQLQVIGNLKNISMSSSKLLL-------AAKSLSVNPRAANAKSLLATAARSVTDSINQLITMCTQHSP-GQRECDNALRELEAV--IVLLDNPNEPVNGLSYFDCIESVMENSKVLGESMAGISQNCKTGDVPAFGECVGVASKALCGLTEVARQTSYLVGVSDPNSQAGQQGLV-DPIQFARANQAIQMA--CQNLADPGSSPSQVLSAATIVAKHTSALCNACRLASAKTTNPVAKRHFVQSAKEVANSTAILVKTIKALDGDFSAENRDKCRVATAPLIEAVDSLT-VFVSSPEFGSVPAQISREGSAAQEPILQSARSMLDSSIKLLTTARSLVLNPKDPALWSLLAAHSHTVSDSIKSLITAVRDKAPGQRECDSAIDSVRKCIREMEQACLSAVSQN----LPTRQDISLEALQEQLMSSVQEVGHLIDPIST--AAKGEASQLGHTVSQLASYFEPLSRAAVGVASKMMHHQEQMNLLDQSRTLAESALQMLYAAKEGGGNPKVTLTHDAIAEAAQLMREAVDDLMLTLNEAASEVGIVGGMVDSIAEAMGKLGAGTPSETEGSFVDYQTVMVKFSRAIAVTAHD-MIGKSVS-------------SPEELGSLASQ------------VTADYGQL--ALHGRLAAATAEPEEVGVQIKSRVQELGHGCMALVQKAGALQICPSDSITKRELMECARTVTEKVSLVLSALQAGNKGTQACITAASAVSGIIADLDTTIMF-----ASAGTLNTENDS---DSFAEHRENILKTAKALVEDTKNLVSGAATSPEKLARAAQSSAKTITQLTEVVKLGAASIGPDDP------------ETQVVLINAVKDVAKALAELISATKGAAGKAAE-DPSMLQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEAAIECIRQELTVFQ----------------------------CKETPDKCSTPEEFIRMTKGITTATAKAVAAGNSTRQEDVISTANLSRRVISDMLTTCKVS 2224          

HSP 2 Score: 73.559 bits (179), Expect = 3.633e-12
Identity = 58/126 (46.03%), Postives = 75/126 (59.52%), Query Frame = 3
Query: 7449 EITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAA 7826
            E T    +L D H+    DP     IAE ELL AA+ IE AAKK+  LKPR    K+  E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++  S   + +++ QWS GLISA    AA
Sbjct: 2244 ECTNGFLELLD-HVLQWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAK-PKEADESLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVG-SIPANAEDDGQWSQGLISAVNPTAA 2366          
BLAST of Talin vs. Ensembl Cavefish
Match: tln2b (talin 2b [Source:ZFIN;Acc:ZDB-GENE-130325-1])

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 609/2144 (28.40%), Postives = 1095/2144 (51.07%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTM-TLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHL----IINSITAHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSALTLLAKQLNESHDCMLMTGLQLIAEV--PNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQDLMENVSSL-KIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDI 6452
            +L+I +   N   +++ +  T VYD CR + +R+P+ +     ++GLF+SD D  +  WL++ + + YY L + + +L +K + R   I+ +D   KT+ VDDSK++ EL++ IC+++GI+N+EEYSLI E  E  +   M TLK+ +T +RD  K+EK+K KL TDD+LNWL H +T R+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A + AGIQ Q + G     K K    +LKEFLPKEY+K +G +K+I   ++     ++ + KV Y +L RSL+TYG++FFLVKEK+++KNKLVPRL+GI+KE VMRVDE+TK+++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    D +EE+ M+EE+V+P K+ ++   F        E  S+A    LP     G++  G +G      + +     Q     Q  +  +  LS  ++ALM  I  +++ ++ A  DL +   +  LG D +SR + +  +D +K  +   + ++T  T +++ +   D     + DY  +  AI TI  N  ++ + ++ +  +    ++E  +G NL+ AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL      Q    + + + +D ++  AK +AN  + +V  +K  +VA +  + T  Q  +I AA     +TS L++  KVV+ +I  P+ Q+QL  + + V  SV+  ++      E  + + +Q++     + +++  L QH+             D      ++ +E +  ++G++ EMV QA++LA+A ++L + +             S + + +D D  ++L+ AA+ L DA  ++V A K      E   + QQ L +AA  +    +  A   I+++L   LE A +Q A  A Q + ++Q AA + +  AS+ Q+    + + + + P+++      +  P D +AQ  L+ A Q  +Q   +++ SS++  P V D +    L+   +N  T LA+L+   Q+A     P  + +  N     +QTL + +  A  +   G+L PLPG+++E  +  +GS+SKA      +L       N + +       G+      +A+E  +++  L + ARG+AA  ++  S   + +    V++    +I      +    ++   A +   L +    +   ++  V  +P  +++D     L+S  E +     N+   ++    +KS  + Q+E        N+T+  + +S  T S L + + + ++  D  L  G+++       ++Q Q+   LK++S  S+ LL   K L    G+++       L  AA  V++SIN L++ C    P  Q+ C+++ R+LEA++  L  + P+ P+++ SY  C++SV E S+ L   M  I   CKTGD   F   + V S +   + ++  QA+Y +G+   N S      + +PI  +    A  M+  C S+    +S       AT +    S++C   +   + +++P  +   + + K VA  T NL+KTI +     S EN E  + A   ++  VE L+  A     +NP   +I  Q    G  AQ  I +++  M++ S  LL  A +LV + K  P       + +T    +  L   ++  APGQRE     + + + +R++++A++   +V +S  +  + + S+ +  +++  +++++ + I PI    + + +   LG  V +  +Y  P+  +S  LA      + +  +++ TKT+ E+ L M+   +E       ++  D +   + L K   DD+M  ++  AS  G +  M+ SI ++  R+ E     P        + +Q+        T    +K I++T            A E   +  + ++ ++ +    LV        G +Q+  + +F  ++    L +C   V +                   +++ ++  LQ+ ++GTQ CI AA+SV+ ++ADLDT I+F      +   +N+EN++    S A  +E+I
Sbjct:    5 SLKICVRQCNVVKTMQFEPSTPVYDACRIIRERVPEAQTGQASDYGLFLSDDDPRKGIWLESGRTLDYYMLRNGD-ILEYKKKQRPQKIKMLDGAIKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQEQGEERKEDGMGTLKKERTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGIQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQDHKSCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDERTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLDGDEESTMLEESVSPKKSTILQQQF--NRVGRVEHGSVA----LP-----GIMRSGSIGGPDNFNMGSMPAPQQQITTGQMHRGHMPPLSLAQQALMGTINSSMQAVQQAQADLGEVDNLPPLGQDRASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAGDP---TDTDYTAVGCAITTISSNLTEMSKGVKLLAAL---MEDEVGSGQNLMCAARTLTGAVSDLLRAVEPASGE-----------------PRQTVLTAAGSIGQASGDLLR-----QMGEGETDERFQDIMMNLAKAVANAAAMLV--LKAKNVA-QVAEDTVLQNRVITAATQCALSTSQLVACTKVVSPTISSPVCQEQLVEAGRLVERSVEGCVKACHAASE-EAELLRQVNGAAGAVSQALSDLLQHVRHYASCGEPIGRYDQATDTIMTVTESIFTSMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAHPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKLVNRLEIAAKQAAAAATQTIAAAQNAAASNKNTASHQQLVHSCKAVADHI-PQLVQGMRSSQAQPEDLSAQLTLIIASQSFLQPGSKMVTSSKSAIPTVTDQAAAMQLSQCAKNLATCLAELRTAAQKAHEACGPLEIDSALNA----VQTLKNELQDAKMAAFDGQLKPLPGDSLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALRTLAQAARGVAACTAERQSAAAMLDSASHVMEGSAMLIHEAHQAL----ISPGDAESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDM---ALRSIGEFY----ANSYLCVQLPPCSKSFQEAQTE-------LNRTV--VHSSRGTSSQLAVASGKFSQDFDEFLDAGIEMAGHTQSKDDQIQVIGNLKNISMASSKLLLAAKSLSVDPGAANAK---NLLAAAARAVTESINQLITLCTQQAP-GQKECDNALRELEAVRGML--DNPNEPVSDLSYFDCIESVMENSKVLGESMAGISQHCKTGDVPAFGECVGVASKALCGLTEAAGQASYLVGVSDPN-SQSGHQGLVDPIQFAKANQAIQMA--CQSLVDPASSPSQVLSAATIVAKHTSALCNACRLASSKTANPVARRHFVQSAKEVANTTANLVKTIKALDGDFSDENRERCRVATTPLIEAVENLSTFA-----SNPEFASIPAQISNEGSAAQEPILRSARSMLDSSTQLLETARSLVINPKDPPTWSILAGHSRTVSDSIKSLITAIRDKAPGQRECDHSIDSINKCIRDIEQASL--AAVGQS--LPCRDDISLEAVQEQVTSAVQEIGHLIEPIST--AARGEAAQLGHKVTQLSNYFEPLIVASVGLASKHMDHQQQMNILDQTKTLAESSLQMLYAAKEGGGNPKASHTHDAIAEAAQLMKEAVDDIMVTLNEAASEGGMVGGMVESIAEAMGRMDEGTPPEP----DGTFVDYQT--------TMVKFSKAIAIT------------AQEMVGLQIKTRVQELGHGCIYLVQK-----AGALQMSPTDSFTKRE----LIECARTVTE-------------------KVSMVLSALQAGNKGTQACITAASSVSGIIADLDTTIMF-----ASAGTLNAENEE----SFADHRENI 1972          

HSP 2 Score: 222.631 bits (566), Expect = 2.308e-57
Identity = 181/493 (36.71%), Postives = 267/493 (54.16%), Query Frame = 3
Query: 6774 LKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYEN----LNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE--HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            LKS+ + MV +V  L+K+VK++ED   RGTRALE ++E +++E             V  SK                  + ++  + E  + MTK + +A+ KA+AA  + +QED++  AN+ RKAI D++        +  K+    P                   E V+    K + +G       ID+ E+    L K  A+       + Q+ + S+++A S+ E+ ++A  +K +   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQAAG+AVKRA++ LVK A +      +D S+           V  +  +I AQ +++ KERELE  R K   IRQ      P
Sbjct: 2067 LKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEFIKQELT-----------VFQSK-----------------DTPERSTTPEEFIRMTKGITVATAKAVAAGNSGQQEDVISTANLSRKAIADML--------ITCKQAAYHP----------------EVAEDVRN---KALLYGLECSTGYIDLLEHVLLVLQKPTAD------QRQQLAVLSKKVAGSVTELIQTAEAMKGSEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADESLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAV---DDGQWSQGLISAARMVAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVKAAQKAAFDKAEDNSVVV-----KTKFVGGIAQIIAAQEEMLRKERELEEARKKLAHIRQQQYKFLP 2486          
BLAST of Talin vs. Ensembl Cavefish
Match: hip1 (huntingtin interacting protein 1 [Source:NCBI gene;Acc:103022424])

HSP 1 Score: 80.1073 bits (196), Expect = 3.214e-14
Identity = 66/237 (27.85%), Postives = 116/237 (48.95%), Query Frame = 3
Query: 7524 IAENELLEAASQIETAAKKIA-LLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALV------KEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGH 8213
            + E E+   ++ +E+AA +I  +L   +++  DTG +   + +I+ +C  ++ A   LV  +   Q+++V  GR   +        ++W+ GLISA++ V      + D+A  VVQGK   + L+  S ++AA TA L+ A +VK+D DS    RLQ A   V +AT  +V      K   E  D        T D  + ++    R  + +Q  ++  E  L+  R +   +R+ H
Sbjct:  770 LVEQEMAATSAAVESAAARIEEMLNKSRAV--DTGIKMEVNERILASCTELMQAIKVLVLSSKDLQKDIVEGGRGAATIKEFYAKNSRWTEGLISASKAVGWGATMMVDAADLVVQGKGKFEELMVCSHEIAASTAQLVAASKVKADKDSGNLARLQQASRGVTQATAGVVASTKSGKSQIEETD--------TMDFSSMTLTQIKRQEMDSQVRVLELETWLQKERERLGELRKKH 996          
BLAST of Talin vs. Ensembl Cavefish
Match: hip1 (huntingtin interacting protein 1 [Source:NCBI gene;Acc:103022424])

HSP 1 Score: 80.1073 bits (196), Expect = 3.323e-14
Identity = 66/237 (27.85%), Postives = 116/237 (48.95%), Query Frame = 3
Query: 7524 IAENELLEAASQIETAAKKIA-LLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALV------KEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGH 8213
            + E E+   ++ +E+AA +I  +L   +++  DTG +   + +I+ +C  ++ A   LV  +   Q+++V  GR   +        ++W+ GLISA++ V      + D+A  VVQGK   + L+  S ++AA TA L+ A +VK+D DS    RLQ A   V +AT  +V      K   E  D        T D  + ++    R  + +Q  ++  E  L+  R +   +R+ H
Sbjct:  804 LVEQEMAATSAAVESAAARIEEMLNKSRAV--DTGIKMEVNERILASCTELMQAIKVLVLSSKDLQKDIVEGGRGAATIKEFYAKNSRWTEGLISASKAVGWGATMMVDAADLVVQGKGKFEELMVCSHEIAASTAQLVAASKVKADKDSGNLARLQQASRGVTQATAGVVASTKSGKSQIEETD--------TMDFSSMTLTQIKRQEMDSQVRVLELETWLQKERERLGELRKKH 1030          
BLAST of Talin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003776.1 (pep scaffold:Pmarinus_7.0:GL481036:4073:28398:-1 gene:ENSPMAG00000003436.1 transcript:ENSPMAT00000003776.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 579.326 bits (1492), Expect = 3.061e-174
Identity = 495/1560 (31.73%), Postives = 827/1560 (53.01%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSM-RAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERM-KTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSF-EKNSLATIGHLPN--RGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALK-ETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQ----DPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLN-NYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVID--------CGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHS-ALTLLAKQLNESHDCMLMTGLQLI--AEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNA 4682
            +L+I +   N   +++ +  TVVYD CR + +R+P+ ++       L +S   S  R   L  S   +  P      +L ++ + R L +R +D T KT  VDDSK++ +++L +C ++GI+N+EEYSL+ E+ E + M  T TLK+ ++ +RD  K+EK+KQKL TDD++NWL HG+TLR+ G+++ + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ E A + AG Q Q + G     K K    +LKEFLPKEYVK +G +K++  +++K    ++ + KV Y +  RSLKTYG++FFLVKEK++ KNKLVPRL GI+KE VMRVDE+TKE+IQ WPLTTV+R+AA+   F+LDFGDYSD  Y +QTTEGE+IAQLI GYIDII+KK+K+KD    + +EE+ M+E++V+P K+ VI  N    N +   E  S+A    LP   RG  G  S GR     P A   +  I  G ++    +  +  +S  ++ALM  I  +++ ++ A   LD+   +  LG D++S+ +R+  +D AK  +   + ++  +T + + +   D     + DY  +  A+ TI  N   L E  R V  +   T+EE  +G  L++AA+ L++   DLL   +P + E                   +A++ A + VG +S  LL  I  +      ++ Q +D L   AK +AN  +G+V  +K  +VA K + Q  + Q  +I AA     +TS L++  KVV  +++ P+ Q+QL  S + V  +V+  ++  Q   +   ++ +Q+      + +++D L QH+ + +   H     D      ++A+E + ++ GN+ EMV QA++LA+A ++L + +   A  +  Q N             R+L+ AA+ L DA  K+V A K      E + E QQ L +AA  +    ++ A   IR++L   LE A RQ A  A Q + ++ +AA + +  A+  Q+   ++ + + V P+++      +  P  P+AQ  L+ A    +Q   +++ +++A  P V D +    L    +N  T LA+L+   Q+A        + +  ++    +++L + +  A  + + G+L+PLPGET+E+ +  +G++SK       ++       N NY         G+      +A++  +++++L   ARG+AA  +   + E + E   D++D          K ++R G D I   +LA +       L K            V  +P  Q++D   + L+S  +   K + +  P         S  + Q     A A  N +  +L+ ++   S  L+  +++        L  G+ +   A+   +Q Q+   LKS+S +S+     L    A     +    K  L  AA  V+DSIN L++ C    P  Q  C+++ R+LE +K  L  + PS P+N+ SY +C+ S+ E S+ L   M+ +    KT +   F  AI   S +   + ++ +Q+ Y +G+   N+
Sbjct:    5 SLKICVRHCNVVKTMQFEPSTVVYDACRIIRERVPEAQDGQPPATPLALSSLPSPPRPLHLPISSTATSPP--HPQDLLEYRKKQRPLKVRMLDGTIKTAMVDDSKTVGDMLLAVCARIGITNYEEYSLVREVAEEKAMDGTGTLKKDRSLLRDEKKMEKLKQKLHTDDDMNWLDHGRTLREQGVEDSETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEMACEFAGYQAQIQFGPHNEVKHKPGFLDLKEFLPKEYVKQRGAEKRLFQEHKKCESMTEIEAKVRYVRQARSLKTYGVSFFLVKEKMKGKNKLVPRLFGITKESVMRVDERTKEVIQEWPLTTVKRWAASPKSFTLDFGDYSDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDRFGTEGDEESTMLEDSVSPKKSTVIQTNC---NPMGMAEHGSVA----LPAVMRGIGGPESLGR--GVMPGA---NKVITSGAMH----RGHLPPMSTNQQALMGTITSSMQAVQQAGNSLDEMDALPPLGQDKASKAWRQYKMDQAKHEIHSQVDAINASTASCINLTSGDA---ADTDYTAVGCAVVTISSN---LTEMSRGVRLLAALTEEEGGDGRALLQAARGLIDCISDLLKTVQPSSTE-----------------PRQAVLTAASTVGRSSNNLLKQIGQQ-----GVDQQFQDVLNQLAKAVANAAAGLV--LKAKTVAQKADDQALQNQ--VIAAATQCALSTSQLVACTKVVGPTMDSPVCQEQLMESGKLVARAVEGCVRSSQEATKDDELL-RQVGGAAGAVTQALDALLQHVKLLASGGHGMGRYDCATDTIITATESIFSSTGNAGEMVKQARLLAQATSDLINAIKVDAEAEGDQEN------------SRKLLAAAKYLADATAKMVEAAKGAAANPE-SEEQQQRLQEAAEGLRVATNIAAQNAIRKKLVHRLEVAARQAAAAASQAIAAATQAAASNKNPANQQQLVGCSKNVADHV-PQLVQGWRGSQSQPDSPSAQLALITASHNFLQPGTKMVAAAKASVPTVTDQASSMQLGQCAKNLATCLAELRTAAQKAQDACGTLEIDSALDL----VRSLEAELQEAKVAASDGKLHPLPGETLETCAQDLGATSKTVGSSMAQVMTAASQGNENY--------TGI------AARDTAQALKQLAAAARGLAANSADKPTQEAVLESARDLMDKASLFIQEAKKAVVRPG-DPINQQRLAQVAKAVSGALGK-----------CVGCLPGQQDVD---TALRSLADHSKKLLSDTIP-----RSGSSFQEAQGNLNDAAAGLNLSASELVQASRGSSQELSTASRKFGNDFSRFLDAGIDMAGQAKTKEDQVQVVGNLKSISMSSS---KLLLAAKALCVDPNAPNAKNQLAAAARAVTDSINQLITMCTQQAP-GQNECDNALRELETVKGML--DNPSEPVNDLSYFECIDSLMENSKVLGEAMQGVSQNAKTSNLPAFGEAISSASKALCGLTEAASQSAYLVGVSDPNS 1455          
BLAST of Talin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007752.1 (pep scaffold:Pmarinus_7.0:GL478287:501:47681:-1 gene:ENSPMAG00000006982.1 transcript:ENSPMAT00000007752.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 318.931 bits (816), Expect = 4.891e-90
Identity = 324/1210 (26.78%), Postives = 570/1210 (47.11%), Query Frame = 3
Query:  951 VKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQ--NSISDLEWQ-------TRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHL--IINSITAHQDP------LVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQICSEAQEMTEIV---LPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQ------LQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSD----------------------NSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQL--IAEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLE 4427
             K  Y +L RSL+TYG++FFLVKEK+++KNKLVPRL+G++KE V+RVDE+TKE++Q WPLTTV+R+AA+   F+LDFGDY    Y +QTTEGE+I+QLI GYIDII+KK++AKD    + +EE+ M+EE+V+P K+ ++   +     +     +L  I   P  G    V+ G +  AQ           Q   + Q  K  +  LS  ++AL+  I  +++ ++ A  DL     +  LG+D  S+++R+  +D +K  +   + ++T  T +++ +   D     + DY  +  A+ TI  N  ++ + +R +  +    D+E  NG +L++AA+ L +A  DLL    P   E                   ++++ A   VG+AS  LL  I  ++   S  D+  Q          TL+  AK +A                 +  +    Q  +I AA     +TS L++  KVV  +I  P  Q+QL  + + V  +V+  +Q  Q   E   ++ +Q+ E    + ++++ L +H+     S+T    P           L+A+E +  ++G++ EMV QA++LA+A ++L + +   A  +  Q N+            R L+ AA+ L DA  ++V A K      E   E QQ L +AA  +    ++ A   I+++L+  LE A +Q A  + Q + ++Q AA + ++ N Q   +  +  ++V   +P+++ +  + +  P    AQ +L+ +    +Q    L+ S+ A  P V++ +  + L    +N    L++L+    +A     PT         +GQ      ++ L + ++ A   VA+G L PLPGET+ES S  +GS+SK       +L       +   +D                      N+ + +  Q   + +A+++M+    LL+ AR  AA  S  D+ + L +                  V + + LA                    ++  V  +P  +++D  +  +  + +    +              +S+ + QS  T A A  NQ  G +++ S+ +   L   + +        L  G+++  + +   +Q Q+   LK++S +S+ LL   K ++    + +V      L  AA  V+DSIN L+S C    P  Q+ C+++ RQLE
Sbjct:   14 AKSKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGVTKESVLRVDERTKEVMQEWPLTTVKRWAASPKSFTLDFGDYQVGYYSVQTTEGEQISQLIAGYIDIILKKKQAKDRFGLEGDEESTMLEESVSPKKSTILQQQYNRVGKVEHASVALPAIMR-PGAGGPDTVNWGMMPVAQ-----------QQVTSGQMHKGHMPPLSSAQQALVGTITSSMQAVQQAHGDLGDMDSLPPLGDDAESQSWRRNKMDESKHEIHSQVDAITAHTASVVNLTAGDP---ADTDYTAVGCAVTTISSNLTEMSKGVRLLAAL---LDDEGANGQDLMQAARGLASAVSDLLKTVDPSTAE-----------------PRQSVLTAAGNVGQASGELLRTIGEDEADQSFQDMLMQLAKAVANAAATLVLKAKNVA-----------------QRAEDPAQQNRVIAAATQCALSTSQLVACTKVVGPTIRSPACQEQLMEAGKLVARAVEGCVQASQDATEEEELL-RQVGEAATAVTQALNDLLRHVRQYAASLTGRAGPGGSYVQATDTILTATENIFGSMGDAGEMVRQARLLAQATSDLVNAIKADAEAEQDQENV------------RNLLAAARVLADATARMVEAAKGAAANPENE-EQQQKLREAAEGLRVATNIAAQNAIKKKLTNRLEQAAKQAAAASTQTIAAAQHAASSNKSPNSQ--QQLVQSCKVVADHIPQLVQSVRESQSTPDSQQAQQSLITSSLGFLQPGNHLVASARAAVPSVENQASSNQLGTCAKNLAACLSELRAAAHKAQQACSPT---------EGQDSALALVRALENELEEAKTEVAQGRLKPLPGETLESCSLELGSASKTVGSAIAQLLTAASQGDESFTDHAAHEAAEALRGLAAAARGVAANTADPLA-QEAALETARDVMDKSANLLQEARKAAANPSDPDNQQRLAQ------------------VAKAVSLA--------------------LNNCVNSLPGQKDVDSALRNINDASKRLQADSF--------PQSGRSYHEAQSGLTQAAAGLNQATGRVVHASHGSSRELATASGRFGRDFSDFLDAGIEMAGLTQTKEDQVQVIGNLKNISVSSSKLLMAAKSMVIDPAAPNVK---NQLASAARAVTDSINLLISMCTQQAP-GQRECDNALRQLE 1095          
BLAST of Talin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010194.1 (pep scaffold:Pmarinus_7.0:GL480176:295:15370:1 gene:ENSPMAG00000009228.1 transcript:ENSPMAT00000010194.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 311.997 bits (798), Expect = 1.413e-89
Identity = 290/958 (30.27%), Postives = 466/958 (48.64%), Query Frame = 3
Query: 5454 SLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETL----------STTTNNQDLMENVSSL-KIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAP-LDAASAHTLIFQSIKGITDTVTD------------NSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKE---NSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRL--KPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPN----KSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            +++Q+ N I P+  +   ++    LG  V +  SY  P+  ++  +A      + +  +++ TKT+ E+ L ++   +            +   N  + ++  S + +   DDL   ++  AS  G +  M+ +I ++  ++ E    AP        T + ++ K I  T  +             SL   ++       +  +   A+ DN+        +V +  K  V D     + V+ +  +GA           +C    G +  DLI   +K     V  +++ ++  LQ+ +RGTQ CI AA++V+ +VADLDT I+FA +G+     +++EN++    S A  +E I K  K+LV D + +V      QE LA A  ++V    +L   VK            LG + +  E    Q +L+NAV+DVA AL D  + TK       D +    NLK + + MV +V  L+K+VK++ED   +GTRALE ++E +++E    E   P                              K  S E+ + MTK + LA+ KA+AA  + +QED++  AN+ RKA+++++           K+    P         + SD   R++   KE       ++EH          +   L K  A+      +K Q+T  S+R+A S+ E+ +SA  +K +   D EDP     IAE ELL AA  IE AAKK+  LKPR   ++   E   F+ QI+ A  +I +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+  DS+  +RLQ AG+AVKRA+E LVK A +       +  +  +  N    +  V  +  +I AQ +++ KEREL+  R K   IRQ      P
Sbjct:   10 TVQQISNTIDPVATVARGEAS--QLGHKVSQMASYFDPLVFAAVGMASKSLSHQQQMNLLDQTKTLAESALQLLYAAKEAGGNPKSSARPAQALNAHEAIQEASQMMREAVDDLTATLNETASELGMVSGMVDAISQAIGKMDEGTPPAPEYSFVDYQTTMVKTAKAIAVTAQEMVSKSASRPEDLGSLASQLTTEYGNLAQQGRPAAASADNE--------EVGHQIKHRVQDLGH--SCVLLVQKAGAL----------QCSPTDGFTKRDLIDCARK-----VSEKVSMVLASLQAGNRGTQACITAASTVSGIVADLDTTIMFATAGT-----LHAENNE----SFADHREGILKTAKALVEDTKLLVAGAGATQEKLAQAAQSSVGTITRLADVVK------------LGAASLGSEDPETQVVLINAVKDVAKALGDLISATKSAAGKQPD-DPAMHNLKGAAKIMVTNVTSLLKTVKAVEDEATKGTRALEATIECIKQEVMMFETREP----------------------------PQKTASPEDFIRMTKGITLATAKAVAAGNSCRQEDVIATANLSRKAVSEML--------AACKQAAFHPE--------VASDVRARSLRYGKECANGYQALLEH----------VLLVLQKPTAD------NKHQLTNLSKRVAGSVSELIQSAEAMKGSEWVDPEDPT---VIAEAELLGAAPAIEAAAKKLEQLKPRAKPRQ-ADESLNFEEQILEAAKAIAAATSALVKSASAAQRELVAQGKVGASPANAV---DDGQWSQGLISAARMVAAATSNLCEAANAAVQGHASEEKLISSAKQVAASTAQLLVACKVKAAPDSEAMRRLQGAGNAVKRASENLVKAAQK-------AAAFDQEEENVVVKEKFVGGIAQIIAAQEEMLRKERELDEARRKLAQIRQQQYKFLP 844          
BLAST of Talin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007037.1 (pep scaffold:Pmarinus_7.0:GL476737:73889:120616:-1 gene:ENSPMAG00000006357.1 transcript:ENSPMAT00000007037.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 221.09 bits (562), Expect = 1.000e-65
Identity = 107/210 (50.95%), Postives = 156/210 (74.29%), Query Frame = 3
Query:  303 VLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENER-------MKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKII 911
            +L +K ++R L +R +D   KT+ VDDSK++ +L++ IC ++GI+N++EYSLI+E    ER       +++ TLK+ +T +RD  K+EK+KQKL TDDELNW+ HG+TLR+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++ +HPV+ ++A + AGIQ Q + G     K K+   +LKEFLPKEYVK KG +KKI 
Sbjct:    2 LLEYKRKVRPLKVRMLDGMIKTVMVDDSKTVGDLLITICTRIGITNYDEYSLIWEGGGEERKEDGGGTLRSGTLKKDRTLLRDEKKMEKLKQKLHTDDELNWVDHGRTLREQGVEENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNSSHPVSYDKACEFAGIQAQIQFGPHVEHKHKAGFLDLKEFLPKEYVKQKGSEKKIF 211          
BLAST of Talin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002539.1 (pep scaffold:Pmarinus_7.0:GL478866:18799:39338:-1 gene:ENSPMAG00000002312.1 transcript:ENSPMAT00000002539.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.614 bits (405), Expect = 3.604e-41
Identity = 151/476 (31.72%), Postives = 239/476 (50.21%), Query Frame = 3
Query: 6210 YDQKEFIGQVRSRLTDLMYL----LQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYEN----LNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIK 7613
            + ++E +   R R+T+ + L    LQ+ +RGTQ CI A ++V+ ++ADLDT I+FA +G+     +N+E ++    S A  +E+I K  K+LV D + +V      QE LA A  ++V     L  AVK  A ++GS+                Q +L+NAV+DVA AL +  + TK      +D +     LK + + MV +V  L+K+VK++ED   RGTRALE ++E +++E    E+         N +               V AS+      E  + MTK + LA+ KA+AA  + +QEDI+  AN+ RKAI+D++   +                  +   P VS       E V+  +++    G+      +++ E+    L +  AE       K+Q+   S+R+A+S+ E+ ++A  +K T   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K
Sbjct:  159 FAKRELVESAR-RVTEKVSLVLAALQAGNRGTQACITAGSAVSGIIADLDTTIMFASAGT-----LNAEGEE----SFADHRENILKTAKALVEDTKMLVAGAGASQEKLAQAAQSSVATITDLAEAVKLGAASLGSHDP------------ETQVVLINAVKDVAKALAELISATKSAAGKPSD-DASMHQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFES---------NDR--------------PVAASTP-----EEFIRMTKGITLATAKAVAAGNSCRQEDIIATANLSRKAISDMLSSCK-----------------RAAYHPDVS-------EDVRSRALRF---GRECTVGYLELLEHVLVILQRPTAE------LKLQLAAFSKRVANSVTELIQAAEAMKGTEWVDPEDPT---VIAEAELLGAAAAIEAAAKKLEQLKPRAKPK 547          
BLAST of Talin vs. Ensembl Yeast
Match: SLA2 (Adaptor protein that links actin to clathrin and endocytosis; involved in membrane cytoskeleton assembly and cell polarization; present in the actin cortical patch of the emerging bud tip; dimer in vivo [Source:SGD;Acc:S000005187])

HSP 1 Score: 52.373 bits (124), Expect = 1.277e-6
Identity = 41/124 (33.06%), Postives = 63/124 (50.81%), Query Frame = 3
Query: 7671 IVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGK----CGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEAL 8030
            I+ A   LVK A   Q E+ +   + P      +N ++W+ GLISAA+ VA AT  L  +A  ++  +       ++ I ASK+VAA T  L+ A +VK+   SK   +L+     V  A  +L
Sbjct:  779 IIDAVVALVKAAIQCQNEIATTTSI-PLNQFYLKN-SRWTEGLISAAKAVAGATNVLITTASKLITSEDNENTSPEQFIVASKEVAASTIQLVAASRVKTSIHSKAQDKLEHCSKDVTDACRSL 900          
BLAST of Talin vs. Ensembl Nematostella
Match: EDO47777 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL15])

HSP 1 Score: 931.784 bits (2407), Expect = 0.000e+0
Identity = 809/2711 (29.84%), Postives = 1364/2711 (50.31%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERM---KTMTLKR--------GKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQ-PIAIRNDSKIG--QGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQ----PLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIV--LPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMD--TAAESVA-RGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPIL---DSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG----VLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTN----NQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHT-------LIFQS--IKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIG---QVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATE 8024
            +L+I +V  N   +L+ + +  V +  R + +++P      V ++GLF  + D  +  WL+ ++ +++YPL D ++ L +KS++R + I+ MD   KTL++DDS ++ +++  +C KMGISN EE+SL+ E  ++E+    KT TLKR         + + RD  K++++K+KL T+D++ WL H KTLR+ G D+   +++RRKYF+SDQNVD +DP+QLNLLYVQ ++ I+DGTHP   EEA QL  IQ Q + G+    K K I  +LKE LPKEYVK+K IDKKI  ++ K +G  +   +  Y QLCR LKTYG+TFFLVKEK++ KNKLVPRL+GI+KE ++RVDEKTKE+++ WPLTTVRR+AA+ + F+LDFGDY++  Y +QT EGEKI+QLI GYIDII+KK+K  +    D +E +AM E+ VAPSK       ++D+ T      S+ ++  LP      VV  G  GS++  +     ++ G   G+ +   +   + +L+  ++A M  +   +  +  A E+L + + +  LG+D +S  +++ TLD+++  V   L +++ +  +++ +    E  D N  Y    AA+  I  N   L + I+ +  +    D +D +   L++AA+ L  AF  LL A++            E   G+K   S   L+ A   VG +   LL  +   +     ++ +T++TLL  A+ +AN  + +V  +K  +VA  +   T  Q  +I AAK++   TS L++  K+V  SI   + Q+Q+  SA+QV  +V++     +    P  E  +V+          +   + K+++     +            L A++RL  ++GN+ EMV QA+ILA+A + L   + + A VQ             D D Q+RL+ AA+ L DA  KLV A K   +      E Q+ L +AA  + S  +  A + ++++L K LE A ++      QLV ++Q AA   R  AS  Q+  + + + + +  L E +  C+    NP D N+Q NL+N  +  I  + +L+  S+A  P + +P   S L    +++  SL +L+   ++A        V       D  L+ L +  D   A E  A  G+L PLPGE  ES +  +G++SK       +L       N   +       G+      +A++   +++ L +  RG+AA  S  D+ +N+ +    VI    ++I   +  +      + +      L +    + + ++  V  +P  +E++  +  + ++ +   K         E    T+ + + Q + + + A  N    D+++ S  + + L    K  + S+  ++ +GL L  + P+   +  + ++++ N ST     L    +     +    K +L  AA  V+DSIN LL+AC S  P  Q+ C+S+ R ++A+ T L  + P  P+N+ +Y  C+++V   S+ L   M  I  + K  D N F  +I+  S +   + ++  QA Y + +         SS    P L   +  I     ++  C S+ + ++S+      AT +    S++C   K     + +P  + + + A K VA  T NL+K I + + +    ND+  K+C      + N+VE LT  A  +P   P    I+++ R AQ  +  A   +     +   AA   V + +   A Q      K     + RL   +K +APGQRE     E++  V+ NLD+A++     N S  +  ++   +    +RM  +L ++   + P+   ++ +S+ E +G  V +   +L P+ +++   A L+ +S+ +G++++ TKTV E+   M+   +T          +  + E   S+     DL   I+  AS  G +  ++ SI K+   L+E+    P D+  A+        +++Q    K + D V             +  K ST   K       L++    D++  +  + H+    V  V     +G         +++  V  +G+SC+ L++            Y +K+      QV  +++ L+  L + SRGTQ CI AA++V  +V+DLDT ++FA +         + N +    + A  +EDI +  K LV D +++V S    Q+ LA A +++V   ++L   VK  A A+GS+ S             AQ +LLNA RDVA AL    N TK N +  +  +     LKSS +TMV +V  L+ +VK++ED   RGTRA+E+S EA+++    L +      D                             S E+L+  TK + LA+ KA+AA  +  Q+D++ AAN+GRKA+T+++                       + A + +D D     ++         +G+   + +I++ +         K     K ++   S+++A  + ++  +A  LK +   + EDPN    IAENELL AA+ IE AA+K+A L+P K   K+  +   F+ QI+ A  +I +AT  LVK AS +Q+EL++ G++  S     + + QWS GL+SAAR VAAAT+ L ++A A VQG    +RL++ + QVA+ TA LLLAC+VK+DA S T +RLQ AG+AVKRA E
Sbjct:    4 SLKINVVKNNSIKTLQFNPEATVAEALRIIREKVPDASPGKVADYGLFKQEDDPAKGKWLEPARSINFYPLKDGDM-LEYKSKIRLIKIKFMDGNVKTLQIDDSHTVGQILETVCVKMGISNPEEFSLLVEGKDDEKEEAEKTSTLKRVMMKDVPIKRLEERDRKKMDQLKKKLHTEDDVQWLDHDKTLREQGTDDSHTVVMRRKYFYSDQNVDIKDPVQLNLLYVQCRDGILDGTHPCTQEEASQLGAIQIQVQFGDYEESKYKLI--DLKEVLPKEYVKSKNIDKKIKEEHRKFNGLDELQGRYKYVQLCRGLKTYGVTFFLVKEKMKGKNKLVPRLLGITKESILRVDEKTKEVMKTWPLTTVRRWAASPNSFTLDFGDYTESYYSVQTNEGEKISQLIAGYIDIILKKRKGMEGYDPDFDEVSAMEEDQVAPSKGT-----YLDRQTNKVGHASVGSVA-LP-----AVVRAGGQGSSRYSMGKMEPAQYGTVSGSAHSAHRPPMLHNLTPAQQAYMSSLSQGIDSVDTADEELKRPVNIVALGSDPASLKWKQNTLDVSRQNVASRLAALSASCASIVNVTSG-EPGDTN--YTAAGAAVHVISANLQDLSKGIKLIAGLL---DNQD-DSSKLLDAARGLAGAFSLLLKAAQ------------EGAGGDKEKRSQ--LLNAAGNVGSSGAQLLEYMGEPE-----VDQETQETLLKLAQAVANATATLV--LKAKNVA-SQCPDTAQQNKVIGAAKDTAMTTSQLVACVKLVVPSITSQMCQEQVVESAKQVAKAVEDTEGACKGACDPDSENMNVLIDAAQGVRDALNALLKKVREGGERPTEGEKYGETCDDILGATDRLFNSMGNAGEMVKQAKILAQATSSLVSGIKSEAEVQD------------DDDNQKRLLAAAKLLADATAKLVEAAKGAARNPNDADE-QEKLKRAAEDLRSATNTAASDALKKKLVKRLENAAKEATGQTTQLVAAAQAAAPVNRNQASQQQLMDQLKPVEDQIARLLESLRDCSN---NPDDANSQLNLINVSKMFIPPVAKLVAFSKAALPTIDEPMYASQLGNFSKSTAASLNELRNAAEKAAEACGTLEV-------DSALKRLKALDDDLKAVERAAEEGKLVPLPGENPESSALELGATSKTVGSSMAQLLTAAAQGNESYT-------GI------AARDTANALKNLTQAVRGVAAGTSDKDAQKNIVQAARGVIQESAKLINEAKKALNNPGDPNNQ----QRLAQVAKGVSQALNNCVNCLPGQREVEDSIKAVSAASQALSKE--------EFPPTTEPYQRNQEKLSQSGAALNAAASDVVSASRGSPNQLATSTKNFSLSYQGLVNSGLMLAGQAPDEAAK-EALVRNLRNTSTASSKLLLAARSLVSDPNAPNAKNALANAARAVTDSINTLLNACMSAAP-GQKECDSALRNIQAVNTIL--DNPVEPVNDSTYFDCLETVAGKSKDLTEAMPVIADSIKQADYNKFDRSIKRASNAVCALTETAAQAAYLVAVADP------SSVAGKPGLIDQEQFINAKQEINDACQSLLNPDSSQQRVLAAATAVAKHTSALCNACKVASAKTHEPAAKRQFVQAAKDVANNTANLVKQIKTFAGN---MNDDNRKSCASATRPLRNSVESLTAYA-LSPDFAPVPAKISDEARSAQVPVIMAGKSIANSGANYFNAAKLSVVNPQDTNAWQNLQQTAKQVADAMRRLITAIKDNAPGQRECDLAIEDINTVINNLDQASL----ANISDGLEPRTEQPLQVYQERMMQNLGEMNPVVEPLG--VAAKSQPENIGHLVAKMTDFLVPLCDAAIGAASLMKNSKRKGDLLDQTKTVAESAAQMMYATKTAGGNPQVHHAHPAVDEAAQSMHDAIYDLKNTIEQDASESGIVSGLVDSISKT---LSES----PYDSVDAYRRGAYEPFVVYQERMTKAMKDLVR--------KAQDMVGKSSTDPTKLGP----LAK----DISNLYDDIAHNARGAVATVGNADVAG---------RIRNGVQGLGESCIGLVQSAGAVQATPTDPYSKKDLADRSRQVAEKVSHLLAALITGSRGTQACINAASTVQGIVSDLDTTVMFATA--------GTLNPETPGETFADHREDILRTAKVLVEDTKRLVASAQASQDVLATAAESSVGSVSKLTDHVKLGAAAMGSDDS------------DAQQMLLNAARDVASALGSLINSTK-NASGKSPNDPAMEPLKSSAKTMVSNVSSLLMTVKTVEDKTMRGTRAMESSNEAIKQAIMVLNSPTLPARDA----------------------------SPEDLIRSTKGVTLATAKAVAAGNSCNQDDVIAAANMGRKAVTEMLS--------------------ICKAAAVKADTDEVKYATIVAGRDTAAAYGE-VSELVINILQ---------KPTPEKKARLMPLSKKVAEGVGKLVRTAETLKGSEWVNPEDPN---IIAENELLGAAASIEAAARKLAELRP-KPRPKEADDSLNFEEQILEAAKAITAATVALVKSASAAQRELIATGKIF-SAGTDAREDNQWSQGLVSAARTVAAATQTLCEAANAAVQGNASEERLVAGANQVASSTAQLLLACRVKADAHSATQRRLQVAGNAVKRAGE 2487          
BLAST of Talin vs. Ensembl Nematostella
Match: EDO49269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH05])

HSP 1 Score: 80.1073 bits (196), Expect = 1.457e-14
Identity = 52/174 (29.89%), Postives = 87/174 (50.00%), Query Frame = 3
Query:  705 NLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKS-----------------IHSNLKEFLPKEYVKTKGIDKKIIAQYEKLS--GKSDKDVKVIYAQLCRSLKTYGITFFLVKE---KVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATA 1160
            ++LY Q + A++ G  P ++E+AI L+ +Q   E  +M+P  A++                   S LK+ +   + K K I K+I  Q E     G S+++ K  Y   C+++  YG  FF +KE    +   +  V RL GIS + V+ +DE+TK ++ NW    V+R+   A
Sbjct: 1485 SILYEQCQKAVVGGGLPCHVEDAIYLSALQLYIE--DMSPPSAETRGRLEGWFLQGTGSEKLSASRLKQAVHPSFYKVKNIAKRIRGQREHFQNEGLSERNAKHNYIDCCQAMPGYGCRFFQLKECLGTISRNSGHVDRLFGISPKKVVLLDERTKGVVGNWQFNDVKRWKLVA 1656          
BLAST of Talin vs. Ensembl Nematostella
Match: EDO35194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM91])

HSP 1 Score: 73.1738 bits (178), Expect = 1.192e-13
Identity = 65/229 (28.38%), Postives = 112/229 (48.91%), Query Frame = 3
Query: 7530 ENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEA-TEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGH 8213
            +NE+   A  +  AA +I  +   K+ +K TG +   +G+I+ +C S++ A   L+  +   Q+E+V  G+   +     +   +W+ GLISAA+ V    + L DSA  VV GK   + L+ AS ++ A TA L+ A +VK+   S   Q L  A   V  +   +V  A T    ++D ++P   D    ++  + R  + +Q  ++  E  L   R K   +R+ H
Sbjct:   21 DNEINATAELVADAAARIEEM-LNKTREKYTGVQLEVNGRILDSCTSLMQAIKVLILKSKDLQEEIVGVGKGTATAKEFYKRHHRWTEGLISAAKAVGWGAKVLVDSADKVVLGKGKFEELVVASNEITASTAQLVAASRVKAHRGSNKLQALHGASKDVVESAAGVVASAKTGAEMIEDKTVP---DYSKLTLTQAKRLEMDSQVRLLELESNLTKEREKLGQLRRIH 245          
BLAST of Talin vs. Ensembl Nematostella
Match: EDO35658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKY6])

HSP 1 Score: 68.9366 bits (167), Expect = 3.551e-11
Identity = 72/309 (23.30%), Postives = 136/309 (44.01%), Query Frame = 3
Query:  351 DDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLL-YVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAK--SIHSNLKEFLPKEYVKTKGID---KKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGD-YSDENYVIQTTEGEKIAQLIGGY 1256
            DD+ +  EVD      E    I  ++G+ + E +SL  ++ +    K +++  G      FD +  + + LK          G T      +   ++   +K +     V  +DP    +  Y Q     + G H    EEA QLA +  + + G    DK++  +I   +KE +P + VK    D   + I+AQ+ K  G++  + K+ + ++     T+G  FF VK+     N     L+ I+K  V  ++ +TKE++  +P T +  +++  + F +  G        + +T+ G K+  L+  Y
Sbjct: 1612 DDSDQAFEVDSGTKAKEFCNIIAQRLGLKSAEGFSLFVKITD----KVISVPEGDF---FFDFVRHLTEWLKKA--------GPTKDGRTPNLTYQVFFMKKLW--TNTVVGKDPAADCIFHYHQELPKYLRGYHKCIKEEAAQLAALIYRVKFGE---DKSQFQNIPRMVKELIPHDLVKQMSPDEWKRAIVAQFNKHPGRTKSEAKISFLKIIYRWPTFGSAFFEVKQGTEP-NFPDNLLIAINKSGVNLINPQTKEILATYPFTKISNWSSGNTYFHMTIGSLVKGSKLLCETSLGYKMDDLLTSY 1899          
BLAST of Talin vs. Ensembl Nematostella
Match: EDO38965 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBA4])

HSP 1 Score: 52.7582 bits (125), Expect = 1.849e-6
Identity = 37/148 (25.00%), Postives = 70/148 (47.30%), Query Frame = 3
Query:  639 LLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLP----KEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGIS 1070
            +LL    FF    +  ++P+ + L ++Q +  I  G+   + E   +LAG   QA  G+    +A          LP    KE+      ++K++ +Y+   G++  +  V Y  + +SL TYG+ ++ VK+K       +P  +G+S
Sbjct:   74 ILLFAVRFFVPNILILKEPVTVELFFLQARALIFKGSIQCDTETVFELAGYVLQAVYGDFTSVEATKQDLKKIAVLPTRTLKEHPSISYCEEKVLTRYKLCVGQTKGEAIVRYLCIFQSLPTYGVHYYEVKDK-----GSIPWWLGLS 216          
BLAST of Talin vs. Ensembl Medaka
Match: tln2a (talin-2 [Source:NCBI gene;Acc:101173776])

HSP 1 Score: 982.63 bits (2539), Expect = 0.000e+0
Identity = 845/2767 (30.54%), Postives = 1435/2767 (51.86%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGN-LIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNL-THSALTLLAKQLNESHDCMLMTGLQLIAEV--PNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSD--VNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQL--SLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQDLMENVSSL-KIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKI-VEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE---HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            +L+I +   N   +++ +  T +YD CR +  R+P+ +     ++GLF+SD D  +  WL++ + + YY L  GD   +L +K + R   I+ +D   KT+ VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +   T TLK+ +T +RD  K+EK+K KL TDD+LNWL H +T R+ G+D+ + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A + AGIQ Q + G+    K K    +LKEFLPKEY+K +G +KKI  +++     ++ + KV Y +L RSL+TYG++FFLVKEK+++KNKLVPRL+GI+KE VMRVDEKTK+++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K+ ++   F        E  S+A    LP     GV+  G +G+ + + +       Q     Q  +  +  LS  ++ALM  I  +++ ++ A  DL +   +  LG D +S+ + +  +D +K  +   + ++T  T +++ +   D     + DY  +  AI TI  N  ++ + ++ +  +     E+D+ GGN L++AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L+  AK +AN  + +V  +K  +VA +  + T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV++ IQ      E   ++ +Q+    +++ +++  L QH  +   T+  +P+          ++ +E +  ++G++ EMV QA++LA+A ++L + +             S + + +D D  ++L+ AA+ L DA  ++V A K      E   + QQ L +AA  +    +  A   I+++L   LE A +Q A  A Q + ++Q AA + +  A++ Q+    + + + + P+++      +  P D +AQ  L+ A Q  +Q   +++ S+++  P V D +    L    +N  T LA+L+   Q+A     P  + +        +QTL S +  A  +    +L PLPGE++E  +  +GS+SK+      +L       N + +       G+      +A+E  ++++ L + ARG+AA  +   ++  + +   DV++    +I   +  +    ++   A +   L +    +   ++  V  +P  +++D     LKS  E   K +++  P    AN  KS  + Q+E     A  NQ+ G+++ +   + S L + + + +   D  L  G+++       ++Q Q+ S LK++S  S+       LL A S S D      K  L  AA  V+DSIN L++ C    P  Q+ C+++ R+LEA++  L  + PS P+N+ SY  C++SV E S+ L   M  I   CK  D   F  ++   S +   + ++  QA+Y +G+   N+       V +PI  +    A  M+  C ++    +S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S EN    + A   ++  VE LT  A     +NP   ++  Q    G  AQ  I Q++  M++ S  LL+ A +L  + K  P       + +T    +  L   ++  APGQRE     + + + +R++++A++   S       N  S D I+ +  + QL  +++++ + I P+    + + +   LG  V +   Y  P+ ++S  +A  L   + +   ++ TKT+ E+ L M+   +E       ++  D +   + L K   DD+M  ++  AS  G +  M+ SI ++ A+L E     P D  S        +K           +K I+VT   ++  TK + + ++   L+            ++  DY  L   V   ++S     ++   ++K  V  +G  C+ L++            + ++E I   R+   +++ ++  LQ+ ++GTQ CI AA++V+ ++ADLDT I+F      +   +N+END+    S A  +E+I K  K+LV D + +V      QE LA A  ++ +   QL   VK  A +IGS+                Q +L+NAV+DVA AL +  + TK       D +     LKS+ + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++             ++  Y               K  + E  + MTK + +A+ KA+AA  + +QEDI+  AN+ RKAI+D++   +                 F    P VS       E V+  +++  VE   G ++ L  +   L +   E       K Q+  +S+R+A ++ E+  +A  +K +   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K D  E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT +L ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQ AG+AVK+A++ LV+ A +    +  +D  +  T        V  +  +I AQ +++ KERELE  R K   IRQ      P
Sbjct:    5 SLKICVRQCNVVKTMQFEPSTAIYDACRIIRDRVPEAQTGQASDYGLFLSDEDPRKGIWLESGRTLDYYMLRNGD---ILEYKKKQRPQKIKMLDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQETVEEKKEDGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGIQAQIQFGSHIEHKHKPGFLDLKEFLPKEYIKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQF--NRVGRVEHGSVA----LP-----GVIRSGSIGT-ESLTLGTMPSPQQQITMGQMHRGHMPPLSSAQQALMGTINTSMQAVQKAQIDLGEVDNLPPLGQDMASKVWIQNKMDESKHEIHSQVDAITAGTASVVNLTAGDP---TDTDYTAVGCAITTISSNLTEMSKGVKLLAALM----EDDVGGGNDLMKAARTLAGAVSDLLKAVEPASGE-----------------PRQTVLTAAGSIGQASGDLLRQIGENE---TDERFQ--DVLMNLAKAVANAAAMLV--LKAKNVA-QVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVESCIQACLSATEDGELL-KQVSAAASVVSQALADLLQH--VRQYTSRGEPIGRYDQATDTIMTVTESIFISMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKLINRLENAAKQAAAAATQTIAAAQNAAASNKNTAAHQQLVQSCKAVADHI-PQLVQGVRSSQAKPEDLSAQLALIIASQNFLQPGSKMVTSAKSSVPTVTDQAAAMQLGQCAKNLATCLAELRTAAQKAHEACGPMEIDSALTA----IQTLRSELQDAKLAATTTQLKPLPGESLEKCAQDLGSTSKSVGSSMAQLLTCAAQGNEHFT-------GI------AARETAQALKTLAQAARGVAASITDPKASAAMLDSARDVMEGSALLIHEAKQAL----ISPADAESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDM---ALKSIGEASKKLLMDAIP---PAN--KSFQEAQNELNQTAADLNQSAGEVVTATRGSSSQLAVASGKFSHDFDEFLDAGIEMAGHTQKKDDQVQVISNLKNISMASS-----KLLLAAKSLSVDPAAANAKNLLAAAARAVTDSINQLITLCTQQAP-GQKECDNALRELEAVRGML--DNPSEPVNDLSYFDCIESVMENSKVLGESMAGISQNCKISDVTAFGDSVGSASKALCGLTEAAGQASYLVGVSDPNSQAGHQGLV-DPIQFAKANQAIQMA--CQNLVDPESSPSQVLSAATIVAKHTSALCNACRLASSKTTNPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENRSRCQVATTPLIEAVENLTTFA-----SNPEFASVPAQISNEGSAAQEPIIQSARSMLDSSTLLLKTARSLALNPKDPPTWSVLAGHSRTVSDSIKSLITAIRDKAPGQRECDSSIDNINKCIRDIEQASLAVVS------QNLPSRDDISLEALQEQLTSTVQEIGHLIDPVST--AARGEASQLGHKVTQLAGYFEPLIKASVGVASKLNDHQQQMTFLDQTKTLAESALQMLYAAKEGGGNPKASHTHDAIAEAAQLMKEAVDDIMVTLNEAASEVGMVGGMVESIAEAMAKLDE--GTPPEDEGSFVDYQTSMVKH----------SKAIAVT--AQEMMTKSVTSPDELGALA-----------SQVTVDYSQL--AVQGRLASHTAEPEEIGFQIKTRVQELGHGCIYLVQKAGALQISPTDSFTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAASAVSGIIADLDTTIMF-----ASAGTLNAENDE----SFADHRENILKTAKALVEDTKMLVSGAASGQERLAQAAQSSAKTITQLTDVVKLGAASIGSDDP------------ETQVVLINAVKDVAKALAELISATKCAAGKAAD-DPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQEMALFQS-------------KDSPY---------------KTTTPEEFIRMTKGITMATAKAVAAGNSARQEDIIHTANLSRKAISDMLTTCK--------------QAAFH---PEVS-------EDVRTRALRFGVECTTGYIELLEQVLLVLLRPSPE------QKQQLAASSKRVACAVTELIHTAEAMKGSEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKAD--ETLNFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIPANAV---DDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQVAGNAVKKASDNLVRAAQKAAFDKADEDNVVVKT------KFVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQQQYKFLP 2533          
BLAST of Talin vs. Ensembl Medaka
Match: tln1 (talin 1 [Source:NCBI gene;Acc:101157630])

HSP 1 Score: 981.474 bits (2536), Expect = 0.000e+0
Identity = 855/2775 (30.81%), Postives = 1423/2775 (51.28%), Query Frame = 3
Query:   69 MHTLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTM-TLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDS--KIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEAS-RLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAH----QDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLN-NYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIR---AVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLIN-SNLTHSALTLLAKQLNESHDCMLMTGLQL--IAEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRE-----LATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG-VLNTVEQLTQIAKYTPITNPAVKT----ITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQDLM-ENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGE--DKLKKCVVAVGQSCMDLI------------RYDQKEFIGQVR---SRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSN---LKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSD---KIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKE---NSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHR-DVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            M  L + I   N   +++ +  T+VYD CR + +R+P+ +     ++GLF+SD D  +  WL+  K + YY L  GD    L +K + R L IR +D T KT+ VDDSK ++++++ IC ++GI+N++EYSL++++ E ++ +T  TLK+ KT +RD  K+EK+KQKL TDDELNWL HG+TLR+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A + AG QCQ + G+    K KS   +LKEFLPKEY+K KG +KKI   ++     ++ + KV Y +L RSLKTYG++FFLVKEK++ KNKLVPRL+GI+KE VMRVDEKTKE+IQ W LT ++R+AA+   F+LDFGDY D  Y +QTTEGE+IAQLI GYIDII+KK+K+KD+   + +EE+ M+E++V+P K+ V+   F          N +  +      G + + +  R G+  P + +  S  +  Q   + Q  +  +  L+  ++AL   I  +++ ++AA   L+    +  LG D +S+ +RK  +D +K  +   + ++T  T +++ +   D       DY  +  A+ TI  N  ++ + ++ +  +    ++E  NG  L+ AAK L  A  D+L  ++P N E                   + L++A   VG+ S  LL HI        +D + Q ++ L+  AK +AN  +    ++K  +VA K T+ +  Q  +I AA     +TS L++  +VVA +I  P+ Q+QL  +++ V  SV+  +   Q       ++ +Q+      + +++++L QH+   +   H          + L+ +E + +++G++ EMV QA+ILA+A ++L + +   A  +S            D +  R+L+ AA+ L DA  K+V A K      + + E QQ L +AA  +    +  A   I++RL   LE A +Q A  A Q + ++Q AA T +   +  Q+    + + E + P+++      +  P  P+AQ  L+NA Q  +Q   +++ +++A  P + D +    L+   +N  ++LA+L+   Q+A        + N   +    ++ L   +  A  S   G+L PLPGET+   S  + +++KA +    +L +     + NY         G+      SA+++ ++++ L+  ARG+AA    TD        +  V+DC   ++    ++I+  K A  +   A +   L +    M + ++  V  +P  +++D   + +++  E     + ++ P     +  KS  ++Q++     A  NQ+  +++  S  T   L     +  +     L  G+ +   ++   +Q Q+ S LK++S +S+ LL   K L   S S ++      L  AA  V+DSIN L++ C    P  Q+ C+++ R+LE++K  L  E P+  +N+ S+ +C+ SV E S+ L   M  I    K  +  +F  ++   S +   + +   QA Y +G+   N      ST     L    Q A   +   I MA  N  +  C +      AT +    S++C   +   + +S+   + + + + K VA  T NL+K+I +   + S EN E  KA  G ++  V+ LT  A     +NP   +    I+ +G  A   I  A+  M+E S  L++ A +L  + K  P       + +T    + +L   ++  APGQRE  +  E L   +R +D+A++       S  +  + + S+ +  ++M  S+ ++ N I P+   ++ +S+   LG  V +  SY  P+  ++   A  +  S+ +  V++ TKT+ E+ L M+   +E        + Q+ + E+V  +K   DDL   +   AS  G +  M+ +I  +  ++ +++    LD    H   F     +    T     K I+VT    +E   +   N D          D+     +L +++ +L           A   ++ E    +KK V  +G +C  L+             + +KE I   R    +++ ++  LQ+ +RGTQ CI AA++V+ ++ADLDT I+F          ++ EN +    + A  +E I K  K+LV D + +V      QE LA A  ++V    +L   VK  A ++GS            E    Q +L+NAV+DVA AL +  + TK    A   K  D  +   LK+S + MV +V  L+K+VK++ED   +GTRALE ++E +++E                                 V  SSD   K  S E+ + MTK + +A+ KA+AA  + +QEDI+  AN+ R+AI D++           KE    P         + +D  RR +    E     + ++EH    V  +I             K +   K Q+   S+R+A S+ E+ ++A  +K T   D EDP     IAENELL AA+ IE AAKK+  L+PR +  K+  E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT NL ++A + VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+T +RLQAAG+AVKRA++ LVK A +   D +D             MV  +  +I AQ +++ KE+ELE  R +   IRQ
Sbjct:    1 MVALSLKIGVGNVVKTMQFEPSTMVYDACRIIRERVPEAQLGQPNDYGLFLSDEDPKKGIWLEAGKALDYYMLRNGD---TLDYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIGITNYDEYSLVHDIGEEKKEETTGTLKKDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTLREQGVEETEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGDHNESKHKSGFLDLKEFLPKEYIKNKG-EKKIFQAHKNCQNMTEIEAKVSYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGMEGDEESTMLEDSVSPKKSTVLQQQF----------NKMGKV----ETGSVALPAIMRSGAGGPESFQMGSMPQAKQHITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQASLEDFDTLPPLGTDAASQAWRKNKMDESKHEIHSQVDAITAGTASMVNLTAGDP---AETDYTAVGCAVTTISSNLTEMSKGVKLLAAL---MEDEGGNGQLLLGAAKNLACAVSDMLKTAQPANTE-----------------PRQNLLQAAGNVGQTSGELLSHI------GETDTDPQFQEMLMQLAKAVANAAA--ALVLKAKNVAQK-TEDSAQQNRVIAAATQCALSTSQLVACTRVVAPTISSPVCQEQLIEASKLVAKSVEGCVGASQSATNDEGLL-KQVGVAATGVTQTLNELLQHIKQYASGGHPIGRHGEATDRILNVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKMDAEGES------------DLENSRKLLSAAKLLADATAKMVEAAKGAAANPD-SEEQQQKLREAAEGLRMATNAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASTNKNQGAQQQLVQSCKVVAEQI-PQLVQGVRGSQSQPDSPSAQLALINASQNFLQPGAKMVTAAKATVPTISDQASAMQLSQCAKNLASALAELRTASQKAQDACGQLEIDNALVM----VRDLEKDIQEAKASAREGKLKPLPGETLGKCSQDLSTNTKAVTSAIAQLLSEATQGDENYA--------GI------SARDMAQTLKSLVSAARGVAA---STDDP----AARGAVLDCAGDVLDKSANLIEEAKRAIAKPGDAESQQRLAQVAKAMSQALNRCVNCLPGQRDVD---NAIRTVGEASKTLLADSFP-----SSGKSFQELQAQLNEVAAGLNQSANEVVQASRGTTQDLAKATSKFGQDFSNFLDAGVDMAGTSQSKEDQTQVVSNLKTISMSSSKLLLAAKALSTDSSSPNLK---NQLAAAARAVTDSINQLITMCTQQAP-GQKECDNALRELESVKGML--ENPTEAVNDLSFFECIDSVMENSKVLGESMAGISHNAKNSNLPEFGDSVSAASKALCGLTEGAAQAAYLVGVSDPN------STAGQKGLVDPTQFAR--ANQSIQMACQNLVDPACTQSQVLSAATIVAKHTSALCNACRLASSQTSNAVAKRQFVQSAKEVANTTANLVKSIKALDGAFSQENREKCKAATGPLIEAVDNLTAFA-----SNPEFASIPAHISPEGHAAMEPIVAAAQTMLESSTGLIQTARSLAVNPKDPPTWSVLAGHSRTVSDSIKKLITNMREKAPGQRECDDAIEVLNGCIREVDQASLAAI----SQHLTPREDISMETLHEQMAASVHEISNLIDPV--AVAARSEASQLGHKVSQMASYFEPLIMAAIGTASKILSSQQQMAVLDQTKTLAESALQMLYTAKEAGGNPKAAHMQEAVEESVQMMKEAVDDLGATLADAASAAGAVGGMVDTINDAINKMEDSHT---LD----HDGTF-----VDYQTTMVKTAKAIAVTV---QEMVTKSNTNPD----------DLGGLANQLTNNFGNLANEA----KYAALTAENDEIGSHIKKQVGELGFTCTGLVTKAGALQCSPNDTFTKKELIESARKVSEKVSHVLASLQAGNRGTQACITAASAVSGIIADLDTTIMF-----ATAGTLHRENAE----TFADHRECILKTAKALVEDTKLLVSGAGASQEKLAQAAQSSVSTITKLAEVVKLGAASLGS------------EDPETQVVLINAVKDVAKALSNLISATK----AAAGKPHDDPSMLQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATIEHIKQEL-------------------------------TVFCSSDPPAKTTSPEDFIRMTKGITMATAKAVAAGNSCRQEDIIATANLSRRAIADMLR--------SCKEAAYHPE--------VNADVRRRALRFGNECATGYLGLLEH----VLVIIQ------------KPSHDLKQQLATYSKRVAGSVTELIQAAEAMKGTEWVDPEDPT---VIAENELLGAAAAIEAAAKKLEQLRPR-TKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAV---DDGQWSQGLISAARMVAAATNNLCEAANSAVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSQTMKRLQAAGNAVKRASDNLVKAAQKAAFDAEDDQAVVV----KSKMVGGIAQIIAAQEEMLRKEKELEEARKRLAMIRQ 2524          
BLAST of Talin vs. Ensembl Medaka
Match: tln2a (talin-2 [Source:NCBI gene;Acc:101173776])

HSP 1 Score: 980.319 bits (2533), Expect = 0.000e+0
Identity = 844/2767 (30.50%), Postives = 1435/2767 (51.86%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGN-LIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNL-THSALTLLAKQLNESHDCMLMTGLQLIAEV--PNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSD--VNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQL--SLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQDLMENVSSL-KIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKI-VEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE---HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHP 8228
            +L+I +   N   +++ +  T +YD CR +  R+P+ +     ++GLF+SD D  +  WL++ + + YY L  GD   +L +K + R   I+ +D   KT+ VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +   T TLK+ +T +RD  K+EK+K KL TDD+LNWL H +T R+ G+D+ + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A + AGIQ Q + G+    K K    +LKEFLPKEY+K +G +KKI  +++     ++ + KV Y +L RSL+TYG++FFLVKEK+++KNKLVPRL+GI+KE VMRVDEKTK+++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K+ ++   F        E  S+A    LP     GV+  G +G+ + + +       Q     Q  +  +  LS  ++ALM  I  +++ ++ A  DL +   +  LG D +S+ + +  +D +K  +   + ++T  T +++ +   D     + DY  +  AI TI  N  ++ + ++ +  +     E+D+ GGN L++AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L+  AK +AN  + +V  +K  +VA +  + T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV++ IQ      E   ++ +Q+    +++ +++  L QH  +   T+  +P+          ++ +E +  ++G++ EMV QA++LA+A ++L + +             S + + +D D  ++L+ AA+ L DA  ++V A K      E   + QQ L +AA  +    +  A   I+++L   LE A +Q A  A Q + ++Q AA + +  A++ Q+    + + + + P+++      +  P D +AQ  L+ A Q  +Q   +++ S+++  P V D +    L    +N  T LA+L+   Q+A     P  + +        +QTL S +  A  +    +L PLPGE++E  +  +GS+SK+      +L       N + +       G+      +A+E  ++++ L + ARG+AA  +   ++  + +   DV++    +I   +  +    ++   A +   L +    +   ++  V  +P  +++D     LKS  E   K +++  P    AN  KS  + Q+E     A  NQ+ G+++ +   + S L + + + +   D  L  G+++       ++Q Q+ S LK++S  S+       LL A S S D      K  L  AA  V+DSIN L++ C    P  Q+ C+++ R+LEA++  L  + PS P+N+ SY  C++SV E S+ L   M  I   CK  D   F  ++   S +   + ++  QA+Y +G+   N+       V +PI  +    A  M+  C ++    +S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S EN    + A   ++  VE LT  A     +NP   ++  Q    G  AQ  I Q++  M++ S  LL+ A +L  + K  P       + +T    +  L   ++  APGQRE     + + + +R++++A++   S       N  S D I+ +  + QL  +++++ + I P+    + + +   LG  V +   Y  P+ ++S  +A  L   + +   ++ TKT+ E+ L M+   +E       ++  D +   + L K   DD+M  ++  AS  G +  M+ SI ++ A+L E     P D  S        +K           +K I+VT   ++  TK + + ++   L+            ++  DY  L   V   ++S     ++   ++K  V  +G  C+ L++            + ++E I   R+   +++ ++  LQ+ ++GTQ CI AA++V+ ++ADLDT I+F      +   +N+END+    S A  +E+I K  K+LV D + +V      QE LA A  ++ +   QL   VK  A +IGS+                Q +L+NAV+DVA AL +  + TK       D +     LKS+ + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++             ++  Y               K  + E  + MTK + +A+ KA+AA  + +QEDI+  AN+ RKAI+D++   +                 F    P VS       E V+  +++  VE   G ++ L  +   L +   E       K Q+  +S+R+A ++ E+  +A  +K +   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT +L ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQ AG+AVK+A++ LV+ A +    +  +D  +  T        V  +  +I AQ +++ KERELE  R K   IRQ      P
Sbjct:    5 SLKICVRQCNVVKTMQFEPSTAIYDACRIIRDRVPEAQTGQASDYGLFLSDEDPRKGIWLESGRTLDYYMLRNGD---ILEYKKKQRPQKIKMLDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQETVEEKKEDGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGIQAQIQFGSHIEHKHKPGFLDLKEFLPKEYIKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQF--NRVGRVEHGSVA----LP-----GVIRSGSIGT-ESLTLGTMPSPQQQITMGQMHRGHMPPLSSAQQALMGTINTSMQAVQKAQIDLGEVDNLPPLGQDMASKVWIQNKMDESKHEIHSQVDAITAGTASVVNLTAGDP---TDTDYTAVGCAITTISSNLTEMSKGVKLLAALM----EDDVGGGNDLMKAARTLAGAVSDLLKAVEPASGE-----------------PRQTVLTAAGSIGQASGDLLRQIGENE---TDERFQ--DVLMNLAKAVANAAAMLV--LKAKNVA-QVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVESCIQACLSATEDGELL-KQVSAAASVVSQALADLLQH--VRQYTSRGEPIGRYDQATDTIMTVTESIFISMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKLINRLENAAKQAAAAATQTIAAAQNAAASNKNTAAHQQLVQSCKAVADHI-PQLVQGVRSSQAKPEDLSAQLALIIASQNFLQPGSKMVTSAKSSVPTVTDQAAAMQLGQCAKNLATCLAELRTAAQKAHEACGPMEIDSALTA----IQTLRSELQDAKLAATTTQLKPLPGESLEKCAQDLGSTSKSVGSSMAQLLTCAAQGNEHFT-------GI------AARETAQALKTLAQAARGVAASITDPKASAAMLDSARDVMEGSALLIHEAKQAL----ISPADAESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDM---ALKSIGEASKKLLMDAIP---PAN--KSFQEAQNELNQTAADLNQSAGEVVTATRGSSSQLAVASGKFSHDFDEFLDAGIEMAGHTQKKDDQVQVISNLKNISMASS-----KLLLAAKSLSVDPAAANAKNLLAAAARAVTDSINQLITLCTQQAP-GQKECDNALRELEAVRGML--DNPSEPVNDLSYFDCIESVMENSKVLGESMAGISQNCKISDVTAFGDSVGSASKALCGLTEAAGQASYLVGVSDPNSQAGHQGLV-DPIQFAKANQAIQMA--CQNLVDPESSPSQVLSAATIVAKHTSALCNACRLASSKTTNPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENRSRCQVATTPLIEAVENLTTFA-----SNPEFASVPAQISNEGSAAQEPIIQSARSMLDSSTLLLKTARSLALNPKDPPTWSVLAGHSRTVSDSIKSLITAIRDKAPGQRECDSSIDNINKCIRDIEQASLAVVS------QNLPSRDDISLEALQEQLTSTVQEIGHLIDPVST--AARGEASQLGHKVTQLAGYFEPLIKASVGVASKLNDHQQQMTFLDQTKTLAESALQMLYAAKEGGGNPKASHTHDAIAEAAQLMKEAVDDIMVTLNEAASEVGMVGGMVESIAEAMAKLDE--GTPPEDEGSFVDYQTSMVKH----------SKAIAVT--AQEMMTKSVTSPDELGALA-----------SQVTVDYSQL--AVQGRLASHTAEPEEIGFQIKTRVQELGHGCIYLVQKAGALQISPTDSFTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAASAVSGIIADLDTTIMF-----ASAGTLNAENDE----SFADHRENILKTAKALVEDTKMLVSGAASGQERLAQAAQSSAKTITQLTDVVKLGAASIGSDDP------------ETQVVLINAVKDVAKALAELISATKCAAGKAAD-DPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQEMALFQS-------------KDSPY---------------KTTTPEEFIRMTKGITMATAKAVAAGNSARQEDIIHTANLSRKAISDMLTTCK--------------QAAFH---PEVS-------EDVRTRALRFGVECTTGYIELLEQVLLVLLRPSPE------QKQQLAASSKRVACAVTELIHTAEAMKGSEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADETLNFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIPANAV---DDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQVAGNAVKKASDNLVRAAQKAAFDKADEDNVVVKT------KFVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQQQYKFLP 2534          
BLAST of Talin vs. Ensembl Medaka
Match: tln2a (talin-2 [Source:NCBI gene;Acc:101173776])

HSP 1 Score: 923.309 bits (2385), Expect = 0.000e+0
Identity = 816/2667 (30.60%), Postives = 1383/2667 (51.86%), Query Frame = 3
Query:  348 MDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGN-LIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPL------VTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNL-THSALTLLAKQLNESHDCMLMTGLQLIAEV--PNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSD--VNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQ----GRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQL--SLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV---QECETLSTTTNNQDLMENVSSL-KIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKI-VEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLK--PSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATE---HRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQ 8207
            +D   KT+ VDDSK++ EL++ IC+++GI+N+EEYSLI E ++E +   T TLK+ +T +RD  K+EK+K KL TDD+LNWL H +T R+ G+D+ + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ I++G+HPV+ ++A + AGIQ Q + G+    K K    +LKEFLPKEY+K +G +KKI  +++     ++ + KV Y +L RSL+TYG++FFLVKEK+++KNKLVPRL+GI+KE VMRVDEKTK+++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD    + +EE+ M+EE+V+P K+ ++   F        E  S+A    LP     GV+  G +G+ + + +       Q     Q  +  +  LS  ++ALM  I  +++ ++ A  DL +   +  LG D +S+ + +  +D +K  +   + ++T  T +++ +   D     + DY  +  AI TI  N  ++ + ++ +  +     E+D+ GGN L++AA+TL  A  DLL A +P + E                   + ++ A   +G+AS  LL  I   +   +D  +Q  D L+  AK +AN  + +V  +K  +VA +  + T  Q  +I AA     +TS L++ AKVV+ +I  P+ Q+QL  + + V  SV++ IQ      E   ++ +Q+    +++ +++  L QH  +   T+  +P+          ++ +E +  ++G++ EMV QA++LA+A ++L + +             S + + +D D  ++L+ AA+ L DA  ++V A K      E   + QQ L +AA  +    +  A   I+++L   LE A +Q A  A Q + ++Q AA + +  A++ Q+    + + + + P+++      +  P D +AQ  L+ A Q  +Q   +++ S+++  P V D +    L    +N  T LA+L+   Q+A     P  + +        +QTL S +  A  +    +L PLPGE++E  +  +GS+SK+      +L       N + +       G+      +A+E  ++++ L + ARG+AA  +   ++  + +   DV++    +I   +  +    ++   A +   L +    +   ++  V  +P  +++D     LKS  E   K +++  P    AN  KS  + Q+E     A  NQ+ G+++ +   + S L + + + +   D  L  G+++       ++Q Q+ S LK++S  S+       LL A S S D      K  L  AA  V+DSIN L++ C    P  Q+ C+++ R+LEA++  L  + PS P+N+ SY  C++SV E S+ L   M  I   CK  D   F  ++   S +   + ++  QA+Y +G+   N+       V +PI  +    A  M+  C ++    +S       AT +    S++C   +   + +++P  +   + + K VA +T NL+KTI +     S EN    + A   ++  VE LT  A     +NP   ++  Q    G  AQ  I Q++  M++ S  LL+ A +L  + K  P       + +T    +  L   ++  APGQRE     + + + +R++++A++   S       N  S D I+ +  + QL  +++++ + I P+    + + +   LG  V +   Y  P+ ++S  +A  L   + +   ++ TKT+ E+ L M+   +E       ++  D +   + L K   DD+M  ++  AS  G +  M+ SI ++ A+L E     P D  S        +K           +K I+VT   ++  TK + + ++   L+            ++  DY  L   V   ++S     ++   ++K  V  +G  C+ L++            + ++E I   R+   +++ ++  LQ+ ++GTQ CI AA++V+ ++ADLDT I+F      +   +N+END+    S A  +E+I K  K+LV D + +V      QE LA A  ++ +   QL   VK  A +IGS+                Q +L+NAV+DVA AL +  + TK       D +     LKS+ + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++             ++  Y               K  + E  + MTK + +A+ KA+AA  + +QEDI+  AN+ RKAI+D++   +                 F    P VS       E V+  +++  VE   G ++ L  +   L +   E       K Q+  +S+R+A ++ E+  +A  +K +   D EDP     IAE ELL AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++   P+  +   ++ QWS GLISAAR+VAAAT +L ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQ AG+AVK+A++ LV+ A +    +  +D  +  T        V  +  +I AQ +++ KERELE  R K   IRQ
Sbjct:    2 LDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQETVEEKKEDGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGIQAQIQFGSHIEHKHKPGFLDLKEFLPKEYIKQRGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQF--NRVGRVEHGSVA----LP-----GVIRSGSIGT-ESLTLGTMPSPQQQITMGQMHRGHMPPLSSAQQALMGTINTSMQAVQKAQIDLGEVDNLPPLGQDMASKVWIQNKMDESKHEIHSQVDAITAGTASVVNLTAGDP---TDTDYTAVGCAITTISSNLTEMSKGVKLLAALM----EDDVGGGNDLMKAARTLAGAVSDLLKAVEPASGE-----------------PRQTVLTAAGSIGQASGDLLRQIGENE---TDERFQ--DVLMNLAKAVANAAAMLV--LKAKNVA-QVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVESCIQACLSATEDGELL-KQVSAAASVVSQALADLLQH--VRQYTSRGEPIGRYDQATDTIMTVTESIFISMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKLINRLENAAKQAAAAATQTIAAAQNAAASNKNTAAHQQLVQSCKAVADHI-PQLVQGVRSSQAKPEDLSAQLALIIASQNFLQPGSKMVTSAKSSVPTVTDQAAAMQLGQCAKNLATCLAELRTAAQKAHEACGPMEIDSALTA----IQTLRSELQDAKLAATTTQLKPLPGESLEKCAQDLGSTSKSVGSSMAQLLTCAAQGNEHFT-------GI------AARETAQALKTLAQAARGVAASITDPKASAAMLDSARDVMEGSALLIHEAKQAL----ISPADAESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDM---ALKSIGEASKKLLMDAIP---PAN--KSFQEAQNELNQTAADLNQSAGEVVTATRGSSSQLAVASGKFSHDFDEFLDAGIEMAGHTQKKDDQVQVISNLKNISMASS-----KLLLAAKSLSVDPAAANAKNLLAAAARAVTDSINQLITLCTQQAP-GQKECDNALRELEAVRGML--DNPSEPVNDLSYFDCIESVMENSKVLGESMAGISQNCKISDVTAFGDSVGSASKALCGLTEAAGQASYLVGVSDPNSQAGHQGLV-DPIQFAKANQAIQMA--CQNLVDPESSPSQVLSAATIVAKHTSALCNACRLASSKTTNPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENRSRCQVATTPLIEAVENLTTFA-----SNPEFASVPAQISNEGSAAQEPIIQSARSMLDSSTLLLKTARSLALNPKDPPTWSVLAGHSRTVSDSIKSLITAIRDKAPGQRECDSSIDNINKCIRDIEQASLAVVS------QNLPSRDDISLEALQEQLTSTVQEIGHLIDPVST--AARGEASQLGHKVTQLAGYFEPLIKASVGVASKLNDHQQQMTFLDQTKTLAESALQMLYAAKEGGGNPKASHTHDAIAEAAQLMKEAVDDIMVTLNEAASEVGMVGGMVESIAEAMAKLDE--GTPPEDEGSFVDYQTSMVKH----------SKAIAVT--AQEMMTKSVTSPDELGALA-----------SQVTVDYSQL--AVQGRLASHTAEPEEIGFQIKTRVQELGHGCIYLVQKAGALQISPTDSFTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAASAVSGIIADLDTTIMF-----ASAGTLNAENDE----SFADHRENILKTAKALVEDTKMLVSGAASGQERLAQAAQSSAKTITQLTDVVKLGAASIGSDDP------------ETQVVLINAVKDVAKALAELISATKCAAGKAAD-DPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQEMALFQS-------------KDSPY---------------KTTTPEEFIRMTKGITMATAKAVAAGNSARQEDIIHTANLSRKAISDMLTTCK--------------QAAFH---PEVS-------EDVRTRALRFGVECTTGYIELLEQVLLVLLRPSPE------QKQQLAASSKRVACAVTELIHTAEAMKGSEWVDPEDPT---VIAETELLGAAASIEAAAKKLEQLKPRAKPKQ-ADETLNFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIPANAV---DDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQVAGNAVKKASDNLVRAAQKAAFDKADEDNVVVKT------KFVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQ 2434          
BLAST of Talin vs. Ensembl Medaka
Match: tln2b (talin 2 [Source:NCBI gene;Acc:101167954])

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 550/1881 (29.24%), Postives = 983/1881 (52.26%), Query Frame = 3
Query:   75 TLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTM-TLKRGKTQI-RDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASR-LLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHL----IINSITAHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTR--ASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNL-THSALTLLAKQLNESHDCMLMTGLQLIAEVPNNQQ--QLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHA-SVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTK-ACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMV 5675
            +L+I +   N   +++ +  T VYD CR + +R+P+ +     ++GLF+SD D  +  WL++ + + YY L + + +L +K + R   I+ +D T KT+ VDDSK++ EL++ IC+++GI+N+EEYS+I EL E+++   + TL++ +T + RD  K+EK+K KL TDD+LNWL H +T R+ G++E + LLLRRK+F+SDQNVD+RDP+QLNLLYVQ ++ II+G+HPV+ ++A + AGIQ Q + G     K K    +LKEFLPKEY+K +G +KK+  +++     ++ + KV Y +L RSL+TYG++FFLVKEK++ KNKLVPRL+GI+KE VMRVDEKTK+++Q WPLTTV+R+AA+   F+LDFG+Y +  Y +QTTEGE+I+QLI GYIDII+KK+++KD+   + +EE+ M+EE+V+P ++ ++   F        E  S+A    LP     G++  G +G      +       Q     Q  K  +  LS  ++ALM  I  +++ ++ A  DL     +  LG+D +SR + +  +D +K  +   + ++T  T +++ +   +       DY  +  AI TI  N  ++ + ++ +  +    D+E  +G  L+ AA+ L  A  DLL + +P   E                   + ++ A   +G+AS  LL H+   E    +D ++Q  DTL+  AK +AN  + +V  +K  +VA +  + T  Q  +I AA     +TS L++  KVV+ +I  P+ Q+QL  + + V  SV+  ++  +   +   ++ +Q+     ++ +++  L QH+             D      ++ +E +  ++G++ EMV QA++LA+A ++L + +             S + + +D D  ++L+ AA+ L DA  ++V A K      E   + QQ L +AA  +    +  A   I+++L   LE A +Q A  A Q + ++Q AA + +  AS+ Q+    + + + + P+++      +  P +   Q  L+ A Q  +Q   +++ S+++  P V D +    L    +N  T LA+L+   Q+A     P  + +        +QTL   +  A  SV   +L PLPGET+E  +  +GS+SKA      +L       N + +       G+      +A+E  +++  L + ARG+AA   +  +   + +    V++    +I      +    +    A +   L +    +   ++  V  +P  +++D     L+S  E   K +++  P       +KS  + Q++     A  N + G++++S+  T   L   + + ++  D  L  G+++     + +   Q+   LK++S  S+ LL   K L    G+++       L  AA  V++S+N L++ C +     Q+ C+++ R+LEA++   L + P+ PIN  SY  C++SV E S+ L   M  I   CKTGD   F  ++ + S +   + ++  QA+Y +G+   N S      + +PI  +    A     +N +  ASS +  +     AT +    S++C   +   + +S+P  + + + + K VA  T NL+KTI       S EN    + A   +L  VE L   A   P    A   I+ +G  AQ  I +++  M++ S  L+  A +LV + K  P+      + +T    +  L   ++  APGQRE     + + + +R++++A++   +V ++  +  + + S+ +  +++  S++++ + I P+    + + +   LG  V +  SY  P+  +S  LA  L   + +  +++ TKT+ E+ L M+
Sbjct:    5 SLKICVRQCNVVKTMQFEPSTPVYDACRIIRERVPEAQTGQASDYGLFLSDDDPRKGIWLESGRTLDYYMLRNGD-ILEYKKKQRPQKIKMLDGTIKTVMVDDSKTVGELLVTICSRIGITNYEEYSVIQELTEDKKDDGLGTLRKDRTLLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDIINGSHPVSFDKACEFAGIQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKKVFQEHKNCGEMTEIEGKVKYVKLARSLQTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDHFGLEGDEESTMLEESVSPKRSTILQQQF--NRVGRVEHGSVA----LP-----GIIRSGSIGGPDTFNMGTMPSAQQQITTGQMHKGHMPPLSLAQQALMGTINSSMQAVQQAQADLGHVDNLPPLGHDLASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAGEP---AETDYTAVGCAITTISSNLTEMSKGVKLLAAL---MDDEVGSGHKLMGAARMLAGAVSDLLRSVEPAAAE-----------------PRQTVLTAAGSIGQASGDLLRHMGEGE----TDEKFQ--DTLMNLAKAVANAAAMLV--LKAKNVA-QVAEDTTLQNRVIAAATQCALSTSQLVACTKVVSPTISSPVCQEQLVEAGKLVDRSVETCVKACRSASDDGELL-KQVAAAAGVVSQALSDLLQHVRHYASCGEPIGRYDQATDTIMNVTENIFTSMGDAGEMVRQARVLAQATSDLVNAMR------------SDAEAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENE-DQQQRLREAAEGLRVATNAAAQNAIKKKLVNRLEIAAKQAAAAATQTIAAAQNAAISNKNTASHQQLVHSCKAVADSI-PQLVQGIRSSQAQPEELGPQLTLIMASQNFLQPGSKMVSSAKSAVPTVADQAAAMQLGQCAKNLATCLAELRTATQKAHEACGPLEIDSALKT----VQTLKCELQDAKISVIDAQLKPLPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYT-------GV------AARETAQALRTLAQAARGVAACTKEPQAAAAMLDSAQCVMEGSAMLIHEAHQAL----VHPGDADSQQRLAQVAKAVSHSLNNCVNCLPGQKDVDM---ALRSIGEASKKLLVDFLPPC-----SKSFQEAQTDLNHTAAELNHSAGEVVHSSRGTSRQLAAASGKFSQDFDEFLDAGIEMAGHTQSKEDKIQVIGNLKNISMASSKLLLAAKSLSVDPGAANAK---NLLAVAARAVTESVNQLITLC-TQQAAGQKECDNALRELEAVRG--LLDNPNEPINELSYFDCIESVMENSKVLGESMAGISQHCKTGDVQAFGESVSLASKALCGLTEAAGQASYLVGVSDPN-SQSGHEGLVDPIQFARAHQAIQTACQNLVDPASSPSQVLSA---ATIVAKHTSALCNACRLASSKTSNPVARRQFVQSAKEVANTTANLVKTIKGLDGDFSEENRNRCRLATAPLLEAVENLATFAN-NPEFVSAPAQISNEGSAAQEPIVRSARSMLDSSTYLIETARSLVLNPKDPPSWSILAGHSRTVSDSIKSLITSIRDKAPGQRECDYSIDNINKCIRDIEQASL--AAVGQT--LPCRDDISMEALQEQLTSSVQEIGHLIDPVST--TARGEAAQLGHKVTQLASYFDPLIVASVGLASKLQDHQQQMTILDQTKTLSESALQML 1780          

HSP 2 Score: 280.026 bits (715), Expect = 9.190e-75
Identity = 219/628 (34.87%), Postives = 329/628 (52.39%), Query Frame = 3
Query: 6180 VGQSCMDLIR------------YDQKEFIGQVRS---RLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENW-IPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLV-------HHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQ-NETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQ 7991
            +G  C+ L++            + ++E I   RS   +++ ++  LQ+ ++GTQ CI AA++V+ ++ADLDT I+FA +G+     +N EN++    S A  +E I K  K+LV D + +V      QE LA A  ++ +   QL   VK            LG + M  E    Q +L+NAVRDVA AL +    TK       D +     LK + + MV +V  L+K+VK++ED   RGTRALE ++E +++E    ++  IP+                             K  S E  + MTK + +A+ KA+AA  + +QED++  AN+ RKAI+D++       HH  V      +E +SK  +  SE                            G +K L  + + L +   E       K Q+ + S+ +A S+ E+ ++A  +K +   D EDP     IAENEL  AA+ IE AAKK+  LKPR   K+   E   F+ QI+ A  SI +ATS LVK AS +Q+ELV+QG++    N++   ++ QWS GLISAAR+VAAAT NL ++A A VQG    ++LIS++KQVAA TA LL+AC+VK+D DS+  +RLQ
Sbjct: 1837 LGHGCIFLVQKAGALQLSPTDSFSKRELIECARSVTEKVSLVLSALQAGNKGTQACITAASAVSGIIADLDTTIMFASAGT-----LNPENEE----SFADHRESILKTAKALVEDTKLLVAGAASTQEKLAQAAHSSAKTITQLTEVVK------------LGATSMGSENPETQVVLINAVRDVAKALAELIGATKCAAGKPPD-DPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQELTVFQSKDIPE-----------------------------KSTSPEEFIRMTKGITIATAKAVAAGNSAQQEDVIATANLSRKAISDMLTTCKQAAHHPDVG-----EELRSKALQYSSECT-------------------------NGYIKLLEQVLQVLQRPTPE------QKQQLAVHSKHVAASVTELIQTAEAMKGSECVDPEDPT---VIAENELFGAAASIEAAAKKLEQLKPRAKPKQ-ADESLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKV--GSNLANAVDDGQWSQGLISAARMVAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADHDSEAMRRLQ 2371          
BLAST of Talin vs. Planmine SMEST
Match: SMESG000072542.1 (SMESG000072542.1)

HSP 1 Score: 5420.9 bits (14061), Expect = 0.000e+0
Identity = 2721/2728 (99.74%), Postives = 2724/2728 (99.85%), Query Frame = 3
Query:   69 MHTLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHPELFGGDKE 8252
            MHTLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYIDIIIKKQKAKDNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEQPLSQQQLHASAQQVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLS+AALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIAN+EDGQLQTLHSWMDTAAESVARGELYPLPGETIESVSAIIGSSSKAASKIFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLY+KQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPNNQQQLTSGLKSVSNNSTDLLDHLKLLLAASGSSDVNLLKQSLLKAASLVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEAT NLIKTINSCSRSE VENDEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKM DVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFAGSGSLALSLINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQED NSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHPELFGGDKE
Sbjct:    1 MHTLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYIDIIIKKQKAKDNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSLATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEQPLSQQQLHASAQQVIDSVDNVIQLVQPLIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPLVTKFLSASERLPAAIGNSLEMVTQAQILAEAGTELADCLSSAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANMEDGQLQTLHSWMDTAAESVARGELYPLPGETIESVSAIIGSSSKAASKIFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAALKSKTDSNENLYQKQIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSALTLLAKQLNESHDCMLMTGLQLIAEVPNNQQQLTSGLKSVSNNSTDLLDHLKLLLAASGSSDVNLLKQSLLKAASLVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATANLIKTINSCSRSELVENDEWTKACEGVLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRDRGEVIELTKTVLEAFLAMVQECETLSTTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMTDVNYPFKKLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFAGSGSLALSLINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEGEYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQEDILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDRRTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTLASRRIAHSIHEITESATQLKDTHLADQEDLNSHCAIAENELLEAASQIETAAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQQELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQGKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRATEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERELEMLRNKYQSIRQGHISTHPELFGGDKE 2728          
BLAST of Talin vs. Planmine SMEST
Match: SMESG000066444.1 (SMESG000066444.1)

HSP 1 Score: 687.952 bits (1774), Expect = 0.000e+0
Identity = 673/2401 (28.03%), Postives = 1217/2401 (50.69%), Query Frame = 3
Query:   78 LRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERM-KTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKT-KGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYS-DENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDK-NTLSFEKNSLATIGHLPN-------RGDIGVVSQ-GRVGSAQPIAI-RNDSKIGQ-----GNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQ-------HDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNS--------------ISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIE-----THSVIYQQLDETVA-MICESIDKLKQHLIINSITAHQDPLVTKFLSASERL---PAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMT-AGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPD----LNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAAL----KSKTDSNENLYEK--QIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINS---NLTHSALTLLAKQLNESHD-----CMLMTGLQL------IAEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCM-----QSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG-VLNTVEQLTQ-IAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHS----RDRGEVIELTKTVLEAFLAMVQECETL-----------STTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTD-NSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSL---VTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR-------------YDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQ-------KMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTL 6914
            LRI IV  + T  + LD +  ++ +C  + K I + +    + +GL++   D  +  WLDNSK + +Y L  GD    + +++R R L IRTMD T KTL+VDDS +++EL+L +C K+GI N++EYSLI + +D +  + KT+++K G +  +D +KL+K+K+K  T+D LNWL   ++LRQ GI+E + LLL+RKYFFSD NVD+RDPIQL+LLY QLK+A+I+GTHPV + EAI+LAG+QCQ +LGN + DK K    +L+E LPKEY K  K ++KKI  Q+ K    S+ + K  Y  LCRS KTYGITFFLVKEKV  KNKL+PRL+G++KE V++VDEKTKE+I  WPLT++R++AA+ + F++DFG+YS DE Y  QT +GE+I+QLI GYIDII+K++KAKD+L  DA+EE+ M EEN+APSKA ++ H    K +++S E   +    H+ N       +    V SQ G     + I + R  S +G+      ++      +++ D    ++  +I + DNL  ++   + L    +  ++G DE+S+ +    +D ++ R+   + +M  A   +L   Q       ++E+  + +   ++  + + I  +   L+E IR       +  +ED++G  LI AAK L +AF +L+ A+ P             +  +K + + K + +A N VGEAS  LL  I+ ++N               I++ +   ++ LL  AK +AN  + ++K VK  +V   E +    Q  ++ AA  +G A S LIS  K+VA +IE            +Q+I S+++V + +Q ++E     T S   Q L    A  + E++D L +HL  +     ++  +  FL A E +     +  +  ++V+ A+ LA+A T +   +   A+ +  +            + + RL+ AA+ L +A   L+ + K C  + ++ +  +  L +A      V + T     I++++   L  A R+ A T   L+ +S  AAK +RASN+++C++ +E++  +   +I+A  + R +P D  AQ  L+ AC+  I   EQL +S++ + P V DPS+Q+ALN S+  S  +  +LK+CV QAD + +   ++  A +E  QL+ L   + +   S+ R  L PLP E  +  +A++  S + +    ++  N+L            ++S +N+       + A+EL  ++++L+  ARG+AA       ++++N+   EK  Q+ +++   + +++  D++   K +      +D  +++  ++ + +   +  +P  +++D L   ++S    F +N +   P+ +N N   S+   +SE T     FNQ + +L+++   NL +       K++  S+D     C ++           +  + +N+  + +G+  +S +   LLD +K +     +  V    + L +A  ++ DSIN LL+  ++ L   Q+ C+ +  +LE+++  L  + P  PI++  Y +C+     ++V+ L++SL    K IP A K  ++  F  +I   + S   +L+   Q  Y +G+    + I       +    S +Q    +S+NC ++ + + +       A  I   +  +C+  K  +   S P+ + KL D  K    A   L+  + + +++ + +N +  ++  G V + V +L Q +  Y    + A+  I+E+ +++Q  I  A I +++ +  +++ + AL+    +     A+  + K  +  L  L + +K SAPGQ+E  E    L ++++    + M    +   S+  +++ +S  S    +Q +L Q+ + I               L RA  +    LA I      L + + +S     ++ ++I+ +   LE  +A+++  E L              + +  + E    +   C+DL+  +D I+   G +  ++ +I KS+A++ E+  + P       +    S   + D   D N+L  DIS       EST+R+ A      L+QN           L   YD L     G +  +S    N  +G+ +L++CV  VG+  + L++              + +    ++  R+ D++ LL S++ GTQ C  A   + E+ +D+DT+ILF          + S + QN       +KE +FK +++ V D         K+++S D    N+   +      A+Q+  A+ S +LA   N   +GL  ++         LL + ++V V+L+ F    + N +     +    NLK   +  + ++  L+K +KS++D   +  +A++ ++  +   +  L
Sbjct:   20 LRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGD---TIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKHGISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDGTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIEENEEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYP-------------VEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAV---EAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIE-------QSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRKD---FDKNDKLDNFLLAYENIQEVDDSDDDLDKLVSAARRLAQATTAMISEIQLKAVNEQYKT----------PEERDRLINAAKQLAEATTVLIDSAKNCTMDKDE-MNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQI-SNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLS--AALE--QLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDAAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRLSDALSLCLDSLPGQRDLDMLSKHIESKKHQFAENRL---PIQQNNNINLSNC--RSELTDTTFDFNQAVNELVSAPSFNLVNKG----CKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVR---KQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPIL--DNPVHPISHKDYFECLDFIIDKTVQPLADSL----KNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHT---SFLQIQKEISENCQTICNPDTTARQMISTAGQIAENSRKLCEASKTIM--ISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAI--ISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEALAILAKLIKQAYDSKMK--IMKHRSRTISRTFESEESYQNILQSALIQMPHCINE-------------LSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLIAILEASEQLLKAIKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQES-AIIP-----EKSRFGNSQSKMLDICYDMNNLTTDISSN--ANSESTQRLLAP-----LTQN-----------LTQRYDDLCRACQGAVATLS----NENNGK-QLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILF----------VKSADIQNDDREYYSVKE-LFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQES------ADQI--AITSQSLA---NDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVAR-NTSELPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIELEHNHECL 2283          
BLAST of Talin vs. Planmine SMEST
Match: SMESG000066444.1 (SMESG000066444.1)

HSP 1 Score: 687.182 bits (1772), Expect = 0.000e+0
Identity = 673/2401 (28.03%), Postives = 1217/2401 (50.69%), Query Frame = 3
Query:   78 LRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERM-KTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKT-KGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYS-DENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDK-NTLSFEKNSLATIGHLPN-------RGDIGVVSQ-GRVGSAQPIAI-RNDSKIGQ-----GNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQ-------HDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNS--------------ISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIE-----THSVIYQQLDETVA-MICESIDKLKQHLIINSITAHQDPLVTKFLSASERL---PAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMT-AGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPD----LNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAAL----KSKTDSNENLYEK--QIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINS---NLTHSALTLLAKQLNESHD-----CMLMTGLQL------IAEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCM-----QSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG-VLNTVEQLTQ-IAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHS----RDRGEVIELTKTVLEAFLAMVQECETL-----------STTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTD-NSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSL---VTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR-------------YDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQ-------KMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTL 6914
            LRI IV  + T  + LD +  ++ +C  + K I + +    + +GL++   D  +  WLDNSK + +Y L  GD    + +++R R L IRTMD T KTL+VDDS +++EL+L +C K+GI N++EYSLI + +D +  + KT+++K G +  +D +KL+K+K+K  T+D LNWL   ++LRQ GI+E + LLL+RKYFFSD NVD+RDPIQL+LLY QLK+A+I+GTHPV + EAI+LAG+QCQ +LGN + DK K    +L+E LPKEY K  K ++KKI  Q+ K    S+ + K  Y  LCRS KTYGITFFLVKEKV  KNKL+PRL+G++KE V++VDEKTKE+I  WPLT++R++AA+ + F++DFG+YS DE Y  QT +GE+I+QLI GYIDII+K++KAKD+L  DA+EE+ M EEN+APSKA ++ H    K +++S E   +    H+ N       +    V SQ G     + I + R  S +G+      ++      +++ D    ++  +I + DNL  ++   + L    +  ++G DE+S+ +    +D ++ R+   + +M  A   +L   Q       ++E+  + +   ++  + + I  +   L+E IR       +  +ED++G  LI AAK L +AF +L+ A+ P             +  +K + + K + +A N VGEAS  LL  I+ ++N               I++ +   ++ LL  AK +AN  + ++K VK  +V   E +    Q  ++ AA  +G A S LIS  K+VA +IE            +Q+I S+++V + +Q ++E     T S   Q L    A  + E++D L +HL  +     ++  +  FL A E +     +  +  ++V+ A+ LA+A T +   +   A+ +  +            + + RL+ AA+ L +A   L+ + K C  + ++ +  +  L +A      V + T     I++++   L  A R+ A T   L+ +S  AAK +RASN+++C++ +E++  +   +I+A  + R +P D  AQ  L+ AC+  I   EQL +S++ + P V DPS+Q+ALN S+  S  +  +LK+CV QAD + +   ++  A +E  QL+ L   + +   S+ R  L PLP E  +  +A++  S + +    ++  N+L            ++S +N+       + A+EL  ++++L+  ARG+AA       ++++N+   EK  Q+ +++   + +++  D++   K +      +D  +++  ++ + +   +  +P  +++D L   ++S    F +N +   P+ +N N   S+   +SE T     FNQ + +L+++   NL +       K++  S+D     C ++           +  + +N+  + +G+  +S +   LLD +K +     +  V    + L +A  ++ DSIN LL+  ++ L   Q+ C+ +  +LE+++  L  + P  PI++  Y +C+     ++V+ L++SL    K IP A K  ++  F  +I   + S   +L+   Q  Y +G+    + I       +    S +Q    +S+NC ++ + + +       A  I   +  +C+  K  +   S P+ + KL D  K    A   L+  + + +++ + +N +  ++  G V + V +L Q +  Y    + A+  I+E+ +++Q  I  A I +++ +  +++ + AL+    +     A+  + K  +  L  L + +K SAPGQ+E  E    L ++++    + M    +   S+  +++ +S  S    +Q +L Q+ + I               L RA  +    LA I      L + + +S     ++ ++I+ +   LE  +A+++  E L              + +  + E    +   C+DL+  +D I+   G +  ++ +I KS+A++ E+  + P       +    S   + D   D N+L  DIS       EST+R+ A      L+QN           L   YD L     G +  +S    N  +G+ +L++CV  VG+  + L++              + +    ++  R+ D++ LL S++ GTQ C  A   + E+ +D+DT+ILF          + S + QN       +KE +FK +++ V D         K+++S D    N+   +      A+Q+  A+ S +LA   N   +GL  ++         LL + ++V V+L+ F    + N +     +    NLK   +  + ++  L+K +KS++D   +  +A++ ++  +   +  L
Sbjct:   10 LRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGD---TIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKHGISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDGTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIEENEEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYP-------------VEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAV---EAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIE-------QSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRKD---FDKNDKLDNFLLAYENIQEVDDSDDDLDKLVSAARRLAQATTAMISEIQLKAVNEQYKT----------PEERDRLINAAKQLAEATTVLIDSAKNCTMDKDE-MNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQI-SNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLS--AALE--QLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDAAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRLSDALSLCLDSLPGQRDLDMLSKHIESKKHQFAENRL---PIQQNNNINLSNC--RSELTDTTFDFNQAVNELVSAPSFNLVNKG----CKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVR---KQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPIL--DNPVHPISHKDYFECLDFIIDKTVQPLADSL----KNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHT---SFLQIQKEISENCQTICNPDTTARQMISTAGQIAENSRKLCEASKTIM--ISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAI--ISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEALAILAKLIKQAYDSKMK--IMKHRSRTISRTFESEESYQNILQSALIQMPHCINE-------------LSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLIAILEASEQLLKAIKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQES-AIIP-----EKSRFGNSQSKMLDICYDMNNLTTDISSN--ANSESTQRLLAP-----LTQN-----------LTQRYDDLCRACQGAVATLS----NENNGK-QLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILF----------VKSADIQNDDREYYSVKE-LFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQES------ADQI--AITSQSLA---NDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVAR-NTSELPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIELEHNHECL 2273          
BLAST of Talin vs. Planmine SMEST
Match: SMESG000066444.1 (SMESG000066444.1)

HSP 1 Score: 687.182 bits (1772), Expect = 0.000e+0
Identity = 673/2401 (28.03%), Postives = 1217/2401 (50.69%), Query Frame = 3
Query:   78 LRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERM-KTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKT-KGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYS-DENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDK-NTLSFEKNSLATIGHLPN-------RGDIGVVSQ-GRVGSAQPIAI-RNDSKIGQ-----GNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQ-------HDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNS--------------ISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIE-----THSVIYQQLDETVA-MICESIDKLKQHLIINSITAHQDPLVTKFLSASERL---PAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMT-AGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPD----LNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAAL----KSKTDSNENLYEK--QIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINS---NLTHSALTLLAKQLNESHD-----CMLMTGLQL------IAEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCM-----QSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG-VLNTVEQLTQ-IAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHS----RDRGEVIELTKTVLEAFLAMVQECETL-----------STTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTD-NSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSL---VTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR-------------YDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQ-------KMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTL 6914
            LRI IV  + T  + LD +  ++ +C  + K I + +    + +GL++   D  +  WLDNSK + +Y L  GD    + +++R R L IRTMD T KTL+VDDS +++EL+L +C K+GI N++EYSLI + +D +  + KT+++K G +  +D +KL+K+K+K  T+D LNWL   ++LRQ GI+E + LLL+RKYFFSD NVD+RDPIQL+LLY QLK+A+I+GTHPV + EAI+LAG+QCQ +LGN + DK K    +L+E LPKEY K  K ++KKI  Q+ K    S+ + K  Y  LCRS KTYGITFFLVKEKV  KNKL+PRL+G++KE V++VDEKTKE+I  WPLT++R++AA+ + F++DFG+YS DE Y  QT +GE+I+QLI GYIDII+K++KAKD+L  DA+EE+ M EEN+APSKA ++ H    K +++S E   +    H+ N       +    V SQ G     + I + R  S +G+      ++      +++ D    ++  +I + DNL  ++   + L    +  ++G DE+S+ +    +D ++ R+   + +M  A   +L   Q       ++E+  + +   ++  + + I  +   L+E IR       +  +ED++G  LI AAK L +AF +L+ A+ P             +  +K + + K + +A N VGEAS  LL  I+ ++N               I++ +   ++ LL  AK +AN  + ++K VK  +V   E +    Q  ++ AA  +G A S LIS  K+VA +IE            +Q+I S+++V + +Q ++E     T S   Q L    A  + E++D L +HL  +     ++  +  FL A E +     +  +  ++V+ A+ LA+A T +   +   A+ +  +            + + RL+ AA+ L +A   L+ + K C  + ++ +  +  L +A      V + T     I++++   L  A R+ A T   L+ +S  AAK +RASN+++C++ +E++  +   +I+A  + R +P D  AQ  L+ AC+  I   EQL +S++ + P V DPS+Q+ALN S+  S  +  +LK+CV QAD + +   ++  A +E  QL+ L   + +   S+ R  L PLP E  +  +A++  S + +    ++  N+L            ++S +N+       + A+EL  ++++L+  ARG+AA       ++++N+   EK  Q+ +++   + +++  D++   K +      +D  +++  ++ + +   +  +P  +++D L   ++S    F +N +   P+ +N N   S+   +SE T     FNQ + +L+++   NL +       K++  S+D     C ++           +  + +N+  + +G+  +S +   LLD +K +     +  V    + L +A  ++ DSIN LL+  ++ L   Q+ C+ +  +LE+++  L  + P  PI++  Y +C+     ++V+ L++SL    K IP A K  ++  F  +I   + S   +L+   Q  Y +G+    + I       +    S +Q    +S+NC ++ + + +       A  I   +  +C+  K  +   S P+ + KL D  K    A   L+  + + +++ + +N +  ++  G V + V +L Q +  Y    + A+  I+E+ +++Q  I  A I +++ +  +++ + AL+    +     A+  + K  +  L  L + +K SAPGQ+E  E    L ++++    + M    +   S+  +++ +S  S    +Q +L Q+ + I               L RA  +    LA I      L + + +S     ++ ++I+ +   LE  +A+++  E L              + +  + E    +   C+DL+  +D I+   G +  ++ +I KS+A++ E+  + P       +    S   + D   D N+L  DIS       EST+R+ A      L+QN           L   YD L     G +  +S    N  +G+ +L++CV  VG+  + L++              + +    ++  R+ D++ LL S++ GTQ C  A   + E+ +D+DT+ILF          + S + QN       +KE +FK +++ V D         K+++S D    N+   +      A+Q+  A+ S +LA   N   +GL  ++         LL + ++V V+L+ F    + N +     +    NLK   +  + ++  L+K +KS++D   +  +A++ ++  +   +  L
Sbjct:   20 LRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGD---TIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKHGISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDGTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIEENEEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYP-------------VEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAV---EAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIE-------QSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRKD---FDKNDKLDNFLLAYENIQEVDDSDDDLDKLVSAARRLAQATTAMISEIQLKAVNEQYKT----------PEERDRLINAAKQLAEATTVLIDSAKNCTMDKDE-MNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQI-SNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLS--AALE--QLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDAAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRLSDALSLCLDSLPGQRDLDMLSKHIESKKHQFAENRL---PIQQNNNINLSNC--RSELTDTTFDFNQAVNELVSAPSFNLVNKG----CKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVR---KQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPIL--DNPVHPISHKDYFECLDFIIDKTVQPLADSL----KNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHT---SFLQIQKEISENCQTICNPDTTARQMISTAGQIAENSRKLCEASKTIM--ISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAI--ISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEALAILAKLIKQAYDSKMK--IMKHRSRTISRTFESEESYQNILQSALIQMPHCINE-------------LSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLIAILEASEQLLKAIKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQES-AIIP-----EKSRFGNSQSKMLDICYDMNNLTTDISSN--ANSESTQRLLAP-----LTQN-----------LTQRYDDLCRACQGAVATLS----NENNGK-QLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILF----------VKSADIQNDDREYYSVKE-LFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQES------ADQI--AITSQSLA---NDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVAR-NTSELPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIELEHNHECL 2283          
BLAST of Talin vs. Planmine SMEST
Match: SMESG000066444.1 (SMESG000066444.1)

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 673/2401 (28.03%), Postives = 1217/2401 (50.69%), Query Frame = 3
Query:   78 LRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLFVSDADSMRAYWLDNSKPVSYYPL--GDKNLVLLFKSRMRRLIIRTMDDTKKTLEVDDSKSIAELILPICNKMGISNHEEYSLIYE-LDENERM-KTMTLKRGKTQIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFSDQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNMAPDKAKSIHSNLKEFLPKEYVKT-KGIDKKIIAQYEKLSGKSDKDVKVIYAQLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQNWPLTTVRRYAATASLFSLDFGDYS-DENYVIQTTEGEKIAQLIGGYXXXXXXXXXXXXNLSADAEEETAMIEENVAPSKANVISHNFIDK-NTLSFEKNSLATIGHLPN-------RGDIGVVSQ-GRVGSAQPIAI-RNDSKIGQ-----GNVNVQPQKFQIRDLSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLDIAKTRVKGNLMSMTMATGNLLMMMQ-------HDEDSDDNDDYGRIDAAIATIGYNTDKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINMESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNS--------------ISDLEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAAKNSGQATSMLISAAKVVACSIEXXXXXXXXXXXXXXVIDSVDNVIQLVQPLIE-----THSVIYQQLDETVA-MICESIDKLKQHLIINSITAHQDPLVTKFLSASERL---PAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSSLDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHHMTSVAHMT-AGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASNYQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLEQLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPTRVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIEXXXXXXXXXXXXXXXXFDKLYNNLPD----LNNYMSDNSPENIGLQSDFIRSAKELMESMEKLLRGARGIAAL----KSKTDSNENLYEK--QIDVIDCGKQIIRSGEDVIQGIKLASIRAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNIINNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINS---NLTHSALTLLAKQLNESHD-----CMLMTGLQL------IAEVPNNQQQLTSGLKSVSNNSTXXXXXXXXXXAASGSSDVNXXXXXXXXXXXXVSDSINDLLSACASTLPVTQQLCESSQRQLEALKTSLLAEPPSLPINNYSYNQCM-----QSVEELSESLLTQMKRIPVACKTGDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPILDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECINNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG-VLNTVEQLTQ-IAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSLLRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIEMEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQLKNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHS----RDRGEVIELTKTVLEAFLAMVQECETL-----------STTTNNQDLMENVSSLKIGCDDLMKFIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKGITDTVTD-NSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFKKLVHDYDSL---VTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIR-------------YDQKEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFXXXXXXXXXXINSENDQNKPNSVAQIKEDIFKITKSLVSDLQ-------KMVISVDGKQENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTLLLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGLIKSVKSLEDSGFRGTRALETSLEAMRKEYRTL 6914
            LRI IV  + T  + LD +  ++ +C  + K I + +    + +GL++   D  +  WLDNSK + +Y L  GD    + +++R R L IRTMD T KTL+VDDS +++EL+L +C K+GI N++EYSLI + +D +  + KT+++K G +  +D +KL+K+K+K  T+D LNWL   ++LRQ GI+E + LLL+RKYFFSD NVD+RDPIQL+LLY QLK+A+I+GTHPV + EAI+LAG+QCQ +LGN + DK K    +L+E LPKEY K  K ++KKI  Q+ K    S+ + K  Y  LCRS KTYGITFFLVKEKV  KNKL+PRL+G++KE V++VDEKTKE+I  WPLT++R++AA+ + F++DFG+YS DE Y  QT +GE+I+QLI GYIDII+K++KAKD+L  DA+EE+ M EEN+APSKA ++ H    K +++S E   +    H+ N       +    V SQ G     + I + R  S +G+      ++      +++ D    ++  +I + DNL  ++   + L    +  ++G DE+S+ +    +D ++ R+   + +M  A   +L   Q       ++E+  + +   ++  + + I  +   L+E IR       +  +ED++G  LI AAK L +AF +L+ A+ P             +  +K + + K + +A N VGEAS  LL  I+ ++N               I++ +   ++ LL  AK +AN  + ++K VK  +V   E +    Q  ++ AA  +G A S LIS  K+VA +IE            +Q+I S+++V + +Q ++E     T S   Q L    A  + E++D L +HL  +     ++  +  FL A E +     +  +  ++V+ A+ LA+A T +   +   A+ +  +            + + RL+ AA+ L +A   L+ + K C  + ++ +  +  L +A      V + T     I++++   L  A R+ A T   L+ +S  AAK +RASN+++C++ +E++  +   +I+A  + R +P D  AQ  L+ AC+  I   EQL +S++ + P V DPS+Q+ALN S+  S  +  +LK+CV QAD + +   ++  A +E  QL+ L   + +   S+ R  L PLP E  +  +A++  S + +    ++  N+L            ++S +N+       + A+EL  ++++L+  ARG+AA       ++++N+   EK  Q+ +++   + +++  D++   K +      +D  +++  ++ + +   +  +P  +++D L   ++S    F +N +   P+ +N N   S+   +SE T     FNQ + +L+++   NL +       K++  S+D     C ++           +  + +N+  + +G+  +S +   LLD +K +     +  V    + L +A  ++ DSIN LL+  ++ L   Q+ C+ +  +LE+++  L  + P  PI++  Y +C+     ++V+ L++SL    K IP A K  ++  F  +I   + S   +L+   Q  Y +G+    + I       +    S +Q    +S+NC ++ + + +       A  I   +  +C+  K  +   S P+ + KL D  K    A   L+  + + +++ + +N +  ++  G V + V +L Q +  Y    + A+  I+E+ +++Q  I  A I +++ +  +++ + AL+    +     A+  + K  +  L  L + +K SAPGQ+E  E    L ++++    + M    +   S+  +++ +S  S    +Q +L Q+ + I               L RA  +    LA I      L + + +S     ++ ++I+ +   LE  +A+++  E L              + +  + E    +   C+DL+  +D I+   G +  ++ +I KS+A++ E+  + P       +    S   + D   D N+L  DIS       EST+R+ A      L+QN           L   YD L     G +  +S    N  +G+ +L++CV  VG+  + L++              + +    ++  R+ D++ LL S++ GTQ C  A   + E+ +D+DT+ILF          + S + QN       +KE +FK +++ V D         K+++S D    N+   +      A+Q+  A+ S +LA   N   +GL  ++         LL + ++V V+L+ F    + N +     +    NLK   +  + ++  L+K +KS++D   +  +A++ ++  +   +  L
Sbjct:   20 LRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGD---TIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKHGISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDGTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIEENEEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYP-------------VEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAV---EAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIE-------QSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRKD---FDKNDKLDNFLLAYENIQEVDDSDDDLDKLVSAARRLAQATTAMISEIQLKAVNEQYKT----------PEERDRLINAAKQLAEATTVLIDSAKNCTMDKDE-MNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQI-SNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLS--AALE--QLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDAAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRLSDALSLCLDSLPGQRDLDMLSKHIESKKHQFAENRL---PIQQNNNINLSNC--RSELTDTTFDFNQAVNELVSAPSFNLVNKG----CKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVR---KQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPIL--DNPVHPISHKDYFECLDFIIDKTVQPLADSL----KNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHT---SFLQIQKEISENCQTICNPDTTARQMISTAGQIAENSRKLCEASKTIM--ISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAI--ISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEALAILAKLIKQAYDSKMK--IMKHRSRTISRTFESEESYQNILQSALIQMPHCINE-------------LSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLIAILEASEQLLKAIKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQES-AIIP-----EKSRFGNSQSKMLDICYDMNNLTTDISSN--ANSESTQRLLAP-----LTQN-----------LTQRYDDLCRACQGAVATLS----NENNGK-QLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILF----------VKSADIQNDDREYYSVKE-LFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQES------ADQI--AITSQSLA---NDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVAR-NTSELPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIELEHNHECL 2283          
The following BLAST results are available for this feature:
BLAST of Talin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLN10.000e+030.77talin 1 [Source:HGNC Symbol;Acc:HGNC:11845][more]
TLN20.000e+030.22talin 2 [Source:HGNC Symbol;Acc:HGNC:15447][more]
TLN21.315e-13028.13talin 2 [Source:HGNC Symbol;Acc:HGNC:15447][more]
TLN21.202e-11927.95talin 2 [Source:HGNC Symbol;Acc:HGNC:15447][more]
HIP14.694e-1529.24huntingtin interacting protein 1 [Source:HGNC Symb... [more]
back to top
BLAST of Talin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tln-12.595e-14032.38TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9][more]
tln-11.384e-13931.98TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9][more]
tln-11.944e-8427.05TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9][more]
tln-16.606e-8427.07TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9][more]
tln-11.106e-8327.07TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9][more]
back to top
BLAST of Talin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhea0.000e+029.57gene:FBgn0260442 transcript:FBtr0333108[more]
rhea0.000e+029.57gene:FBgn0260442 transcript:FBtr0305210[more]
rhea0.000e+029.57gene:FBgn0260442 transcript:FBtr0333105[more]
rhea0.000e+029.57gene:FBgn0260442 transcript:FBtr0333106[more]
rhea0.000e+029.39gene:FBgn0260442 transcript:FBtr0333107[more]
back to top
BLAST of Talin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tln10.000e+030.90talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48][more]
tln10.000e+030.81talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48][more]
tln2a0.000e+030.12talin 2a [Source:ZFIN;Acc:ZDB-GENE-040724-263][more]
tln2a0.000e+030.12talin 2a [Source:ZFIN;Acc:ZDB-GENE-040724-263][more]
tln2b1.633e-13128.45talin 2b [Source:ZFIN;Acc:ZDB-GENE-130325-1][more]
back to top
BLAST of Talin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLN20.000e+030.35talin 2 [Source:NCBI gene;Acc:100144637][more]
TLN20.000e+030.34talin 2 [Source:NCBI gene;Acc:100144637][more]
TLN20.000e+030.23talin 2 [Source:NCBI gene;Acc:100144637][more]
TLN20.000e+029.13talin 2 [Source:NCBI gene;Acc:100144637][more]
TLN20.000e+028.76talin 2 [Source:NCBI gene;Acc:100144637][more]
back to top
BLAST of Talin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tln10.000e+030.78talin 1 [Source:MGI Symbol;Acc:MGI:1099832][more]
Tln20.000e+030.26talin 2 [Source:MGI Symbol;Acc:MGI:1917799][more]
Tln20.000e+030.26talin 2 [Source:MGI Symbol;Acc:MGI:1917799][more]
Tln20.000e+030.26talin 2 [Source:MGI Symbol;Acc:MGI:1917799][more]
Tln27.623e-12528.33talin 2 [Source:MGI Symbol;Acc:MGI:1917799][more]
back to top
BLAST of Talin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y490|TLN1_HUMAN0.000e+030.77Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3[more]
sp|P26039|TLN1_MOUSE0.000e+030.78Talin-1 OS=Mus musculus OX=10090 GN=Tln1 PE=1 SV=2[more]
sp|P54939|TLN1_CHICK0.000e+030.73Talin-1 OS=Gallus gallus OX=9031 GN=TLN1 PE=1 SV=2[more]
sp|Q9Y4G6|TLN2_HUMAN0.000e+030.22Talin-2 OS=Homo sapiens OX=9606 GN=TLN2 PE=1 SV=4[more]
sp|Q71LX4|TLN2_MOUSE6.304e-7329.87Talin-2 OS=Mus musculus OX=10090 GN=Tln2 PE=1 SV=3[more]
back to top
BLAST of Talin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4BLR40.000e+032.53Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3HJY60.000e+031.72talin-1 isoform X1 OS=Lingula unguis OX=7574 GN=LO... [more]
A0A1S3HMQ00.000e+031.74talin-1 isoform X2 OS=Lingula unguis OX=7574 GN=LO... [more]
A0A224Z8Y20.000e+031.58Talin OS=Rhipicephalus zambeziensis OX=60191 PE=4 ... [more]
A0A131YM950.000e+031.60Talin OS=Rhipicephalus appendiculatus OX=34631 PE=... [more]
back to top
BLAST of Talin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tln10.000e+030.59talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48][more]
tln2a3.633e-1227.86talin-2-like [Source:NCBI gene;Acc:103042966][more]
tln2b2.308e-5728.40talin 2b [Source:ZFIN;Acc:ZDB-GENE-130325-1][more]
hip13.214e-1427.85huntingtin interacting protein 1 [Source:NCBI gene... [more]
hip13.323e-1427.85huntingtin interacting protein 1 [Source:NCBI gene... [more]
back to top
BLAST of Talin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003776.13.061e-17431.73pep scaffold:Pmarinus_7.0:GL481036:4073:28398:-1 g... [more]
ENSPMAT00000007752.14.891e-9026.78pep scaffold:Pmarinus_7.0:GL478287:501:47681:-1 ge... [more]
ENSPMAT00000010194.11.413e-8930.27pep scaffold:Pmarinus_7.0:GL480176:295:15370:1 gen... [more]
ENSPMAT00000007037.11.000e-6550.95pep scaffold:Pmarinus_7.0:GL476737:73889:120616:-1... [more]
ENSPMAT00000002539.13.604e-4131.72pep scaffold:Pmarinus_7.0:GL478866:18799:39338:-1 ... [more]
back to top
BLAST of Talin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SLA21.277e-633.06Adaptor protein that links actin to clathrin and e... [more]
back to top
BLAST of Talin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO477770.000e+029.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492691.457e-1429.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351941.192e-1328.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356583.551e-1123.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389651.849e-625.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Talin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tln2a0.000e+030.54talin-2 [Source:NCBI gene;Acc:101173776][more]
tln10.000e+030.81talin 1 [Source:NCBI gene;Acc:101157630][more]
tln2a0.000e+030.50talin-2 [Source:NCBI gene;Acc:101173776][more]
tln2a0.000e+030.60talin-2 [Source:NCBI gene;Acc:101173776][more]
tln2b9.190e-7529.24talin 2 [Source:NCBI gene;Acc:101167954][more]
back to top
BLAST of Talin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072542.10.000e+099.74SMESG000072542.1[more]
SMESG000066444.10.000e+028.03SMESG000066444.1[more]
SMESG000066444.10.000e+028.03SMESG000066444.1[more]
SMESG000066444.10.000e+028.03SMESG000066444.1[more]
SMESG000066444.10.000e+028.03SMESG000066444.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012271 ID=SMED30012271|Name=Talin|organism=Schmidtea mediterranea sexual|type=transcript|length=8430bp
AAAGCTTTCAATTTCAAATTAATTATTAGCTGCTTTGTTACTTTAAAGAA
TTTAGGTTTTCTATTGAAATGCATACACTAAGAATATTAATTGTTCCCAC
AAATAAAACAATCTCTCTTAAATTAGATTTAGATACTGTGGTTTATGATA
TATGCCGAGATCTGTTTAAAAGAATTCCACAAAAAGAAAATCTATTGGTT
GAAGAATTCGGATTATTCGTTTCCGATGCTGATTCAATGCGAGCTTATTG
GCTGGACAATTCAAAGCCGGTTTCATATTATCCACTGGGAGATAAAAATC
TTGTTCTGTTATTCAAATCTCGAATGAGACGTTTGATAATTCGAACAATG
GATGATACGAAAAAGACACTGGAAGTTGATGATAGCAAATCGATAGCGGA
ATTAATTTTACCAATTTGCAACAAAATGGGAATAAGCAATCACGAGGAAT
ATTCTTTGATATATGAATTGGATGAAAATGAACGAATGAAGACAATGACA
TTGAAACGCGGAAAAACTCAAATCCGTGATTTTGACAAATTAGAAAAAAT
GAAACAAAAATTGAAAACAGACGACGAATTAAACTGGTTGCCTCATGGGA
AAACTCTCAGGCAATTAGGAATTGATGAAAAAGATGAATTATTGTTGAGA
CGTAAATATTTTTTCTCGGACCAAAACGTCGACGCAAGAGATCCTATTCA
ACTTAATCTTCTTTACGTTCAGTTGAAAAATGCTATTATCGACGGAACAC
ATCCAGTAAATATTGAGGAGGCCATTCAACTTGCCGGAATTCAATGTCAA
GCTGAACTTGGCAACATGGCTCCCGACAAGGCTAAATCAATCCATTCGAA
TCTGAAGGAATTCTTGCCAAAAGAATATGTCAAAACTAAGGGTATCGATA
AGAAAATAATTGCACAATATGAAAAATTGTCGGGAAAATCCGATAAAGAT
GTAAAAGTCATATATGCCCAATTGTGTCGATCTCTGAAAACATATGGAAT
AACATTTTTTCTAGTCAAAGAAAAAGTACGAGCAAAAAACAAGTTAGTAC
CACGATTAATGGGCATTAGTAAAGAATATGTGATGCGTGTCGATGAAAAA
ACGAAAGAAATGATTCAAAACTGGCCATTGACGACTGTTCGACGTTACGC
AGCAACAGCATCACTATTTTCTCTGGATTTCGGAGATTATTCCGATGAAA
ATTATGTAATCCAAACAACAGAAGGAGAGAAAATTGCCCAACTAATCGGT
GGATATATTGACATTATAATTAAAAAGCAAAAAGCTAAAGATAATTTGTC
AGCAGACGCAGAAGAAGAAACTGCTATGATTGAAGAAAATGTTGCTCCAT
CAAAAGCCAACGTTATATCACATAATTTCATTGATAAAAATACTTTGTCG
TTTGAAAAAAATTCACTTGCTACAATAGGACACCTTCCGAATCGTGGAGA
TATTGGTGTAGTTTCACAAGGTCGAGTAGGGTCAGCTCAGCCTATTGCAA
TTAGGAATGACAGTAAAATCGGCCAAGGTAACGTCAATGTACAGCCTCAG
AAATTTCAAATCAGAGATCTCAGTCAACCAAAACGAGCTCTGATGATTCG
CATAGGCGACAATTTGAAAATCTTGAAAGCTGCTACTGAAGACTTGGATA
AACATATCGAGGTTGCAAAATTAGGAAACGACGAGAGTTCAAGAAATTAC
CGAAAGCAAACATTAGATATTGCAAAAACTCGAGTTAAAGGCAACTTAAT
GTCAATGACAATGGCAACCGGAAACTTGCTGATGATGATGCAACACGACG
AAGACAGTGATGACAATGACGATTACGGTCGTATTGACGCAGCTATTGCA
ACAATCGGATACAACACTGATAAGCTTTTGGAAAATATTCGACATGTTTA
CGAAATGACTTTCGAAACAGACGAAGAAGACATTAATGGTGGCAACTTAA
TAGAGGCTGCAAAAACGTTGTTAAATGCCTTTCAAGATTTGCTAAATGCA
TCTAAACCTATCAATATGGAAAGTGATGCCAGTTTATCTGATGAATCAAT
TAATGGTGAAAAACCTGCGTTCTCAAATAAAGCACTCATGGAAGCGGTCA
ACAGAGTTGGGGAAGCTAGTCGACTTCTGCTGCACATAATTTCAGTCGAA
CAAAATTCAATTTCCGATTTAGAATGGCAAACCAGAGATACTCTACTAAC
AGATGCCAAACAAATCGCGAATTTGGTCAGTGGTATGGTGAAAATTGTCA
AAGAAGCATCAGTAGCATTGAAAGAAACCCAGGGCACAGAAGCTCAGGCA
ATGCTTATCCATGCAGCTAAAAATAGTGGACAAGCTACAAGCATGCTTAT
ATCAGCAGCTAAAGTTGTCGCATGCTCGATCGAGCAACCATTATCCCAAC
AACAATTGCATGCTTCCGCTCAACAAGTGATTGACTCAGTTGACAATGTG
ATTCAACTAGTTCAGCCCTTGATTGAAACCCACTCGGTAATATATCAGCA
ATTGGATGAAACTGTGGCCATGATTTGTGAAAGCATTGATAAGCTAAAAC
AACATCTCATTATAAACTCAATCACTGCTCATCAAGATCCTTTGGTTACA
AAGTTTCTGTCAGCAAGTGAAAGACTTCCAGCAGCAATTGGAAACAGCTT
AGAAATGGTGACACAAGCACAAATACTAGCTGAAGCAGGAACTGAATTAG
CTGATTGTCTCAGTAATGCAGCATTGGTGCAGTCTCCGCAAAATAACATT
TCTCAGTCAACTTCTTCATTAGATTCAGATCGTCAACGACGCCTAATGAT
TGCTGCTCAAGCTTTAACTGATGCTGTTGGAAAATTAGTACATGCAACTA
AGATTTGTGTGAAAGAGTCGGAACAGACTTTAGAAAATCAACAAGGTTTA
ATGCAAGCAGCTCATCATATGACATCCGTAGCCCATATGACTGCTGGGGA
AATCATCCGACAAAGATTATCTAAAGGACTTGAATTTGCTGGTAGACAAA
CTGCCCTCACCGCTGATCAATTGGTTCTCAGTTCACAAGAAGCAGCTAAA
ACCACAAGAGCAAGCAATTATCAAATTTGTAGTGAAGCTCAAGAAATGAC
TGAAATCGTTTTACCGGAAGTGATTTTAGCTTGTACAAAGATCCGTGAAA
ATCCGATAGATCCAAATGCTCAAAATAATTTATTAAATGCTTGTCAAAAA
TTAATACAGAATCTCGAGCAATTGCTTAAATCAAGTGAAGCTCTTGAGCC
ACGAGTTAAAGATCCATCAATCCAAAGTGCTTTAAATATTTCTATGCAAA
ATTCCCAAACATCTTTGGCTGATCTTAAACAATGTGTACAACAAGCCGAT
ACAATCTTCAAGCCGACAAGGGTTGCGAATATTGCCAATATCGAAGATGG
TCAATTGCAAACACTTCATTCATGGATGGACACTGCCGCAGAATCAGTTG
CTAGAGGTGAATTATATCCTCTTCCAGGAGAAACCATCGAATCTGTTAGT
GCAATAATCGGTAGTTCAAGTAAAGCAGCTTCGAAAATATTTGATAAGCT
CTACAACAATCTTCCCGATTTGAATAATTATATGTCGGACAATAGTCCGG
AAAATATTGGATTGCAATCTGATTTCATTAGAAGTGCTAAGGAATTAATG
GAATCCATGGAGAAATTATTGAGAGGAGCTCGTGGAATCGCAGCACTCAA
ATCCAAAACTGATTCCAATGAGAATCTCTACGAAAAACAAATTGATGTCA
TTGACTGTGGCAAGCAGATAATTCGCAGCGGTGAAGATGTTATCCAAGGA
ATTAAACTCGCTTCTATCAGAGCAGTCGCTATTGACGAGTTGAAAAAATC
TATTGACAAAATGAAAGAGGACATTGATGAACTCGTGTATCGTATTCCTG
CTTACCAAGAAATCGACTGTCTTGTTTCCAAATTGAAATCCAGCATGGAA
ATGTTTGATAAAAATATCATTAATAATAAGCCAGTGATTGAAAATGCGAA
CAAGACAAAATCACATTCTCAAATTCAATCTGAATTCACGACAGCTGTAG
CAATATTCAATCAGACCTTAGGGGATCTGATCAACAGTAATCTGACCCAT
TCAGCCTTAACGCTACTCGCTAAACAGTTGAATGAAAGCCACGATTGCAT
GCTGATGACAGGTTTACAGCTGATAGCCGAAGTACCAAATAACCAACAAC
AGCTAACGTCTGGACTGAAATCTGTGTCGAATAACAGTACAGATCTCCTG
GACCATTTAAAATTATTATTGGCTGCATCGGGTTCTTCGGATGTTAATTT
GCTCAAACAATCTTTATTAAAGGCCGCAAGTTTGGTTTCTGACAGTATCA
ATGATCTATTATCAGCGTGTGCTAGTACGCTTCCAGTTACGCAGCAATTA
TGTGAAAGTTCTCAGCGGCAATTGGAAGCTCTGAAAACCAGTTTATTGGC
AGAGCCACCATCATTGCCGATAAACAATTATTCGTACAATCAGTGCATGC
AATCAGTTGAAGAGTTAAGCGAGTCCTTATTGACGCAAATGAAACGTATT
CCAGTTGCATGCAAAACCGGCGACTCGAATGATTTCTGTTCGGCAATCCA
AGTACTTTCAGCATCCACTGTTGATATGCTGAAGTCGGTTACCCAGGCAA
ATTATAAGTTAGGACTCATCCAATCTAATGCTTCAATCAGAACTTCAAGC
ACTGTTACAAATCCAATATTAGATTCATTAATTCAACATGCTTCCGTGAT
GTCTAAAAACTGTATTAGTATGGCATCAAGTAATAATTCAGAAATACCTT
GCCGAGAACTGGCAACCGATATTAAAAGTCGAGCGAGTAGTGTTTGTCAA
TTAGTCAAAGAATGTATCAATAATTCAAGTGATCCTGATCATCAAAATAA
ATTGTTAGACGCCGGTAAACGAGTTGCAGAAGCTACAGGCAACCTGATAA
AAACAATTAATAGCTGTTCCAGGTCAGAATCGGTAGAAAATGATGAATGG
ACCAAAGCGTGTGAAGGCGTACTCAATACTGTTGAGCAATTAACACAAAT
AGCGAAATATACACCAATAACTAATCCCGCTGTTAAAACTATCACCGAAC
AGGGACGACAAGCACAAACTGAAATTCATCAAGCGTCTATTGAGATGGTT
GAAGGTTCATGTTCGTTATTAAGAGCAGCTGGAGCATTAGTTAAAGATTC
CAAAAGCATTCCAGCAAATCAAGCTTTTATAATAAATCAAAAAACTTACG
ACAGTTGTCTCAATAGACTGAGAAATGTTGTGAAATTTTCAGCTCCTGGA
CAAAGAGAATTTATTGAAATGGAAGAAGAATTGAAACAGGTGTTAAGGAA
TCTAGACCGAGCTAATATGGATCAATTTTCCGTTAATAAATCGTCAAAAA
TGAACGCAAAATCCAATGATTCCATAAACAGTGACATTCAAAGAATGCAG
TTGTCTTTGAAACAATTGAAAAATAATATCCGACCGATTGAAAATATTCT
CAGTGATCAATCCAAGTTCGAATATCTTGGTCGCGCTGTTTGGGAAGCTG
GAAGCTATTTAGCACCAATTTCTGAAAGTTCAAACAATTTGGCGCAGCTT
CTTCCTCACAGCAGAGATCGTGGAGAAGTCATAGAATTGACTAAAACCGT
ATTGGAGGCATTTTTAGCGATGGTACAAGAATGCGAAACATTATCAACTA
CTACTAATAATCAAGACCTAATGGAAAATGTGTCATCCTTAAAGATTGGA
TGTGATGATCTGATGAAATTTATCGATGGAATTGCCAGTTGCCACGGTAC
ACTGGAAAATATGATTGCATCAATTCAAAAATCAGCGGCTAGATTGACCG
AAACCAACAATGTGGCACCGCTAGATGCGGCTTCGGCACATACTCTGATA
TTTCAAAGTATCAAAGGAATCACTGACACAGTGACTGATAATTCACTGAA
CAAAGATATATCCGTGACTCGGTTACAAAAGAAAGAATCAACGAAAAGAA
TCAAAGCCAATGAGGACAATCAGATTTTGTCTCAGAATAAAATGGCCGAT
GTTAATTATCCTTTCAAAAAATTGGTCCATGATTATGATTCCCTAGTTAC
TGGAGTCATACAAATAATGTCTTCGGGAGCTTTTAATGTACAAGATGGAG
AAGATAAATTAAAAAAATGTGTTGTTGCTGTTGGCCAATCATGCATGGAT
TTAATTCGGTACGACCAAAAGGAATTTATTGGACAAGTGAGAAGTCGACT
CACGGATCTCATGTATCTCTTGCAATCTAATTCACGTGGAACTCAATGCT
GTATCGTTGCTGCAAATTCCGTTAATGAAATGGTAGCCGATTTGGATACT
GCGATTTTGTTTGCCGGTTCCGGATCTTTGGCGCTTTCGTTGATTAACAG
TGAAAACGATCAAAATAAACCGAATTCCGTTGCACAAATCAAAGAAGACA
TTTTCAAAATTACAAAATCTTTGGTATCAGATTTGCAGAAAATGGTTATA
TCAGTTGATGGGAAACAAGAAAATTTAGCAATGGCAACGGATAATGCTGT
TCGACGGGCAAATCAACTCTGTGGAGCTGTTAAAAGTAGTGCTTTAGCAA
TTGGTTCGAATCCATCTCTTTTAGGATTGTCGGAAATGAGCGATGAATGC
ATCAGTGCTCAAACGTTATTATTAAATGCGGTTCGCGATGTCGCTGTGGC
ACTTGTAGATTTCTTTAATTGCACTAAAATGAATGTCACGGCCACTACTG
ACAAAGAACGGGATAGATCTAATCTGAAAAGTAGTTTAGAAACTATGGTG
AAAAGTGTTGATGGATTAATAAAAAGCGTTAAAAGTTTAGAAGATTCTGG
ATTTAGAGGTACTAGAGCTTTAGAAACATCCCTTGAAGCTATGCGCAAAG
AATACCGCACCCTAGAAAATTGGATTCCTGACGGTGAAGATGTACTTAAC
TCTAAAATCCAAGAAGGGGAATATTCCCAAATCAATGTTGGCGTTGATAA
TGTTACAGCTTCTTCAGATAAAATTTATTCTGTTGAAAATTTGGTTCTGA
TGACTAAGCCCTTGATTTTAGCATCACAGAAAGCAATGGCTGCAGTTCAA
ACATTTAAGCAGGAAGATATACTTATGGCAGCAAACGTCGGTCGCAAGGC
AATTACGGATTTGGTCCATCATATAAGAGTTACAATTGATATGAAGTTAA
AAGAAGAAAAATCCAAACCGTCGAGGATTTTCAGTGAAAAAGCACCAATT
GTGTCTGATCCAGACCGACGCACTGTTGAATCAGTGAAGGAAAATTCAAT
GAAAATAGTCGAACACGGTAAAGGCGCAGTTAAAGCCCTGATTGACATGT
ACGAAAATTTAAACAAGAGTGTGGCAGAAGGCAAAAAAAATGAATCACAT
AAAATGCAAATGACTCTTGCTTCTCGGCGAATCGCCCATTCGATTCACGA
AATTACTGAATCCGCCACACAACTCAAAGACACACATTTGGCCGATCAAG
AAGATCCGAATAGTCACTGTGCAATTGCAGAGAACGAACTGCTGGAAGCG
GCTTCACAAATCGAAACGGCAGCAAAGAAAATAGCTTTGCTTAAACCACG
AAAATCAATAAAGAAAGATACTGGCGAAGAATATACATTTGATGGCCAAA
TTATTGTTGCATGTGGCTCGATAGTCAGTGCAACCTCACATTTAGTCAAA
ATGGCCTCGTTGTCTCAGCAAGAATTAGTTTCTCAGGGTCGACTGAAACC
CAGTGAAAATATATCCGAGCAAAATGAAACCCAATGGAGTCATGGATTGA
TATCGGCAGCCAGATTAGTGGCAGCAGCAACGGAAAATCTTAGTGATAGT
GCAAAAGCTGTTGTCCAGGGCAAATGTGGTACAGATCGTCTGATATCGGC
TTCTAAACAGGTTGCTGCCGGCACAGCTCATTTGTTATTGGCATGCCAAG
TGAAATCTGATGCCGATTCGAAAACCAACCAAAGATTACAAGCAGCCGGC
TCTGCTGTTAAACGAGCAACAGAAGCCTTAGTGAAAGAGGCTACCGAACA
CAGAGATGTCCAAGATGGCTCCATTCCATACACTTACGATGGACCGAACA
AGAGCATGGTTAATTCCATGAGAAATGTTATCCAAGCTCAAGCAGATATA
GTTGCAAAAGAAAGAGAACTGGAAATGCTGCGTAACAAGTACCAATCGAT
TCGACAGGGCCATATTTCCACTCATCCGGAACTGTTTGGTGGTGACAAGG
AATAAATCCGGAATTTTACATGCCTTTGTATATATAACTTGATTGATTGC
GTTCGAATATCTGTTTCTGTTTCATAAATTTATATTTTGATTTTTTCAGT
TCATTTTCACATTCAGATTCTCTCGATAGCAATTCCAATGTCAAGAAATT
GATTGTTTTGTTTATCTGCACCCAAATATC
back to top

protein sequence of SMED30012271-orf-1

>SMED30012271-orf-1 ID=SMED30012271-orf-1|Name=SMED30012271-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2729bp
MHTLRILIVPTNKTISLKLDLDTVVYDICRDLFKRIPQKENLLVEEFGLF
VSDADSMRAYWLDNSKPVSYYPLGDKNLVLLFKSRMRRLIIRTMDDTKKT
LEVDDSKSIAELILPICNKMGISNHEEYSLIYELDENERMKTMTLKRGKT
QIRDFDKLEKMKQKLKTDDELNWLPHGKTLRQLGIDEKDELLLRRKYFFS
DQNVDARDPIQLNLLYVQLKNAIIDGTHPVNIEEAIQLAGIQCQAELGNM
APDKAKSIHSNLKEFLPKEYVKTKGIDKKIIAQYEKLSGKSDKDVKVIYA
QLCRSLKTYGITFFLVKEKVRAKNKLVPRLMGISKEYVMRVDEKTKEMIQ
NWPLTTVRRYAATASLFSLDFGDYSDENYVIQTTEGEKIAQLIGGYIDII
IKKQKAKDNLSADAEEETAMIEENVAPSKANVISHNFIDKNTLSFEKNSL
ATIGHLPNRGDIGVVSQGRVGSAQPIAIRNDSKIGQGNVNVQPQKFQIRD
LSQPKRALMIRIGDNLKILKAATEDLDKHIEVAKLGNDESSRNYRKQTLD
IAKTRVKGNLMSMTMATGNLLMMMQHDEDSDDNDDYGRIDAAIATIGYNT
DKLLENIRHVYEMTFETDEEDINGGNLIEAAKTLLNAFQDLLNASKPINM
ESDASLSDESINGEKPAFSNKALMEAVNRVGEASRLLLHIISVEQNSISD
LEWQTRDTLLTDAKQIANLVSGMVKIVKEASVALKETQGTEAQAMLIHAA
KNSGQATSMLISAAKVVACSIEQPLSQQQLHASAQQVIDSVDNVIQLVQP
LIETHSVIYQQLDETVAMICESIDKLKQHLIINSITAHQDPLVTKFLSAS
ERLPAAIGNSLEMVTQAQILAEAGTELADCLSNAALVQSPQNNISQSTSS
LDSDRQRRLMIAAQALTDAVGKLVHATKICVKESEQTLENQQGLMQAAHH
MTSVAHMTAGEIIRQRLSKGLEFAGRQTALTADQLVLSSQEAAKTTRASN
YQICSEAQEMTEIVLPEVILACTKIRENPIDPNAQNNLLNACQKLIQNLE
QLLKSSEALEPRVKDPSIQSALNISMQNSQTSLADLKQCVQQADTIFKPT
RVANIANIEDGQLQTLHSWMDTAAESVARGELYPLPGETIESVSAIIGSS
SKAASKIFDKLYNNLPDLNNYMSDNSPENIGLQSDFIRSAKELMESMEKL
LRGARGIAALKSKTDSNENLYEKQIDVIDCGKQIIRSGEDVIQGIKLASI
RAVAIDELKKSIDKMKEDIDELVYRIPAYQEIDCLVSKLKSSMEMFDKNI
INNKPVIENANKTKSHSQIQSEFTTAVAIFNQTLGDLINSNLTHSALTLL
AKQLNESHDCMLMTGLQLIAEVPNNQQQLTSGLKSVSNNSTDLLDHLKLL
LAASGSSDVNLLKQSLLKAASLVSDSINDLLSACASTLPVTQQLCESSQR
QLEALKTSLLAEPPSLPINNYSYNQCMQSVEELSESLLTQMKRIPVACKT
GDSNDFCSAIQVLSASTVDMLKSVTQANYKLGLIQSNASIRTSSTVTNPI
LDSLIQHASVMSKNCISMASSNNSEIPCRELATDIKSRASSVCQLVKECI
NNSSDPDHQNKLLDAGKRVAEATGNLIKTINSCSRSESVENDEWTKACEG
VLNTVEQLTQIAKYTPITNPAVKTITEQGRQAQTEIHQASIEMVEGSCSL
LRAAGALVKDSKSIPANQAFIINQKTYDSCLNRLRNVVKFSAPGQREFIE
MEEELKQVLRNLDRANMDQFSVNKSSKMNAKSNDSINSDIQRMQLSLKQL
KNNIRPIENILSDQSKFEYLGRAVWEAGSYLAPISESSNNLAQLLPHSRD
RGEVIELTKTVLEAFLAMVQECETLSTTTNNQDLMENVSSLKIGCDDLMK
FIDGIASCHGTLENMIASIQKSAARLTETNNVAPLDAASAHTLIFQSIKG
ITDTVTDNSLNKDISVTRLQKKESTKRIKANEDNQILSQNKMADVNYPFK
KLVHDYDSLVTGVIQIMSSGAFNVQDGEDKLKKCVVAVGQSCMDLIRYDQ
KEFIGQVRSRLTDLMYLLQSNSRGTQCCIVAANSVNEMVADLDTAILFAG
SGSLALSLINSENDQNKPNSVAQIKEDIFKITKSLVSDLQKMVISVDGKQ
ENLAMATDNAVRRANQLCGAVKSSALAIGSNPSLLGLSEMSDECISAQTL
LLNAVRDVAVALVDFFNCTKMNVTATTDKERDRSNLKSSLETMVKSVDGL
IKSVKSLEDSGFRGTRALETSLEAMRKEYRTLENWIPDGEDVLNSKIQEG
EYSQINVGVDNVTASSDKIYSVENLVLMTKPLILASQKAMAAVQTFKQED
ILMAANVGRKAITDLVHHIRVTIDMKLKEEKSKPSRIFSEKAPIVSDPDR
RTVESVKENSMKIVEHGKGAVKALIDMYENLNKSVAEGKKNESHKMQMTL
ASRRIAHSIHEITESATQLKDTHLADQEDPNSHCAIAENELLEAASQIET
AAKKIALLKPRKSIKKDTGEEYTFDGQIIVACGSIVSATSHLVKMASLSQ
QELVSQGRLKPSENISEQNETQWSHGLISAARLVAAATENLSDSAKAVVQ
GKCGTDRLISASKQVAAGTAHLLLACQVKSDADSKTNQRLQAAGSAVKRA
TEALVKEATEHRDVQDGSIPYTYDGPNKSMVNSMRNVIQAQADIVAKERE
LEMLRNKYQSIRQGHISTHPELFGGDKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000020protonephridia
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000231vitelline gland
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR030224Sla2_fam
IPR035964I/LWEQ_dom_sf
IPR035963FERM_2
IPR036476Talin_cent_sf
IPR002404IRS_PTB
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR000299FERM_domain
IPR014760Serum_albumin_N
IPR019749Band_41_domain
IPR002558ILWEQ_dom
IPR019748FERM_central
IPR015224Talin_cent
IPR011993PH-like_dom_sf
IPR018979FERM_N
IPR032425FERM_f0
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
GO:0007016cytoskeletal anchoring at plasma membrane
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0030276clathrin binding
GO:0003779actin binding
GO:0005200structural constituent of cytoskeleton
GO:0005158insulin receptor binding
GO:0008483transaminase activity
GO:0016740transferase activity
GO:0051015actin filament binding
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
GO:0001726ruffle
GO:0005925focal adhesion
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 2484..2504
NoneNo IPR availableCOILSCoilCoilcoord: 1255..1275
NoneNo IPR availableCOILSCoilCoilcoord: 2687..2714
NoneNo IPR availableCOILSCoilCoilcoord: 1783..1803
NoneNo IPR availableCOILSCoilCoilcoord: 1035..1059
NoneNo IPR availableCOILSCoilCoilcoord: 1748..1768
NoneNo IPR availableSMARTSM01244IRS_2coord: 309..402
e-value: 2.6E-11
score: 53.6
NoneNo IPR availableGENE3DG3DSA:1.20.1420.10coord: 1744..1912
e-value: 2.4E-16
score: 62.3
NoneNo IPR availableGENE3DG3DSA:1.20.1420.10coord: 2301..2389
e-value: 4.1E-11
score: 44.9
NoneNo IPR availableGENE3DG3DSA:1.20.1420.10coord: 1281..1437
e-value: 1.6E-10
score: 43.1
NoneNo IPR availableGENE3DG3DSA:1.20.120.230coord: 690..800
e-value: 6.2E-7
score: 31.5
coord: 964..1095
e-value: 1.3E-19
score: 72.6
NoneNo IPR availableGENE3DG3DSA:1.20.1420.10coord: 2071..2286
e-value: 3.8E-44
score: 152.8
NoneNo IPR availableGENE3DG3DSA:1.20.1420.10coord: 1442..1743
e-value: 2.5E-38
score: 134.1
NoneNo IPR availableGENE3DG3DSA:1.20.1410.10coord: 2476..2666
e-value: 5.5E-57
score: 194.4
NoneNo IPR availableGENE3DG3DSA:1.20.1420.10coord: 496..689
e-value: 3.5E-30
score: 106.9
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 82..200
e-value: 4.4E-40
score: 138.5
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 1..81
e-value: 1.9E-12
score: 49.4
NoneNo IPR availableGENE3DG3DSA:1.20.120.230coord: 1542..1673
e-value: 2.5E-38
score: 134.1
NoneNo IPR availableGENE3DG3DSA:1.20.120.230coord: 822..963
e-value: 6.6E-13
score: 50.6
NoneNo IPR availableGENE3DG3DSA:1.20.1420.10coord: 1111..1280
e-value: 3.6E-8
score: 35.7
NoneNo IPR availablePANTHERPTHR10407:SF19coord: 3..2373
NoneNo IPR availablePANTHERPTHR10407:SF19coord: 2437..2715
NoneNo IPR availablePRODOMPD011820coord: 2516..2720
e-value: 1.0E-38
score: 412.0
NoneNo IPR availableCDDcd17089FERM_F0_TLNcoord: 3..86
e-value: 2.38206E-13
score: 65.7416
NoneNo IPR availableCDDcd17090FERM_F1_TLNcoord: 87..197
e-value: 7.16017E-41
score: 145.173
NoneNo IPR availableCDDcd10569FERM_C_Talincoord: 310..401
e-value: 9.06261E-46
score: 158.274
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 310..400
IPR002558I/LWEQ domainSMARTSM00307ILWEQ_1coord: 2519..2719
e-value: 4.8E-38
score: 142.4
IPR002558I/LWEQ domainPFAMPF01608I_LWEQcoord: 2569..2714
e-value: 2.7E-41
score: 141.3
IPR002558I/LWEQ domainPROSITEPS50945I_LWEQcoord: 2475..2719
score: 41.73
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 83..314
e-value: 3.3E-50
score: 182.8
IPR014352FERM/acyl-CoA-binding protein superfamilyGENE3DG3DSA:1.20.80.10coord: 201..308
e-value: 8.3E-37
score: 127.8
IPR032425Talin, N-terminal F0 domainPFAMPF16511FERM_f0coord: 3..78
e-value: 1.3E-12
score: 47.8
IPR018979FERM, N-terminalPFAMPF09379FERM_Ncoord: 91..185
e-value: 4.7E-14
score: 52.1
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 309..406
e-value: 1.9E-32
score: 113.5
IPR002404IRS-type PTB domainPFAMPF02174IRScoord: 330..397
e-value: 1.2E-4
score: 21.9
IPR015224Talin, centralPFAMPF09141Talin_middlecoord: 504..688
e-value: 2.0E-33
score: 115.7
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 206..314
e-value: 1.6E-22
score: 80.1
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 211..306
e-value: 4.77095E-21
score: 88.0722
IPR030224Sla2 familyPANTHERPTHR10407HUNTINGTIN INTERACTING PROTEIN 1coord: 3..2373
IPR030224Sla2 familyPANTHERPTHR10407HUNTINGTIN INTERACTING PROTEIN 1coord: 2437..2715
IPR000299FERM domainPROSITEPS50057FERM_3coord: 87..404
score: 50.978
IPR035964I/LWEQ domain superfamilySUPERFAMILYSSF109885I/LWEQ domaincoord: 810..934
IPR035964I/LWEQ domain superfamilySUPERFAMILYSSF109885I/LWEQ domaincoord: 1547..1635
IPR035964I/LWEQ domain superfamilySUPERFAMILYSSF109885I/LWEQ domaincoord: 702..805
IPR035964I/LWEQ domain superfamilySUPERFAMILYSSF109885I/LWEQ domaincoord: 2482..2662
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 195..309
IPR036476Talin, central domain superfamilySUPERFAMILYSSF109880A middle domain of Talin 1coord: 501..655