Kinesin-like protein

Overview
NameKinesin-like protein
Smed IDSMED30012267
Length (bp)2458
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin-like protein (SMED30012267) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30012267) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin-like protein (SMED30012267) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30012267) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012267

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
non-ciliated epidermisSMED30012267SMESG000073771.1 dd_Smed_v4_6755_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30012267SMESG000073771.1 dd_Smed_v4_6755_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
head regionSMED30012267SMESG000073771.1 SmedASXL_017540SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30012267SMESG000073771.1 dd_Smed_v4_6755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30012267SMESG000073771.1 dd_Smed_v4_6755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012267SMESG000073771.1 dd_Smed_v4_6755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012267SMESG000073771.1 dd_Smed_v4_6755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012267SMESG000073771.1 dd_Smed_v4_6755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30012267SMESG000073771.1 dd_Smed_v4_6755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30012267SMESG000073771.1 dd_Smed_v4_6755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012267SMESG000073771.1 dd_Smed_v4_6755_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012267SMESG000073771.1 Contig41114newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012267SMESG000073771.1 Contig41114uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012267SMESG000073771.1 Contig5824newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012267SMESG000073771.1 Contig5824uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012267SMESG000022975.1 Contig5824newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012267SMESG000022975.1 Contig5824uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30012267SMESG000073771.1 dd_Smed_v6_6755_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30012267SMESG000073771.1 dd_Smed_v4_6755_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF9 (kinesin family member 9 [Source:HGNC Symbol;Acc:HGNC:16666])

HSP 1 Score: 472.241 bits (1214), Expect = 2.926e-155
Identity = 215/439 (48.97%), Postives = 318/439 (72.44%), Query Frame = 3
Query:   66 KNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLAN--FNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIK 1376
            + KV  F+R +P+  F+++  +  +DK++I IH+ K+ R  +VNNQ ++WSF  DG+ H+  QD ++  +  ++V  AL G N T MCYGQTGAGKT+TM GATEN+ +RG++PRAL  ++R IEE   ++I+VR+SY+EIYNE ++DLL+   +   S + +TIVE+ +G  ++KGL  HL   EE+A + LFEGE+NR  A+H +NK SSRSHC+FT+YLE+ SR  S+  +  +K+  VDLAGSERL K+ S G++L+EA+YINKSLSFLEQ +IAL D++R+HIPFRQ KLTH LKDS+GGNC  +L+ N++ +   +EET+S++RFA RM  VT+EP  N +YD   +V+NL+KE++ LK ELA+HD+L NR  + Y+P+ + Q  +I  QVR+Y+EG + E+DI+++RQI+ V+  F  +    +QE E  ++
Sbjct:    4 RKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQTDWSFKLDGVLHDASQDLVYETVAKDVVSQALDGYNGTIMCYGQTGAGKTYTMMGATENYKHRGILPRALQQVFRMIEERPTHAITVRVSYLEIYNESLFDLLSTLPYVGPSVTPMTIVENPQG-VFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMNKNSSRSHCIFTIYLEAHSRTLSEEKYITSKINLVDLAGSERLGKSGSEGQVLKEATYINKSLSFLEQAIIALGDQKRDHIPFRQCKLTHALKDSLGGNCNMVLVTNIYGEAAQLEETLSSLRFASRMKLVTTEPAINEKYDAERMVKNLEKELALLKQELAIHDSLTNRTFVTYDPMDEIQIAEINSQVRRYLEGTLDEIDIISLRQIKEVFNQFRVVLSQQEQEVESTLR 441          

HSP 2 Score: 116.316 bits (290), Expect = 4.005e-26
Identity = 84/216 (38.89%), Postives = 115/216 (53.24%), Query Frame = 3
Query: 1749 PTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGE-QNFENKANGEGSVGLIY--------EDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQPVRR 2369
            P++  AFEEFK EQG EI+ I  ENK IL+ ++K  S     IN IK EID +   L   K  RE QG  Y N G +II EEEF  I KL D KK YR  Y+DL++L++ I +CQ +VD  R RL+ EFD+WY ES++  E      K  G    G++         ED  +KF  L+       PD  ++  AK  ++ +  + + +   Q   R
Sbjct:  510 PSKPVAFEEFKNEQGSEINRIFKENKSILNERRKRASETTQHINAIKREIDVTKEALNFQKSLREKQG-KYENKGLMIIDEEEFLLILKLKDLKKQYRSEYQDLRDLRAEIQYCQHLVDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKIEQKHNYLKTMMGLQQAHR 724          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF9 (kinesin family member 9 [Source:HGNC Symbol;Acc:HGNC:16666])

HSP 1 Score: 473.396 bits (1217), Expect = 5.736e-155
Identity = 215/439 (48.97%), Postives = 318/439 (72.44%), Query Frame = 3
Query:   66 KNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLAN--FNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIK 1376
            + KV  F+R +P+  F+++  +  +DK++I IH+ K+ R  +VNNQ ++WSF  DG+ H+  QD ++  +  ++V  AL G N T MCYGQTGAGKT+TM GATEN+ +RG++PRAL  ++R IEE   ++I+VR+SY+EIYNE ++DLL+   +   S + +TIVE+ +G  ++KGL  HL   EE+A + LFEGE+NR  A+H +NK SSRSHC+FT+YLE+ SR  S+  +  +K+  VDLAGSERL K+ S G++L+EA+YINKSLSFLEQ +IAL D++R+HIPFRQ KLTH LKDS+GGNC  +L+ N++ +   +EET+S++RFA RM  VT+EP  N +YD   +V+NL+KE++ LK ELA+HD+L NR  + Y+P+ + Q  +I  QVR+Y+EG + E+DI+++RQI+ V+  F  +    +QE E  ++
Sbjct:    4 RKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQTDWSFKLDGVLHDASQDLVYETVAKDVVSQALDGYNGTIMCYGQTGAGKTYTMMGATENYKHRGILPRALQQVFRMIEERPTHAITVRVSYLEIYNESLFDLLSTLPYVGPSVTPMTIVENPQG-VFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMNKNSSRSHCIFTIYLEAHSRTLSEEKYITSKINLVDLAGSERLGKSGSEGQVLKEATYINKSLSFLEQAIIALGDQKRDHIPFRQCKLTHALKDSLGGNCNMVLVTNIYGEAAQLEETLSSLRFASRMKLVTTEPAINEKYDAERMVKNLEKELALLKQELAIHDSLTNRTFVTYDPMDEIQIAEINSQVRRYLEGTLDEIDIISLRQIKEVFNQFRVVLSQQEQEVESTLR 441          

HSP 2 Score: 116.701 bits (291), Expect = 3.823e-26
Identity = 84/216 (38.89%), Postives = 115/216 (53.24%), Query Frame = 3
Query: 1749 PTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGE-QNFENKANGEGSVGLIY--------EDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQPVRR 2369
            P++  AFEEFK EQG EI+ I  ENK IL+ ++K  S     IN IK EID +   L   K  RE QG  Y N G +II EEEF  I KL D KK YR  Y+DL++L++ I +CQ +VD  R RL+ EFD+WY ES++  E      K  G    G++         ED  +KF  L+       PD  ++  AK  ++ +  + + +   Q   R
Sbjct:  575 PSKPVAFEEFKNEQGSEINRIFKENKSILNERRKRASETTQHINAIKREIDVTKEALNFQKSLREKQG-KYENKGLMIIDEEEFLLILKLKDLKKQYRSEYQDLRDLRAEIQYCQHLVDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKIEQKHNYLKTMMGLQQAHR 789          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF9 (kinesin family member 9 [Source:HGNC Symbol;Acc:HGNC:16666])

HSP 1 Score: 473.396 bits (1217), Expect = 5.736e-155
Identity = 215/439 (48.97%), Postives = 318/439 (72.44%), Query Frame = 3
Query:   66 KNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLAN--FNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIK 1376
            + KV  F+R +P+  F+++  +  +DK++I IH+ K+ R  +VNNQ ++WSF  DG+ H+  QD ++  +  ++V  AL G N T MCYGQTGAGKT+TM GATEN+ +RG++PRAL  ++R IEE   ++I+VR+SY+EIYNE ++DLL+   +   S + +TIVE+ +G  ++KGL  HL   EE+A + LFEGE+NR  A+H +NK SSRSHC+FT+YLE+ SR  S+  +  +K+  VDLAGSERL K+ S G++L+EA+YINKSLSFLEQ +IAL D++R+HIPFRQ KLTH LKDS+GGNC  +L+ N++ +   +EET+S++RFA RM  VT+EP  N +YD   +V+NL+KE++ LK ELA+HD+L NR  + Y+P+ + Q  +I  QVR+Y+EG + E+DI+++RQI+ V+  F  +    +QE E  ++
Sbjct:    4 RKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQTDWSFKLDGVLHDASQDLVYETVAKDVVSQALDGYNGTIMCYGQTGAGKTYTMMGATENYKHRGILPRALQQVFRMIEERPTHAITVRVSYLEIYNESLFDLLSTLPYVGPSVTPMTIVENPQG-VFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMNKNSSRSHCIFTIYLEAHSRTLSEEKYITSKINLVDLAGSERLGKSGSEGQVLKEATYINKSLSFLEQAIIALGDQKRDHIPFRQCKLTHALKDSLGGNCNMVLVTNIYGEAAQLEETLSSLRFASRMKLVTTEPAINEKYDAERMVKNLEKELALLKQELAIHDSLTNRTFVTYDPMDEIQIAEINSQVRRYLEGTLDEIDIISLRQIKEVFNQFRVVLSQQEQEVESTLR 441          

HSP 2 Score: 116.701 bits (291), Expect = 3.823e-26
Identity = 84/216 (38.89%), Postives = 115/216 (53.24%), Query Frame = 3
Query: 1749 PTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGE-QNFENKANGEGSVGLIY--------EDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQPVRR 2369
            P++  AFEEFK EQG EI+ I  ENK IL+ ++K  S     IN IK EID +   L   K  RE QG  Y N G +II EEEF  I KL D KK YR  Y+DL++L++ I +CQ +VD  R RL+ EFD+WY ES++  E      K  G    G++         ED  +KF  L+       PD  ++  AK  ++ +  + + +   Q   R
Sbjct:  575 PSKPVAFEEFKNEQGSEINRIFKENKSILNERRKRASETTQHINAIKREIDVTKEALNFQKSLREKQG-KYENKGLMIIDEEEFLLILKLKDLKKQYRSEYQDLRDLRAEIQYCQHLVDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKIEQKHNYLKTMMGLQQAHR 789          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF9 (kinesin family member 9 [Source:HGNC Symbol;Acc:HGNC:16666])

HSP 1 Score: 473.396 bits (1217), Expect = 5.736e-155
Identity = 215/439 (48.97%), Postives = 318/439 (72.44%), Query Frame = 3
Query:   66 KNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLAN--FNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIK 1376
            + KV  F+R +P+  F+++  +  +DK++I IH+ K+ R  +VNNQ ++WSF  DG+ H+  QD ++  +  ++V  AL G N T MCYGQTGAGKT+TM GATEN+ +RG++PRAL  ++R IEE   ++I+VR+SY+EIYNE ++DLL+   +   S + +TIVE+ +G  ++KGL  HL   EE+A + LFEGE+NR  A+H +NK SSRSHC+FT+YLE+ SR  S+  +  +K+  VDLAGSERL K+ S G++L+EA+YINKSLSFLEQ +IAL D++R+HIPFRQ KLTH LKDS+GGNC  +L+ N++ +   +EET+S++RFA RM  VT+EP  N +YD   +V+NL+KE++ LK ELA+HD+L NR  + Y+P+ + Q  +I  QVR+Y+EG + E+DI+++RQI+ V+  F  +    +QE E  ++
Sbjct:    4 RKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQTDWSFKLDGVLHDASQDLVYETVAKDVVSQALDGYNGTIMCYGQTGAGKTYTMMGATENYKHRGILPRALQQVFRMIEERPTHAITVRVSYLEIYNESLFDLLSTLPYVGPSVTPMTIVENPQG-VFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMNKNSSRSHCIFTIYLEAHSRTLSEEKYITSKINLVDLAGSERLGKSGSEGQVLKEATYINKSLSFLEQAIIALGDQKRDHIPFRQCKLTHALKDSLGGNCNMVLVTNIYGEAAQLEETLSSLRFASRMKLVTTEPAINEKYDAERMVKNLEKELALLKQELAIHDSLTNRTFVTYDPMDEIQIAEINSQVRRYLEGTLDEIDIISLRQIKEVFNQFRVVLSQQEQEVESTLR 441          

HSP 2 Score: 116.701 bits (291), Expect = 3.823e-26
Identity = 84/216 (38.89%), Postives = 115/216 (53.24%), Query Frame = 3
Query: 1749 PTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGE-QNFENKANGEGSVGLIY--------EDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQPVRR 2369
            P++  AFEEFK EQG EI+ I  ENK IL+ ++K  S     IN IK EID +   L   K  RE QG  Y N G +II EEEF  I KL D KK YR  Y+DL++L++ I +CQ +VD  R RL+ EFD+WY ES++  E      K  G    G++         ED  +KF  L+       PD  ++  AK  ++ +  + + +   Q   R
Sbjct:  575 PSKPVAFEEFKNEQGSEINRIFKENKSILNERRKRASETTQHINAIKREIDVTKEALNFQKSLREKQG-KYENKGLMIIDEEEFLLILKLKDLKKQYRSEYQDLRDLRAEIQYCQHLVDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKIEQKHNYLKTMMGLQQAHR 789          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF9 (kinesin family member 9 [Source:HGNC Symbol;Acc:HGNC:16666])

HSP 1 Score: 370.933 bits (951), Expect = 1.379e-121
Identity = 167/329 (50.76%), Postives = 241/329 (73.25%), Query Frame = 3
Query:   66 KNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLAN--FNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTM 1046
            + KV  F+R +P+  F+++  +  +DK++I IH+ K+ R  +VNNQ ++WSF  DG+ H+  QD ++  +  ++V  AL G N T MCYGQTGAGKT+TM GATEN+ +RG++PRAL  ++R IEE   ++I+VR+SY+EIYNE ++DLL+   +   S + +TIVE+ +G  ++KGL  HL   EE+A + LFEGE+NR  A+H +NK SSRSHC+FT+YLE+ SR  S+  +  +K+  VDLAGSERL K+ S G++L+EA+YINKSLSFLEQ +IAL D++R+HIPFRQ KLTH LKDS+GGNC  +L+ N++ +   +EET S +
Sbjct:    4 RKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQTDWSFKLDGVLHDASQDLVYETVAKDVVSQALDGYNGTIMCYGQTGAGKTYTMMGATENYKHRGILPRALQQVFRMIEERPTHAITVRVSYLEIYNESLFDLLSTLPYVGPSVTPMTIVENPQG-VFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMNKNSSRSHCIFTIYLEAHSRTLSEEKYITSKINLVDLAGSERLGKSGSEGQVLKEATYINKSLSFLEQAIIALGDQKRDHIPFRQCKLTHALKDSLGGNCNMVLVTNIYGEAAQLEETGSRL 331          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: osm-3 (Osmotic avoidance abnormal protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P46873])

HSP 1 Score: 222.246 bits (565), Expect = 3.513e-62
Identity = 131/314 (41.72%), Postives = 177/314 (56.37%), Query Frame = 3
Query:  219 FPFDGI-FHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALK 1154
            F FDG  F +   + ++N I   LV + + G N T   YGQTG+GKTF+M G       RG+IPRA  +++       N    V  SY+EIYNE V DLL   N +    L I E      +V GL  H+          +  G +NR   A ++NK SSRSH +FTVY+E    M    +  + KL  VDLAGSER  KT +TG  L+EA+ IN SLS L   + AL D + +HIP+R SKLT  L+DS+GGN KTI+IA V    ++ +ET+ST+R+A R   + ++P   I  DP   L+R  Q+EI+ LK
Sbjct:   20 FTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQRGVIPRAFDHIFTATATTENVKFLVHCSYLEIYNEEVRDLLGADNKQK---LEIKEQPDRGVYVAGLSMHVCHDVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVEG---MTETGSIRMGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKP--TINEDPKDALLREYQEEIARLK 325          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: osm-3 (Osmotic avoidance abnormal protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P46873])

HSP 1 Score: 221.861 bits (564), Expect = 8.371e-62
Identity = 131/314 (41.72%), Postives = 177/314 (56.37%), Query Frame = 3
Query:  219 FPFDGI-FHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALK 1154
            F FDG  F +   + ++N I   LV + + G N T   YGQTG+GKTF+M G       RG+IPRA  +++       N    V  SY+EIYNE V DLL   N +    L I E      +V GL  H+          +  G +NR   A ++NK SSRSH +FTVY+E    M    +  + KL  VDLAGSER  KT +TG  L+EA+ IN SLS L   + AL D + +HIP+R SKLT  L+DS+GGN KTI+IA V    ++ +ET+ST+R+A R   + ++P   I  DP   L+R  Q+EI+ LK
Sbjct:   48 FTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQRGVIPRAFDHIFTATATTENVKFLVHCSYLEIYNEEVRDLLGADNKQK---LEIKEQPDRGVYVAGLSMHVCHDVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVEG---MTETGSIRMGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKP--TINEDPKDALLREYQEEIARLK 353          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-11 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:E5QCG4])

HSP 1 Score: 222.631 bits (566), Expect = 1.674e-61
Identity = 143/383 (37.34%), Postives = 213/383 (55.61%), Query Frame = 3
Query:   57 IMRKNK----VQVFLRTRP--SQKFSYDFFKI---QEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESN--LTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHEL 1163
            IM+K+     V+V +R RP  SQ+ + ++ KI   +  +  I +  PKE+          +  F FD I+  N  Q DL+ +   +LV S L+G N+T   YGQTG GKT TM G + +   RG+I + + +++  +    N    VR SY+EIY E + DLL     E+ESN  L I E   G  +VK L   L +T  E    +  G  +R+     +N+ SSRSH +F + +E SR     +++ +V +L  VDLAGSER  KT +TG+  +EA+ IN SLS L   + AL D +  HIP+R SKLT  L+DS+GGN KT+++A +     + EET+ T+R+A R   + ++P   I  DP   L+R  Q+EI  L+ +L
Sbjct:    4 IMKKSSKQETVKVIVRCRPLSSQEIANNYSKIVHMRPQRGQIELKNPKEQDE-------PSKDFTFDAIYDENSTQSDLYEETFRDLVDSVLNGYNATIFAYGQTGTGKTHTMEGKSSDPEQRGVIYKCIDHIFEHMAASHNQEYLVRASYLEIYQEELRDLL-----EAESNKKLEIKERPDGGVYVKDLTSKLTRTVGEIHEVMIRGNGHRSVGRTNMNEHSSRSHAIFIITVECSRIGEDGESHITVGRLNLVDLAGSERQSKTGATGERFKEATKINLSLSALGNVISALVDAKSAHIPYRDSKLTRLLQDSLGGNSKTVMVACIGPASYNFEETLGTLRYANRAKNIKNQP--KINEDPKDALLREFQEEIEMLREQL 372          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 203.756 bits (517), Expect = 1.024e-55
Identity = 138/368 (37.50%), Postives = 200/368 (54.35%), Query Frame = 3
Query:   72 KVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNN---QISNWSFPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEE-DLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLES-RSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALK 1154
            KV+V +R RP         K+Q  K  I +    EE++  + +   +    +F FD +F  N  Q  ++N     +V + L G N T   YGQTG GKTFTM G  E    RG+IP + ++++  I +   + +  VR+SY+EIYNE + DLL+    +   NL I E      +V+ L     +   +    +  G  NR   A  +N  SSRSH +FTV +ES R+ + +Q      KLQ VDLAGSER  KT + G+ L+EA+ IN SLS L   + +L D +  HIP+R SKLT  L+DS+GGN KT++IANV     + +ET+ST+R+A R   + +  +  I  DP    +R  Q EI AL+
Sbjct:    6 KVKVVVRCRPISTTE----KLQGHK--IAVTCNDEEKAVNIKSLSQEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLLSK---DHNGNLEIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTIESCRNGLVTQG-----KLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYANRAKNIQN--VAKINEDPKDAQLRKFQLEIEALR 357          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: klp-20 (Kinesin-like protein klp-20 [Source:UniProtKB/Swiss-Prot;Acc:Q965T6])

HSP 1 Score: 203.756 bits (517), Expect = 1.024e-55
Identity = 138/368 (37.50%), Postives = 200/368 (54.35%), Query Frame = 3
Query:   72 KVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNN---QISNWSFPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEE-DLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLES-RSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALK 1154
            KV+V +R RP         K+Q  K  I +    EE++  + +   +    +F FD +F  N  Q  ++N     +V + L G N T   YGQTG GKTFTM G  E    RG+IP + ++++  I +   + +  VR+SY+EIYNE + DLL+    +   NL I E      +V+ L     +   +    +  G  NR   A  +N  SSRSH +FTV +ES R+ + +Q      KLQ VDLAGSER  KT + G+ L+EA+ IN SLS L   + +L D +  HIP+R SKLT  L+DS+GGN KT++IANV     + +ET+ST+R+A R   + +  +  I  DP    +R  Q EI AL+
Sbjct:    6 KVKVVVRCRPISTTE----KLQGHK--IAVTCNDEEKAVNIKSLSQEDPPRTFYFDAVFSPNTDQMTVYNVAARPIVENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFLVRVSYLEIYNEEIRDLLSK---DHNGNLEIKERPDVGVYVRNLSNPTVENASKMQALMEFGSKNRKVGATAMNLESSRSHAMFTVTIESCRNGLVTQG-----KLQLVDLAGSERQSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMIANVGPATYNYDETLSTLRYANRAKNIQN--VAKINEDPKDAQLRKFQLEIEALR 357          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp64D (gene:FBgn0004380 transcript:FBtr0077157)

HSP 1 Score: 207.994 bits (528), Expect = 6.460e-57
Identity = 138/384 (35.94%), Postives = 206/384 (53.65%), Query Frame = 3
Query:   75 VQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIV--NNQISN---WSFPFDGIFHNVP-QDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEE-DLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQ--ANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRM------MKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDAL 1181
            V+V +RTRP  K       +        I + K  R+  V   N  +N    ++ FD +F     Q DL+      +V   L G N T + YGQTG GKT+TM+G  ++   +G+IP A ++++  I +   N    VR+SY+EIYNE V DLL     +   +L + E      +VK L  ++    ++  N +  G  NR   A  +N+ SSRSH +F++ +E RS +      +  + KLQ VDLAGSER  KTQ++G+ L+EA+ IN SLS L   + AL D +  HIP+R SKLT  L+DS+GGN KT++ A +     +  ETIST+R+A R       M +  EP +        L+R+ Q+EI+ L+ +L   D+L
Sbjct:   21 VRVVVRTRPMDKNELSAGALSA------ISVDKINRAITVMKPNATANEPPKTYYFDNVFDGGSNQMDLYVDTARPIVDKVLEGYNGTILAYGQTGTGKTYTMSGNPDSPQTKGIIPNAFAHIFGHIAKAKENQKFLVRVSYMEIYNEEVRDLLGK---DVGKSLEVKERPDIGVFVKDLSGYVVHNADDLENIMRLGNKNRAVGATKMNQESSRSHAIFSITVE-RSELGEGDVQHVRMGKLQLVDLAGSERQSKTQASGQRLKEATKINLSLSVLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMCATISPADSNYMETISTLRYASRAKNIQNRMHINEEPKD-------ALLRHFQEEIARLRKQLEEGDSL 387          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Kif3C (gene:FBgn0039925 transcript:FBtr0089196)

HSP 1 Score: 195.667 bits (496), Expect = 9.475e-53
Identity = 126/324 (38.89%), Postives = 178/324 (54.94%), Query Frame = 3
Query:  219 FPFDGIFHNVPQDD--LFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNR-GLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQAN-----FSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHEL 1163
            F FD ++ N+  D   +++++   LV S + G N T   YGQTG GKT TM G  ENF+N  G+IP+   +++ RI    N      ++Y+EIYNE + DLL      +  N  + E       V  L         +  ++L  G  NR TAA ++NK SSRSH +FT+ LE    + S  +         KL  VDLAGSER +KT + G  L+EAS IN SLS L   + +L D + +H+PFR SKLT  L+DS+GGN KT++I+ +     H +ETIST+R+A R   ++++P   I  DP    +R  Q EI  LK  L
Sbjct:   49 FIFDSVY-NMKTDTEVIYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQG-DENFSNSTGIIPKCFDHIFERISMTTNVRYLALVTYLEIYNERIRDLLNKNENTNVINHFLKELPGIGVSVPTLTTQPVVNANQCYDWLHFGNKNRVTAATLMNKNSSRSHTIFTITLEQSPFLNSIGSDAFGGICRGKLSLVDLAGSERQRKTGAQGDRLKEASQINLSLSALGNVISSLVDGKAKHVPFRDSKLTRLLQDSLGGNTKTLMISCISPTDIHYDETISTLRYASRAKNISNKP--KINEDPKDARLRQYQNEILYLKRML 368          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp31E (gene:FBgn0032243 transcript:FBtr0331642)

HSP 1 Score: 192.2 bits (487), Expect = 2.404e-50
Identity = 125/347 (36.02%), Postives = 191/347 (55.04%), Query Frame = 3
Query:  207 SNWSFPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTM-TG-----ATENFNNRGLIPRALSNLYRRIEEDLNYS------------ISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFS-------VAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQRE--HIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHEL 1163
            S+ +F FD +F  N  Q D+++    +LV S L G N+T + YGQTG+GKT+TM TG      + +    G+IPRA+ +++  IE+    S             S+ + Y+E+YNE ++DLL  FN    SN  I ED  G   + G          +AL +L +G   RTTA+  +N +SSRSH +FT+++  +  +    N          +K  FVDLAGSERL++TQ+TG+  +E   IN  L  L   + AL DK +   H+P+R SKLT  L+DS+GGN +T++IA V        ET++T+++A R   + ++   N Q      +  L++EI+AL+ EL
Sbjct:   49 SDKAFTFDYVFDTNSNQCDIYSDCVEKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGIIPRAVRHIFSGIEQLEGSSTSEHPAAGGSPQFSLAVQYIELYNEDIFDLLDPFN--KNSNFKIHEDASGQITISGASIKPIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTIFVRRQRLLTPSDNVPDNDLETLTSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALGDKSKRALHVPYRDSKLTRLLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKYANRARNIKNKVKIN-QDQSSRTISQLRREIAALQLEL 392          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp31E (gene:FBgn0032243 transcript:FBtr0302039)

HSP 1 Score: 192.2 bits (487), Expect = 2.568e-50
Identity = 125/347 (36.02%), Postives = 191/347 (55.04%), Query Frame = 3
Query:  207 SNWSFPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTM-TG-----ATENFNNRGLIPRALSNLYRRIEEDLNYS------------ISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFS-------VAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQRE--HIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHEL 1163
            S+ +F FD +F  N  Q D+++    +LV S L G N+T + YGQTG+GKT+TM TG      + +    G+IPRA+ +++  IE+    S             S+ + Y+E+YNE ++DLL  FN    SN  I ED  G   + G          +AL +L +G   RTTA+  +N +SSRSH +FT+++  +  +    N          +K  FVDLAGSERL++TQ+TG+  +E   IN  L  L   + AL DK +   H+P+R SKLT  L+DS+GGN +T++IA V        ET++T+++A R   + ++   N Q      +  L++EI+AL+ EL
Sbjct:   49 SDKAFTFDYVFDTNSNQCDIYSDCVEKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGIIPRAVRHIFSGIEQLEGSSTSEHPAAGGSPQFSLAVQYIELYNEDIFDLLDPFN--KNSNFKIHEDASGQITISGASIKPIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTIFVRRQRLLTPSDNVPDNDLETLTSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALGDKSKRALHVPYRDSKLTRLLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKYANRARNIKNKVKIN-QDQSSRTISQLRREIAALQLEL 392          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Klp31E (gene:FBgn0032243 transcript:FBtr0080018)

HSP 1 Score: 192.2 bits (487), Expect = 2.568e-50
Identity = 125/347 (36.02%), Postives = 191/347 (55.04%), Query Frame = 3
Query:  207 SNWSFPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTM-TG-----ATENFNNRGLIPRALSNLYRRIEEDLNYS------------ISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFS-------VAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQRE--HIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHEL 1163
            S+ +F FD +F  N  Q D+++    +LV S L G N+T + YGQTG+GKT+TM TG      + +    G+IPRA+ +++  IE+    S             S+ + Y+E+YNE ++DLL  FN    SN  I ED  G   + G          +AL +L +G   RTTA+  +N +SSRSH +FT+++  +  +    N          +K  FVDLAGSERL++TQ+TG+  +E   IN  L  L   + AL DK +   H+P+R SKLT  L+DS+GGN +T++IA V        ET++T+++A R   + ++   N Q      +  L++EI+AL+ EL
Sbjct:   49 SDKAFTFDYVFDTNSNQCDIYSDCVEKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGIIPRAVRHIFSGIEQLEGSSTSEHPAAGGSPQFSLAVQYIELYNEDIFDLLDPFN--KNSNFKIHEDASGQITISGASIKPIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTIFVRRQRLLTPSDNVPDNDLETLTSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALGDKSKRALHVPYRDSKLTRLLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKYANRARNIKNKVKIN-QDQSSRTISQLRREIAALQLEL 392          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif9 (kinesin family member 9 [Source:ZFIN;Acc:ZDB-GENE-160728-129])

HSP 1 Score: 509.22 bits (1310), Expect = 2.368e-169
Identity = 292/775 (37.68%), Postives = 441/775 (56.90%), Query Frame = 3
Query:   75 VQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFN---PESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQSRK----KERKRLIMNSKASNI----VSKDEFVNER---LGGSSEKIIEVPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGEQNFENKANGEGSVGLIYEDPIEKFDTLKHSKYEGKPDEE---------AYNRAKESLKHRKI 2330
            V+V++R RP+  F+++  +   D++T+ +   K  +    NN +    F  +G+ +NV Q+DL++++   +V  A  G N T MC+GQTGAGKT+TMTGA E +  RG+IPRA+  +++ +E+  +Y+ SV +S++EIYNE + DLL++            T+VE+  G   VKGL  HL   EEEALN LFEGE NR    H LNK SSRSHC+FT+++ESRSR  S+A +  +KL  VDLAGSERL KT S G++  EA YINKSLSFLEQ ++AL+D +REH+PFRQSKLTH LKDS+GGNC T+L+AN++ D   +EET+ST+RFA RM  V ++P  N   DP+I V+ L+KEI  LK EL+ ++ L NR  +  E LS+ Q  ++R QV++Y+ G + E+ IV+  QI+ V+  F  +    +++ +EQ+                        ++N R +K   +T    S          ++    VG+++ + G+G+G A  +   +     +S K    K+  R  + ++ SN+    +S+ +    +   L          P ++EAFE+FK EQG EI+ IL ENK +LS +  +   L N IN  K EID     L   + +R+ QG   + DGE ++  EE   + KL + K  YR+ YE+L+  ++ I +C  +V+  R RL+ EF+ WY ES+L   +      NG    G I   P++K  TL       +P  +         AYNR  +    R++
Sbjct:    8 VKVYIRIRPTASFAHELIECLPDQQTLRVRSRKGSKKGKRNNHV--RLFQLNGVLYNVSQEDLYDRVARSVVLGAFKGYNGTIMCFGQTGAGKTYTMTGAAETYKQRGIIPRAIQEVFQEVEQRADYTFSVHLSFLEIYNETMVDLLSSLKQGKAPGSGLFTVVEEPGGGVSVKGLSVHLVHNEEEALNLLFEGEMNRIIGEHALNKHSSRSHCIFTIHIESRSRTLSEAKYITSKLNLVDLAGSERLSKTGSEGQVQMEAMYINKSLSFLEQVILALADSRREHVPFRQSKLTHALKDSLGGNCNTVLVANIYGDASQIEETLSTLRFATRMKCVQTKPSINEHIDPVIQVKRLEKEIQFLKEELSSYNPLTNR--LTNEILSETQVEEVRTQVQRYLSGSLDEIPIVSSTQIQEVFSQFKKVMLEQQKKLQEQL-----------------------CQRNTRVEKAMNTTPSTVS----------EKSEGAVGEVE-SYGYGLGLAKSSQRHQQAVSPKSSKARNDKQINRKEVAAENSNVQPLTMSESDLTTHKPQPLEEQQPTTDSPPPKAEAFEDFKAEQGSEINRILKENKAVLSERTSQLRALTNVINVTKREIDHITSDLRQFREQRQGQGEFMSADGEPVLEVEELSLVMKLKELKNRYRQTYEELRTTETEIRYCAHLVNQCRMRLLTEFENWYNESFLLPGEVLSVLENGPVRPGHI---PVDKALTLMEDDDPQEPHADTSSAVSYYNAYNRTLQRRGSRQV 741          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif6 (kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-061027-130])

HSP 1 Score: 298.516 bits (763), Expect = 6.717e-89
Identity = 157/379 (41.42%), Postives = 236/379 (62.27%), Query Frame = 3
Query:   60 MRKNKVQVFLRTRPSQKFSYDFFK-IQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESN-------LTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAM 1169
            M K  +++F R +P++K + ++F    E   ++   +P++     +NN+  N+ F F  +F     Q+++F  I   +  + L+G N T   YGQTG+GKTFT+TG  E++N+RG+IPR LS LYR    +     +  ISY+EIYNE  YDLL   NP+ E++       +TI+ED   +  +K L    +  EEEALN LF G++NR  A   +N+ S+RSHC+FT++L S+      A    +KL  VDLAGSER+ KT   G+IL EA YIN SL +LEQ +IALS+K R HIP+R S +T  L+DS+GGNC T +IA V  + +++ E++ST RFA R+  + +E + N + DP +L+ +L+KE  +LK +LA+
Sbjct:    1 MVKQTIEIFARVKPTKKPTSEYFADCDEQGGSLLFLVPRDAADGFINNKRENYKFRFQKVFDQTASQEEVFENIAKPVADNVLAGYNGTIFAYGQTGSGKTFTITGGAEHYNDRGIIPRTLSYLYRYFSMNNTMIYTTHISYLEIYNESGYDLL---NPQHEASRLEDLPRVTIMEDPDQNIHLKNLSLLQSANEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLCSKEL--GSARVRCSKLHLVDLAGSERVGKTGVGGQILTEAKYINLSLHYLEQVIIALSEKDRSHIPYRNSMMTSVLRDSLGGNCMTTMIATVSVEKKNIGESLSTCRFAQRVALIKNEALLNEELDPALLIVHLKKENQSLKEQLAL 374          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif9 (kinesin family member 9 [Source:ZFIN;Acc:ZDB-GENE-160728-129])

HSP 1 Score: 215.312 bits (547), Expect = 7.218e-60
Identity = 100/238 (42.02%), Postives = 149/238 (62.61%), Query Frame = 3
Query:   75 VQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANF---NPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQ 779
            V+V++R RP+  F+++  +   D++T+ +   K  +    NN +    F  +G+ +NV Q+DL++++   +V  A  G N T MC+GQTGAGKT+TMTGA E +  RG+IPRA+  +++ +E+  +Y+ SV +S++EIYNE + DLL++            T+VE+  G   VKGL  HL   EEEALN LFEGE NR    H LNK SSRSHC+FT+++ESRSR  S+      + Q
Sbjct:    8 VKVYIRIRPTASFAHELIECLPDQQTLRVRSRKGSKKGKRNNHVR--LFQLNGVLYNVSQEDLYDRVARSVVLGAFKGYNGTIMCFGQTGAGKTYTMTGAAETYKQRGIIPRAIQEVFQEVEQRADYTFSVHLSFLEIYNETMVDLLSSLKQGKAPGSGLFTVVEEPGGGVSVKGLSVHLVHNEEEALNLLFEGEMNRIIGEHALNKHSSRSHCIFTIHIESRSRTLSETQVEEVRTQ 243          

HSP 2 Score: 126.716 bits (317), Expect = 8.330e-30
Identity = 107/393 (27.23%), Postives = 182/393 (46.31%), Query Frame = 3
Query: 1212 LSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQSRK----KERKRLIMNSKASNI----VSKDEFVNER---LGGSSEKIIEVPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGEQNFENKANGEGSVGLIYEDPIEKFDTLKHSKYEGKPDEE---------AYNRAKESLKHRKI 2330
            LS+ Q  ++R QV++Y+ G + E+ IV+  QI+ V+  F  +    +++ +EQ+                        ++N R +K   +T    S          ++    VG+++ + G+G+G A  +   +     +S K    K+  R  + ++ SN+    +S+ +    +   L          P ++EAFE+FK EQG EI+ IL ENK +LS +  +   L N IN  K EID     L   + +R+ QG   + DGE ++  EE   + KL + K  YR+ YE+L+  ++ I +C  +V+  R RL+ EF+ WY ES+L   +      NG    G I   P++K  TL       +P  +         AYNR  +    R++
Sbjct:  232 LSETQVEEVRTQVQRYLSGSLDEIPIVSSTQIQEVFSQFKKVMLEQQKKLQEQL-----------------------CQRNTRVEKAMNTTPSTVS----------EKSEGAVGEVE-SYGYGLGLAKSSQRHQQAVSPKSSKARNDKQINRKEVAAENSNVQPLTMSESDLTTHKPQPLEEQQPTTDSPPPKAEAFEDFKAEQGSEINRILKENKAVLSERTSQLRALTNVINVTKREIDHITSDLRQFREQRQGQGEFMSADGEPVLEVEELSLVMKLKELKNRYRQTYEELRTTETEIRYCAHLVNQCRMRLLTEFENWYNESFLLPGEVLSVLENGPVRPGHI---PVDKALTLMEDDDPQEPHADTSSAVSYYNAYNRTLQRRGSRQV 587          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif15 (kinesin family member 15 [Source:ZFIN;Acc:ZDB-GENE-050622-16])

HSP 1 Score: 214.927 bits (546), Expect = 9.573e-58
Identity = 144/387 (37.21%), Postives = 211/387 (54.52%), Query Frame = 3
Query:   69 NKVQVFLRTRP-------SQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATE--NFNN--RGLIPRALSNLYRRIEEDL-----NYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSD----KQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELA 1166
            + ++VF+R RP       S    +         +T+ +H   E R+           F +D +   N  Q+++F+ +   +V S ++G N T   YGQTG+GKTFTM G +E  NF++  RG+IPR+   L+  I  ++       S   + S++EIYNE +YDLL + +    ++L + ED K   +V+G     A +  EA   L  G  NR  A+  +N+ SSRSH VFT+ LES+   Q   N   ++L  VDLAGSER + T + G  L+EAS IN+SL  L Q ++AL D    K R HI +R SKLT  L+DS+GGN KT +IANV    +   ET+ST++FA R   + ++ + N   D    VR LQ E+  LK +LA
Sbjct:   18 DAIKVFVRVRPLTQGTGLSTDGDHSLCLTVSSPQTVRLHCKPEPRT-----------FTYDHVADMNTSQEEVFSSVAKNIVESCMNGYNGTIFAYGQTGSGKTFTMLGPSELDNFSDELRGVIPRSFEYLFFLINREVERSGGTKSFLCKCSFIEIYNEQIYDLLDSVS----TSLFLREDIKRGVFVEGSVEKYAASAAEAYQVLSMGWRNRRVASTSMNRESSRSHAVFTMTLESKETGQEVVNIRTSQLNLVDLAGSERQRDTHTEGSRLKEASSINRSLMCLGQVIMALMDVSNGKNR-HICYRDSKLTFLLRDSLGGNAKTYIIANVHPGSKCFGETLSTLQFAQRAKLIKNKAMVN--EDTQGNVRQLQAEVRKLKEQLA 386          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif3cb (kinesin family member 3Cb [Source:ZFIN;Acc:ZDB-GENE-080709-4])

HSP 1 Score: 211.075 bits (536), Expect = 2.200e-57
Identity = 124/334 (37.13%), Postives = 188/334 (56.29%), Query Frame = 3
Query:  216 SFPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHELAMHDALRNRGHIAYE 1208
            SF FD ++  +  Q++L++     L+ S L G N T   YGQTG GKT+TM G   +   RG+IP +  +++ +I    N    VR+SY+EIY E + DLL   N      L + E+ +   +VK L C + +  +E  + +  G  +R+     +N+RSSRSH +F + +E S   +  + +  V KL  VDLAGSER  KT   G+  +EA+ IN SLS L   + AL D +  H+P+R SKLT  L+DS+GGN KT+++A V     + +ET++T+R+A R   + ++P   I  DP   L+R  Q+EI+ LK +      L  RG +A E
Sbjct:   67 SFTFDAVYDVSSKQNELYDYACKPLIDSVLLGFNGTIFAYGQTGTGKTYTMEGVPTDPETRGVIPNSFQHIFTQISRSQNQQYLVRVSYIEIYQEEIRDLLCKDN---NKKLELKENPELGVYVKDLSCVVTKNIKEIEHVMNLGNQSRSVGFTKMNERSSRSHAIFVITIECSEMGIDGEDHIRVGKLNMVDLAGSERQSKTGVQGRRFKEAAKINLSLSALGNVISALVDGKSTHVPYRDSKLTRLLQDSLGGNAKTVMVATVGPASCYYDETLTTLRYANRAKNIKNKP--KINEDPKDALLREFQEEIARLKAQ------LEERGMLAKE 389          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kif15 (kinesin family member 15 [Source:Xenbase;Acc:XB-GENE-1005654])

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 294/706 (41.64%), Postives = 443/706 (62.75%), Query Frame = 3
Query:   63 RKNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANF--NPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYD----PLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQSRKKERKRLIMNSKASNIVSKDEFVNERLGGSSEKIIEVPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYL 2162
            R + V+VF+R +P+  F+++  +  ED KT+ IHI K++R  +VNN+ S+WSF  DG+ HN  QD +++ +   +V  AL G N T MCYGQTGAGKT+T+TG TEN+  RG+IPRAL  +++ IE   + SI+VRISY+EIYNE +YDLL+     P  ++ +TIV+D +G   +KGL  HLA  EE+ALN LFEGE+NR   +HILNK SSRSHC+FT+++ES SR+ S A ++++K+  VDLAGSERL KT S  ++L+E +YINKSLSFLEQT+IAL+D+ R+HIPFRQSKLTH LKDS+GGNC TIL+AN++ ++  + ET+S+      +  + S+ I  I       P  + RNLQKEI  L+ ELA+ D L N   ++YEP ++ Q  +I  QVR+Y++G++ E+DI+N+RQI+ ++  F  +    ++  E ++                            R++   +      +     +   +      VG++D +S FG+G A   +  +    L +RK + ++    S+  N+   + F++  L  S       P +  AFE+FK E+G E++ I  ENK IL+++K++   +  +IN IK E+D++   L   K ERE QG     +G++II E+EF  I +L D KK YR  YE+L++L++ + +CQK+VD  RQRL+ EF+ WY ES++
Sbjct:    4 RPSTVRVFVRVKPTPNFAHEIIRFGEDNKTVDIHIKKDDRLGVVNNKRSDWSFKVDGLLHNASQDTVYDTVAKSVVSKALDGYNGTVMCYGQTGAGKTYTITGGTENYQLRGIIPRALQQVFKEIEGKSDQSITVRISYLEIYNETLYDLLSTVPDAPAPDTQMTIVDDAQG-VIIKGLSLHLASNEEQALNLLFEGETNRMIGSHILNKNSSRSHCIFTIHVESHSRIISDAKYTISKINLVDLAGSERLGKTGSEEQVLKETTYINKSLSFLEQTIIALTDRSRDHIPFRQSKLTHALKDSLGGNCNTILVANIYGEVSQLSETVSSCN----LKPIGSDVILLILTPGFPFPQRVARNLQKEIDHLRQELAVRDTLTNHARVSYEPFNESQIAEINAQVRRYLDGKVDEIDILNLRQIQEIFNQFKLILSQQEKAAEARL----------------------------RQKYTLIDKTDFVTVTAAQKAGLLDADGLMVGEVDGHS-FGIGVAP--VSSKASSSLSARKPKSRKSKERSRIHNL---NFFIS--LFSSP------PPKPSAFEDFKAERGSELNRIFKENKAILADRKRKLKDVTQRINLIKKEMDDTSHTLNVAKVEREKQGEYINEEGQVIIDEQEFILIVRLKDLKKQYRADYEELQDLRAEVQYCQKLVDQCRQRLLTEFEAWYNESFV 662          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kif15 (kinesin family member 15 [Source:Xenbase;Acc:XB-GENE-1005654])

HSP 1 Score: 488.804 bits (1257), Expect = 1.399e-160
Identity = 222/440 (50.45%), Postives = 320/440 (72.73%), Query Frame = 3
Query:   63 RKNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANF--NPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIK 1376
            R + V+VF+R +P+  F+++  +  ED KT+ IHI K++R  +VNN+ S+WSF  DG+ HN  QD +++ +   +V  AL G N T MCYGQTGAGKT+T+TG TEN+  RG+IPRAL  +++ IE   + SI+VRISY+EIYNE +YDLL+     P  ++ +TIV+D +G   +KGL  HLA  EE+ALN LFEGE+NR   +HILNK SSRSHC+FT+++ES SR+ S A ++++K+  VDLAGSERL KT S  ++L+E +YINKSLSFLEQT+IAL+D+ R+HIPFRQSKLTH LKDS+GGNC TIL+AN++ ++  + ET+ST+RFA RM  + +E +    YDP+ + RNLQKEI  L+ ELA+ D L N   ++YEP ++ Q  +I  QVR+Y++G++ E+DI+N+RQI+ ++  F  +    ++  E +++
Sbjct:    8 RPSTVRVFVRVKPTPNFAHEIIRFGEDNKTVDIHIKKDDRLGVVNNKRSDWSFKVDGLLHNASQDTVYDTVAKSVVSKALDGYNGTVMCYGQTGAGKTYTITGGTENYQLRGIIPRALQQVFKEIEGKSDQSITVRISYLEIYNETLYDLLSTVPDAPAPDTQMTIVDDAQG-VIIKGLSLHLASNEEQALNLLFEGETNRMIGSHILNKNSSRSHCIFTIHVESHSRIISDAKYTISKINLVDLAGSERLGKTGSEEQVLKETTYINKSLSFLEQTIIALTDRSRDHIPFRQSKLTHALKDSLGGNCNTILVANIYGEVSQLSETLSTLRFASRMKCIPAESVVIEHYDPVRVARNLQKEIDHLRQELAVRDTLTNHARVSYEPFNESQIAEINAQVRRYLDGKVDEIDILNLRQIQEIFNQFKLILSQQEKAAEARLR 446          

HSP 2 Score: 125.946 bits (315), Expect = 4.271e-29
Identity = 80/231 (34.63%), Postives = 129/231 (55.84%), Query Frame = 3
Query: 1764 AFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGEQNFENKANGEGSV--GLIY--------EDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQPVRRNPGTPIVINKTNNSLPKEM 2426
            AFE+FK E+G E++ I  ENK IL+++K++   +  +IN IK E+D++   L   K ERE QG     +G++II E+EF  I +L D KK YR  YE+L++L++ + +CQK+VD  RQRL+ EF+ WY ES++  E + +      GS+  GLI         ED  E+ + L+       P    ++ A+ +++ +  +  A  Q  P ++ P    +I  T  + P  M
Sbjct:  590 AFEDFKAERGSELNRIFKENKAILADRKRKLKDVTQRINLIKKEMDDTSHTLNVAKVEREKQGEYINEEGQVIIDEQEFILIVRLKDLKKQYRADYEELQDLRAEVQYCQKLVDQCRQRLLTEFEAWYNESFVIPE-DMQTLLKLGGSIRPGLIPANKLLELGEDEQERLERLQQELLMEVPGSLPFHNARSNVEKKYKYSRAAAQITPSKKKPS---LITSTVKNKPPSM 816          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kif15 (kinesin family member 15 [Source:Xenbase;Acc:XB-GENE-1005654])

HSP 1 Score: 456.062 bits (1172), Expect = 2.932e-148
Identity = 216/444 (48.65%), Postives = 313/444 (70.50%), Query Frame = 3
Query:   63 RKNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANF--NPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYD----PLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIK 1376
            R + V+VF+R +P+  F+++  +  ED KT+ IHI K++R  +VNN+ S+WSF  DG+ HN  QD +++ +   +V  AL G N T MCYGQTGAGKT+T+TG TEN+  RG+IPRAL  +++ IE   + SI+VRISY+EIYNE +YDLL+     P  ++ +TIV+D +G   +KGL  HLA  EE+ALN LFEGE+NR   +HILNK SSRSHC+FT+++ES SR+ S A ++++K+  VDLAGSERL KT S  ++L+E +YINKSLSFLEQT+IAL+D+ R+HIPFRQSKLTH LKDS+GGNC TIL+AN++ ++  + ET+S+      +  + S+ I  I       P  + RNLQKEI  L+ ELA+ D L N   ++YEP ++ Q  +I  QVR+Y++G++ E+DI+N+RQI+ ++  F  +    ++  E +++
Sbjct:    4 RPSTVRVFVRVKPTPNFAHEIIRFGEDNKTVDIHIKKDDRLGVVNNKRSDWSFKVDGLLHNASQDTVYDTVAKSVVSKALDGYNGTVMCYGQTGAGKTYTITGGTENYQLRGIIPRALQQVFKEIEGKSDQSITVRISYLEIYNETLYDLLSTVPDAPAPDTQMTIVDDAQG-VIIKGLSLHLASNEEQALNLLFEGETNRMIGSHILNKNSSRSHCIFTIHVESHSRIISDAKYTISKINLVDLAGSERLGKTGSEEQVLKETTYINKSLSFLEQTIIALTDRSRDHIPFRQSKLTHALKDSLGGNCNTILVANIYGEVSQLSETVSS----CNLKPIGSDVILLILTPGFPFPQRVARNLQKEIDHLRQELAVRDTLTNHARVSYEPFNESQIAEINAQVRRYLDGKVDEIDILNLRQIQEIFNQFKLILSQQEKAAEARLR 442          

HSP 2 Score: 119.013 bits (297), Expect = 7.504e-27
Identity = 60/133 (45.11%), Postives = 91/133 (68.42%), Query Frame = 3
Query: 1764 AFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYL 2162
            AFE+FK E+G E++ I  ENK IL+++K++   +  +IN IK E+D++   L   K ERE QG     +G++II E+EF  I +L D KK YR  YE+L++L++ + +CQK+VD  RQRL+ EF+ WY ES++
Sbjct:  587 AFEDFKAERGSELNRIFKENKAILADRKRKLKDVTQRINLIKKEMDDTSHTLNVAKVEREKQGEYINEEGQVIIDEQEFILIVRLKDLKKQYRADYEELQDLRAEVQYCQKLVDQCRQRLLTEFEAWYNESFV 719          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:NCBI gene;Acc:100127668])

HSP 1 Score: 306.22 bits (783), Expect = 8.893e-92
Identity = 173/446 (38.79%), Postives = 264/446 (59.19%), Query Frame = 3
Query:   60 MRKNKVQVFLRTRPSQKFS--YDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESN-------LTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISE--LDI-VNIRQIEGVYEAFSNLFRSTKQE 1358
            M K  +++F R +PS+K +  Y     +E   ++ I +P++     VNN+  ++ F F   F  +V QD +F  I   +  S L+G N T   YGQTG+GKTFT+TG  E +++RG+IPR LS ++ + ++D +   +  +SY+EIYNE  YDLL   +P  E++       +TI+ED   +  +K L    A  EEEALN LF G++NR  A   +N+ S+RS+C+FT+ + S+      A    +KL  VDLAGSER+ KT   G++L EA YIN SL +LEQ +IAL++K R HIP+R S +T  L+DS+GGNC T +IA +  D  +++E+IST RFA R+  + +E I N + DP +++  L+KEI  LK ELA+       G    E L++ +   + EQVR ++E    E  LD+  ++R+I+  +     L    K+E
Sbjct:    1 MVKQAIRIFARVKPSRKPAGIYSVSNEEERASSLEILVPRDLADGFVNNKRESYKFRFQETFDQDVKQDTIFESIAKPVAESVLTGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYMFEQFQKDSSKVYTAHVSYLEIYNECGYDLL---DPRHEASKLEDLPKVTIMEDPDQNIHLKNLSLLQASNEEEALNLLFLGDTNRMIAETPMNQASTRSNCIFTIQVSSKE--PGSATVGRSKLHLVDLAGSERVAKTGVGGQLLTEAKYINLSLHYLEQVIIALAEKNRSHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLDKRNIDESISTCRFAQRVALIKNEAILNEETDPQLIIVRLRKEIQGLKGELALLT-----GEQRTEELTEDETLRLEEQVRGFLEDRDPESSLDMGADMRKIQYCFAFIKKLLHGKKEE 436          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:NCBI gene;Acc:100127668])

HSP 1 Score: 291.582 bits (745), Expect = 1.840e-86
Identity = 169/446 (37.89%), Postives = 258/446 (57.85%), Query Frame = 3
Query:   60 MRKNKVQVFLRTRPSQKFS--YDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESN-------LTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISE--LDI-VNIRQIEGVYEAFSNLFRSTKQE 1358
            M K  +++F R +PS+K +  Y     +E   ++ I +P++     VNN+  ++ F F   F  +V QD +F  I   +  S L+G N T   YGQTG+GKTFT+TG  E +++RG+IPR LS ++ + ++D +   +  +SY+EIYNE  YDLL   +P  E++       +TI+ED   +  +K L    A  EEEALN LF G++NR  A     +     +C+FT+ + S+      A    +KL  VDLAGSER+ KT   G++L EA YIN SL +LEQ +IAL++K R HIP+R S +T  L+DS+GGNC T +IA +  D  +++E+IST RFA R+  + +E I N + DP +++  L+KEI  LK ELA+       G    E L++ +   + EQVR ++E    E  LD+  ++R+I+  +     L    K+E
Sbjct:    1 MVKQAIRIFARVKPSRKPAGIYSVSNEEERASSLEILVPRDLADGFVNNKRESYKFRFQETFDQDVKQDTIFESIAKPVAESVLTGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYMFEQFQKDSSKVYTAHVSYLEIYNECGYDLL---DPRHEASKLEDLPKVTIMEDPDQNIHLKNLSLLQASNEEEALNLLFLGDTNRMIA-----EPPPAPNCIFTIQVSSKE--PGSATVGRSKLHLVDLAGSERVAKTGVGGQLLTEAKYINLSLHYLEQVIIALAEKNRSHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLDKRNIDESISTCRFAQRVALIKNEAILNEETDPQLIIVRLRKEIQGLKGELALLT-----GEQRTEELTEDETLRLEEQVRGFLEDRDPESSLDMGADMRKIQYCFAFIKKLLHGKKEE 431          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif9 (kinesin family member 9 [Source:MGI Symbol;Acc:MGI:1098237])

HSP 1 Score: 484.567 bits (1246), Expect = 3.150e-162
Identity = 221/439 (50.34%), Postives = 317/439 (72.21%), Query Frame = 3
Query:   66 KNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLAN--FNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIK 1376
            + KVQ F+R RP+  F+++  K  ED K+I IH+ K+ R  +VNNQ ++WSF  DG+ HN  QD ++  +  + V  AL G N T MCYGQTGAGKT+TMTGATEN+ +RG++PRAL  ++R IEE   ++I+VR+SY+EIYNE ++DLL+   +   S + +TIVE+ +G  ++KGL  HL   EE+A + LFEGE+NR  A+H +NK SSRSHC+FT+Y+E+ SR  S   +  +K+  VDLAGSERL KT S G++L+EA+YINKSLSFLEQ +IAL D+ R+H+PFRQSKLTH LKDS+GGNC  +L+ N++ +   ++ET+S++RFA RM  VT+EP  N +YD   +V+NL+KE++ LK ELA+HD+L NR  + Y+P+ + Q  +I  QVR+Y+EG + E+DI+N+RQI+ V+  F  +    +QE E  ++
Sbjct:    4 RKKVQAFVRVRPTDDFAHEMIKYGEDNKSIDIHLKKDTRRGVVNNQQTDWSFKLDGVLHNASQDLVYETVAKDAVSQALDGYNGTIMCYGQTGAGKTYTMTGATENYKHRGILPRALQQVFRMIEERPTHAITVRVSYLEIYNENLFDLLSTLPYVGPSVTPMTIVENPQG-IFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMNKNSSRSHCIFTIYMEAHSRTLSDEKYITSKINLVDLAGSERLSKTGSEGRVLKEATYINKSLSFLEQAIIALGDQNRDHVPFRQSKLTHALKDSLGGNCNMVLVTNIYGEAAQLDETLSSLRFASRMKLVTTEPAINEKYDAERMVKNLEKELALLKQELAIHDSLSNRTLVNYDPMDEIQIAEINSQVRRYLEGTLDEIDIINLRQIQEVFNQFRVVLSQQEQEVESALR 441          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif9 (kinesin family member 9 [Source:MGI Symbol;Acc:MGI:1098237])

HSP 1 Score: 482.641 bits (1241), Expect = 1.461e-158
Identity = 221/439 (50.34%), Postives = 317/439 (72.21%), Query Frame = 3
Query:   66 KNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLAN--FNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIK 1376
            + KVQ F+R RP+  F+++  K  ED K+I IH+ K+ R  +VNNQ ++WSF  DG+ HN  QD ++  +  + V  AL G N T MCYGQTGAGKT+TMTGATEN+ +RG++PRAL  ++R IEE   ++I+VR+SY+EIYNE ++DLL+   +   S + +TIVE+ +G  ++KGL  HL   EE+A + LFEGE+NR  A+H +NK SSRSHC+FT+Y+E+ SR  S   +  +K+  VDLAGSERL KT S G++L+EA+YINKSLSFLEQ +IAL D+ R+H+PFRQSKLTH LKDS+GGNC  +L+ N++ +   ++ET+S++RFA RM  VT+EP  N +YD   +V+NL+KE++ LK ELA+HD+L NR  + Y+P+ + Q  +I  QVR+Y+EG + E+DI+N+RQI+ V+  F  +    +QE E  ++
Sbjct:    4 RKKVQAFVRVRPTDDFAHEMIKYGEDNKSIDIHLKKDTRRGVVNNQQTDWSFKLDGVLHNASQDLVYETVAKDAVSQALDGYNGTIMCYGQTGAGKTYTMTGATENYKHRGILPRALQQVFRMIEERPTHAITVRVSYLEIYNENLFDLLSTLPYVGPSVTPMTIVENPQG-IFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMNKNSSRSHCIFTIYMEAHSRTLSDEKYITSKINLVDLAGSERLSKTGSEGRVLKEATYINKSLSFLEQAIIALGDQNRDHVPFRQSKLTHALKDSLGGNCNMVLVTNIYGEAAQLDETLSSLRFASRMKLVTTEPAINEKYDAERMVKNLEKELALLKQELAIHDSLSNRTLVNYDPMDEIQIAEINSQVRRYLEGTLDEIDIINLRQIQEVFNQFRVVLSQQEQEVESALR 441          

HSP 2 Score: 118.242 bits (295), Expect = 9.731e-27
Identity = 81/186 (43.55%), Postives = 109/186 (58.60%), Query Frame = 3
Query: 1647 RKRLIMNSKASNIVSKDEFVNERLGGSSEKIIE--------------VPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYL 2162
            + +LI +SK  ++  KD    ER   S E +I                P+R+ AFEEFK E+G EI+ I  ENK IL+ +KK  S    +IN IK EIDE+   L   K  RE QG  Y N G +II EEEF  I KL D KK YR  Y++L++L++ I +CQ++VD  R RL+ EFD+WY ES++
Sbjct:  529 KTQLIPSSKDGDL--KDMLARERETSSIEPLISDSPKEELRAPRPSTPPSRTVAFEEFKNERGSEINRIFKENKSILNERKKRASETTQRINAIKQEIDETKDALNFQKSLREKQG-EYENKGLMIIDEEEFLLILKLKDLKKQYRNEYQELRDLRAEIQYCQRLVDQCRHRLLMEFDIWYNESFM 711          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif9 (kinesin family member 9 [Source:MGI Symbol;Acc:MGI:1098237])

HSP 1 Score: 482.256 bits (1240), Expect = 2.533e-158
Identity = 221/439 (50.34%), Postives = 317/439 (72.21%), Query Frame = 3
Query:   66 KNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLAN--FNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIK 1376
            + KVQ F+R RP+  F+++  K  ED K+I IH+ K+ R  +VNNQ ++WSF  DG+ HN  QD ++  +  + V  AL G N T MCYGQTGAGKT+TMTGATEN+ +RG++PRAL  ++R IEE   ++I+VR+SY+EIYNE ++DLL+   +   S + +TIVE+ +G  ++KGL  HL   EE+A + LFEGE+NR  A+H +NK SSRSHC+FT+Y+E+ SR  S   +  +K+  VDLAGSERL KT S G++L+EA+YINKSLSFLEQ +IAL D+ R+H+PFRQSKLTH LKDS+GGNC  +L+ N++ +   ++ET+S++RFA RM  VT+EP  N +YD   +V+NL+KE++ LK ELA+HD+L NR  + Y+P+ + Q  +I  QVR+Y+EG + E+DI+N+RQI+ V+  F  +    +QE E  ++
Sbjct:    4 RKKVQAFVRVRPTDDFAHEMIKYGEDNKSIDIHLKKDTRRGVVNNQQTDWSFKLDGVLHNASQDLVYETVAKDAVSQALDGYNGTIMCYGQTGAGKTYTMTGATENYKHRGILPRALQQVFRMIEERPTHAITVRVSYLEIYNENLFDLLSTLPYVGPSVTPMTIVENPQG-IFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMNKNSSRSHCIFTIYMEAHSRTLSDEKYITSKINLVDLAGSERLSKTGSEGRVLKEATYINKSLSFLEQAIIALGDQNRDHVPFRQSKLTHALKDSLGGNCNMVLVTNIYGEAAQLDETLSSLRFASRMKLVTTEPAINEKYDAERMVKNLEKELALLKQELAIHDSLSNRTLVNYDPMDEIQIAEINSQVRRYLEGTLDEIDIINLRQIQEVFNQFRVVLSQQEQEVESALR 441          

HSP 2 Score: 117.857 bits (294), Expect = 1.041e-26
Identity = 81/186 (43.55%), Postives = 109/186 (58.60%), Query Frame = 3
Query: 1647 RKRLIMNSKASNIVSKDEFVNERLGGSSEKIIE--------------VPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYL 2162
            + +LI +SK  ++  KD    ER   S E +I                P+R+ AFEEFK E+G EI+ I  ENK IL+ +KK  S    +IN IK EIDE+   L   K  RE QG  Y N G +II EEEF  I KL D KK YR  Y++L++L++ I +CQ++VD  R RL+ EFD+WY ES++
Sbjct:  529 KTQLIPSSKDGDL--KDMLARERETSSIEPLISDSPKEELRAPRPSTPPSRTVAFEEFKNERGSEINRIFKENKSILNERKKRASETTQRINAIKQEIDETKDALNFQKSLREKQG-EYENKGLMIIDEEEFLLILKLKDLKKQYRNEYQELRDLRAEIQYCQRLVDQCRHRLLMEFDIWYNESFM 711          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif9 (kinesin family member 9 [Source:MGI Symbol;Acc:MGI:1098237])

HSP 1 Score: 481.485 bits (1238), Expect = 6.257e-158
Identity = 221/439 (50.34%), Postives = 317/439 (72.21%), Query Frame = 3
Query:   66 KNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLAN--FNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIK 1376
            + KVQ F+R RP+  F+++  K  ED K+I IH+ K+ R  +VNNQ ++WSF  DG+ HN  QD ++  +  + V  AL G N T MCYGQTGAGKT+TMTGATEN+ +RG++PRAL  ++R IEE   ++I+VR+SY+EIYNE ++DLL+   +   S + +TIVE+ +G  ++KGL  HL   EE+A + LFEGE+NR  A+H +NK SSRSHC+FT+Y+E+ SR  S   +  +K+  VDLAGSERL KT S G++L+EA+YINKSLSFLEQ +IAL D+ R+H+PFRQSKLTH LKDS+GGNC  +L+ N++ +   ++ET+S++RFA RM  VT+EP  N +YD   +V+NL+KE++ LK ELA+HD+L NR  + Y+P+ + Q  +I  QVR+Y+EG + E+DI+N+RQI+ V+  F  +    +QE E  ++
Sbjct:    4 RKKVQAFVRVRPTDDFAHEMIKYGEDNKSIDIHLKKDTRRGVVNNQQTDWSFKLDGVLHNASQDLVYETVAKDAVSQALDGYNGTIMCYGQTGAGKTYTMTGATENYKHRGILPRALQQVFRMIEERPTHAITVRVSYLEIYNENLFDLLSTLPYVGPSVTPMTIVENPQG-IFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMNKNSSRSHCIFTIYMEAHSRTLSDEKYITSKINLVDLAGSERLSKTGSEGRVLKEATYINKSLSFLEQAIIALGDQNRDHVPFRQSKLTHALKDSLGGNCNMVLVTNIYGEAAQLDETLSSLRFASRMKLVTTEPAINEKYDAERMVKNLEKELALLKQELAIHDSLSNRTLVNYDPMDEIQIAEINSQVRRYLEGTLDEIDIINLRQIQEVFNQFRVVLSQQEQEVESALR 441          

HSP 2 Score: 118.242 bits (295), Expect = 1.030e-26
Identity = 81/186 (43.55%), Postives = 109/186 (58.60%), Query Frame = 3
Query: 1647 RKRLIMNSKASNIVSKDEFVNERLGGSSEKIIE--------------VPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYL 2162
            + +LI +SK  ++  KD    ER   S E +I                P+R+ AFEEFK E+G EI+ I  ENK IL+ +KK  S    +IN IK EIDE+   L   K  RE QG  Y N G +II EEEF  I KL D KK YR  Y++L++L++ I +CQ++VD  R RL+ EFD+WY ES++
Sbjct:  529 KTQLIPSSKDGDL--KDMLARERETSSIEPLISDSPKEELRAPRPSTPPSRTVAFEEFKNERGSEINRIFKENKSILNERKKRASETTQRINAIKQEIDETKDALNFQKSLREKQG-EYENKGLMIIDEEEFLLILKLKDLKKQYRNEYQELRDLRAEIQYCQRLVDQCRHRLLMEFDIWYNESFM 711          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif6 (kinesin family member 6 [Source:MGI Symbol;Acc:MGI:1098238])

HSP 1 Score: 324.709 bits (831), Expect = 3.046e-98
Identity = 244/740 (32.97%), Postives = 373/740 (50.41%), Query Frame = 3
Query:   60 MRKNKVQVFLRTRPS-QKFSYDFFKIQEDKKTIH---IHIPKEERSYIVNNQISNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESN-------LTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISE--LDI-VNIRQIEGVYEAFSNLF------------RSTKQEYEEQIKN-----LLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQSRKKERKRLIMNSKASNIVSKDEFVNERLGGSSEKIIEVPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQG----------PSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTE 2153
            M K  +Q+F R +P+ +K     + I ED+K  H   I +P++     VNN+  ++ F F  IF     Q+ +F  I   +  S L+G N T   YGQTG+GKTFT+TG  E +++RG+IPR LS ++ ++++D +   +  ISY+EIYNE  YDLL   +P  E++       +TI+ED   +  +K L  H A TEEEALN LF G++NR  A   +N+ S+RSHC+FTV+L S+      A    AKL  VDLAGSER+ KT   G +L EA YIN SL +LEQ +IALS+K R HIP+R S +T  L+DS+GGNC T +IA +  +  +++E+IST RFA R+  + +E I N + DP +++  LQKEI  LK ELAM       G    E L++ +   + + +  Y+E +  E  L++  ++R+I   +  F  L              ST+Q  +E +++     LL    Q        V          +++K+K   A   SS+  S+T +  Q SP +         G     R        + Q     R R       S+++ K   + E +    ++  E+  R  A +   IE          +NK++L  +  E   L   IN  +S+I +    L+    +R  Q           P+ T D +    EE+     +L + K  Y+  +  LK LK  I H Q ++D  + +L KEF+ W+ E
Sbjct:    1 MVKQTIQIFARVKPTVRKQQQGIYSIDEDEKLTHSLEIVLPRDLADGFVNNKRESYKFKFQRIFDQEAKQEIIFEIIAKPVAESTLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLL---DPRHEASKLEDLPKVTILEDPDQNIHLKNLSLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTVHLSSKE--PGSATVRHAKLHLVDLAGSERVSKTGVGGLLLTEAKYINLSLHYLEQVIIALSEKHRTHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLEKRNIDESISTCRFAQRVALIKNEAILNEEIDPRLMIVRLQKEIEDLKAELAM-----ATGEQRTEALTEAELLQLEKLIASYLEDQDPESRLEVGADMRKIHHCFHHFKKLLNDKKTLENTVSSESTRQACQEPLRDEEYTKLLGLLKQRDNEINILVNML-------KKEKKKTQDALQNSSLEKSDT-RPPQNSPFIA--------GSPAVPRTPFSSAPSHTQDLSICRHR-------SSLLHKKTGMREEMSLGRQEAFEIFKRDHA-DSVTIE----------DNKQVLKQRFSEAKALGESINEARSKIGQ----LKDAINQRHLQQVALGISENTVPASTPDPQ----EEKLR--AQLEEEKGRYKTAFMHLKALKVEIEHLQLLMDKAKVKLQKEFEAWWAE 686          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q9WV04|KIF9_MOUSE (Kinesin-like protein KIF9 OS=Mus musculus OX=10090 GN=Kif9 PE=1 SV=2)

HSP 1 Score: 482.641 bits (1241), Expect = 1.022e-157
Identity = 221/439 (50.34%), Postives = 317/439 (72.21%), Query Frame = 3
Query:   66 KNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLAN--FNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIK 1376
            + KVQ F+R RP+  F+++  K  ED K+I IH+ K+ R  +VNNQ ++WSF  DG+ HN  QD ++  +  + V  AL G N T MCYGQTGAGKT+TMTGATEN+ +RG++PRAL  ++R IEE   ++I+VR+SY+EIYNE ++DLL+   +   S + +TIVE+ +G  ++KGL  HL   EE+A + LFEGE+NR  A+H +NK SSRSHC+FT+Y+E+ SR  S   +  +K+  VDLAGSERL KT S G++L+EA+YINKSLSFLEQ +IAL D+ R+H+PFRQSKLTH LKDS+GGNC  +L+ N++ +   ++ET+S++RFA RM  VT+EP  N +YD   +V+NL+KE++ LK ELA+HD+L NR  + Y+P+ + Q  +I  QVR+Y+EG + E+DI+N+RQI+ V+  F  +    +QE E  ++
Sbjct:    4 RKKVQAFVRVRPTDDFAHEMIKYGEDNKSIDIHLKKDTRRGVVNNQQTDWSFKLDGVLHNASQDLVYETVAKDAVSQALDGYNGTIMCYGQTGAGKTYTMTGATENYKHRGILPRALQQVFRMIEERPTHAITVRVSYLEIYNENLFDLLSTLPYVGPSVTPMTIVENPQG-IFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMNKNSSRSHCIFTIYMEAHSRTLSDEKYITSKINLVDLAGSERLSKTGSEGRVLKEATYINKSLSFLEQAIIALGDQNRDHVPFRQSKLTHALKDSLGGNCNMVLVTNIYGEAAQLDETLSSLRFASRMKLVTTEPAINEKYDAERMVKNLEKELALLKQELAIHDSLSNRTLVNYDPMDEIQIAEINSQVRRYLEGTLDEIDIINLRQIQEVFNQFRVVLSQQEQEVESALR 441          

HSP 2 Score: 118.242 bits (295), Expect = 6.807e-26
Identity = 81/186 (43.55%), Postives = 109/186 (58.60%), Query Frame = 3
Query: 1647 RKRLIMNSKASNIVSKDEFVNERLGGSSEKIIE--------------VPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYL 2162
            + +LI +SK  ++  KD    ER   S E +I                P+R+ AFEEFK E+G EI+ I  ENK IL+ +KK  S    +IN IK EIDE+   L   K  RE QG  Y N G +II EEEF  I KL D KK YR  Y++L++L++ I +CQ++VD  R RL+ EFD+WY ES++
Sbjct:  529 KTQLIPSSKDGDL--KDMLARERETSSIEPLISDSPKEELRAPRPSTPPSRTVAFEEFKNERGSEINRIFKENKSILNERKKRASETTQRINAIKQEIDETKDALNFQKSLREKQG-EYENKGLMIIDEEEFLLILKLKDLKKQYRNEYQELRDLRAEIQYCQRLVDQCRHRLLMEFDIWYNESFM 711          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q9HAQ2|KIF9_HUMAN (Kinesin-like protein KIF9 OS=Homo sapiens OX=9606 GN=KIF9 PE=1 SV=4)

HSP 1 Score: 473.396 bits (1217), Expect = 2.754e-154
Identity = 215/439 (48.97%), Postives = 318/439 (72.44%), Query Frame = 3
Query:   66 KNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLAN--FNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIK 1376
            + KV  F+R +P+  F+++  +  +DK++I IH+ K+ R  +VNNQ ++WSF  DG+ H+  QD ++  +  ++V  AL G N T MCYGQTGAGKT+TM GATEN+ +RG++PRAL  ++R IEE   ++I+VR+SY+EIYNE ++DLL+   +   S + +TIVE+ +G  ++KGL  HL   EE+A + LFEGE+NR  A+H +NK SSRSHC+FT+YLE+ SR  S+  +  +K+  VDLAGSERL K+ S G++L+EA+YINKSLSFLEQ +IAL D++R+HIPFRQ KLTH LKDS+GGNC  +L+ N++ +   +EET+S++RFA RM  VT+EP  N +YD   +V+NL+KE++ LK ELA+HD+L NR  + Y+P+ + Q  +I  QVR+Y+EG + E+DI+++RQI+ V+  F  +    +QE E  ++
Sbjct:    4 RKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQTDWSFKLDGVLHDASQDLVYETVAKDVVSQALDGYNGTIMCYGQTGAGKTYTMMGATENYKHRGILPRALQQVFRMIEERPTHAITVRVSYLEIYNESLFDLLSTLPYVGPSVTPMTIVENPQG-VFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMNKNSSRSHCIFTIYLEAHSRTLSEEKYITSKINLVDLAGSERLGKSGSEGQVLKEATYINKSLSFLEQAIIALGDQKRDHIPFRQCKLTHALKDSLGGNCNMVLVTNIYGEAAQLEETLSSLRFASRMKLVTTEPAINEKYDAERMVKNLEKELALLKQELAIHDSLTNRTFVTYDPMDEIQIAEINSQVRRYLEGTLDEIDIISLRQIKEVFNQFRVVLSQQEQEVESTLR 441          

HSP 2 Score: 116.701 bits (291), Expect = 1.836e-25
Identity = 84/216 (38.89%), Postives = 115/216 (53.24%), Query Frame = 3
Query: 1749 PTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGE-QNFENKANGEGSVGLIY--------EDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQPVRR 2369
            P++  AFEEFK EQG EI+ I  ENK IL+ ++K  S     IN IK EID +   L   K  RE QG  Y N G +II EEEF  I KL D KK YR  Y+DL++L++ I +CQ +VD  R RL+ EFD+WY ES++  E      K  G    G++         ED  +KF  L+       PD  ++  AK  ++ +  + + +   Q   R
Sbjct:  575 PSKPVAFEEFKNEQGSEINRIFKENKSILNERRKRASETTQHINAIKREIDVTKEALNFQKSLREKQG-KYENKGLMIIDEEEFLLILKLKDLKKQYRSEYQDLRDLRAEIQYCQHLVDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKIEQKHNYLKTMMGLQQAHR 789          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|P46870|KLP1_CHLRE (Kinesin-like protein KLP1 OS=Chlamydomonas reinhardtii OX=3055 GN=KLP1 PE=2 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 4.325e-118
Identity = 234/671 (34.87%), Postives = 360/671 (53.65%), Query Frame = 3
Query:   60 MRKNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIV--NIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDID--KNSGFGVGQADRN--------------------LLDE---NGGYLQSRKKERKRLIMNSKASNIVSKDEFVNERLGGSSEKIIEVPT-RSEAFEEFKIE--QGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELI 1982
            M K  V+VF+RTRP+   S    K+  D +++ +++PK+  +  VNNQ   +SF FDG+  NV Q+  +  +  E+V S ++G + T   YGQTGAGKTFTM+G    + +RGLIPRA+ +++R ++   +    V +SY+EIYNE +YDLL +  P +   L ++ED   +T+V+GL     ++EEEAL   F GE  RTTA H+LN  SSRSH VFT+++E R+   +     ++KL  VDLAGSER +KT  TG+ L+EA +IN+SLSFLEQTV ALS K   ++PFRQ+KLT  L+D++GGNCKT+++AN+WA+  H EET+ST+RFA R+  +T++   N   DP +L+R  +++I  LK ELAM D L  +G ++Y+ L+D +  ++    R+++ GE    D+   +++++   ++A   +  + K +   Q+  L                        RR  +E    +G A+    S  P        VGD+D     GF VG A  +                     L E    GG L ++         N   +  +S       RL G    I  V   R+  F  +K++  +G+E+++ L      L++ K     L   +N+ K  IDE    L  L+R     G     DGE++
Sbjct:    1 MVKQAVKVFVRTRPTAT-SGSGLKLGPDGQSVSVNVPKDLSAGPVNNQQEQFSFKFDGVLENVSQEAAYTTLAHEVVDSLMAGYHGTIFAYGQTGAGKTFTMSGGGTAYAHRGLIPRAIHHVFREVDMRADKMYRVHVSYLEIYNEQLYDLLGD-TPGTSDALAVLEDSNSNTYVRGLTLVPVRSEEEALAQFFLGEQGRTTAGHVLNAESSRSHTVFTIHVEMRTSDAASERAVLSKLNLVDLAGSERTKKTGVTGQTLKEAQFINRSLSFLEQTVNALSRKD-TYVPFRQTKLTAVLRDALGGNCKTVMVANIWAEPSHNEETLSTLRFASRVRTLTTDLALNESNDPALLLRRYERQIKELKAELAMRDTLSGKGRVSYDDLTDDELRELHATCRRFLHGEAEPEDLPADSMKRVRETFKALRAVHVAIKADMATQMATL------------------------RRATEEG---SGAAARGGDSAGPS------GVGDVDLRATGGFTVGHAPLDARPPVRSELGSPGAGASGAEALGEPRSPGGGLHAQASSHTDAGSNWGDAGPLSSPG--GTRLAG----IFGVSGDRNAVFRRYKVDVGEGRELAASLKAASIALADTKASIRSLGASVNDAKQRIDELSSAL-ALRRGATPAG----GDGEVL 624          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q6ZMV9|KIF6_HUMAN (Kinesin-like protein KIF6 OS=Homo sapiens OX=9606 GN=KIF6 PE=1 SV=3)

HSP 1 Score: 311.227 bits (796), Expect = 2.718e-92
Identity = 175/446 (39.24%), Postives = 266/446 (59.64%), Query Frame = 3
Query:   60 MRKNKVQVFLRTRPS-QKFSYDFFKIQEDKKTI---HIHIPKEERSYIVNNQISNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESN-------LTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISE--LDI-VNIRQIEGVYEAFSNLFRSTK 1352
            M K  +Q+F R +P  +K     + I ED+K I    I +P++     VNN+  ++ F F  IF  +  Q+ +F  I   + GS L+G N T   YGQTG+GKTFT+TG  E +++RG+IPR LS ++ ++++D +   +  ISY+EIYNE  YDLL   +P  E++       +TI+ED   +  +K L  H A TEEEALN LF G++NR  A   +N+ S+RSHC+FT++L S+      A    AKL  VDLAGSER+ KT   G +L EA YIN SL +LEQ +IALS+K R HIP+R S +T  L+DS+GGNC T +IA +  +  +++E+IST RFA R+  + +E + N + +P ++++ LQKEI  LK ELAM       G    E L++ +   + + +  ++E + S+  L++  ++R++   +     L    K
Sbjct:    1 MVKQTIQIFARVKPPVRKHQQGIYSIDEDEKLIPSLEIILPRDLADGFVNNKRESYKFKFQRIFDQDANQETVFENIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLL---DPRHEASSLEDLPKVTILEDPDQNIHLKNLTLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLSSKE--PGSATVRHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALSEKHRSHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAVLNEEINPRLVIKRLQKEIQELKDELAM-----VTGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRKVHHCFHHLKKLLNDKK 436          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q9GYZ0|KIF15_STRPU (Kinesin-like protein KIF15 OS=Strongylocentrotus purpuratus OX=7668 GN=KIF15 PE=1 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 6.984e-62
Identity = 146/385 (37.92%), Postives = 212/385 (55.06%), Query Frame = 3
Query:   69 NKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGI-FHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNN-----RGLIPRALSNLY-----RRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSD----KQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDA 1178
            + ++VF+R RPS+    D    Q     + + +P    + I++++     F +D +   N  Q+ +F  +G  ++ S + G N T   YGQTG+GKTFTM G  E+ +N     RG+IPR+   L+      R +    Y    R S++EIYNE +YDLL   +P S   L + E+ K   +V GL      +  EA   L  G  NR  AA  +N+ SSRSH VFTV +ES+ +    +N  V++L  VDLAGSER + T++ G  L+EA  INKSLS L   ++AL D    KQR H+P+R SKL+  L+DS+GGN KT +IANV  D +   ET+ST++FA R   + +  +  +  D    V +LQ EI  L+  L M  A
Sbjct:   17 DAIKVFVRVRPSESHDADAAFGQ----CLEVRLPD---TIIMHSKPEPKVFTYDHVTAANTTQESVFTAVGKRIIESCVGGFNGTIFAYGQTGSGKTFTMLGPCEDGDNFHHEMRGVIPRSFEYLFSLVNREREKHGDRYEFLCRCSFLEIYNEQIYDLL---DPAS-LGLHLRENMKKGVFVDGLIERAVASASEAYGVLQAGWHNRRVAATSMNRESSRSHAVFTVSIESKEKKAGVSNIRVSQLHLVDLAGSERQKDTKAIGVRLKEAGSINKSLSILGNVIMALVDIAHGKQR-HVPYRDSKLSFLLRDSLGGNAKTYIIANVHPDAKCFGETLSTLKFARRAKMIKNRAV--VNEDTQGNVMHLQAEIRRLREALCMKGA 387          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A267E8X3 (Kinesin-like protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008674g1 PE=3 SV=1)

HSP 1 Score: 744.962 bits (1922), Expect = 0.000e+0
Identity = 402/833 (48.26%), Postives = 546/833 (65.55%), Query Frame = 3
Query:   63 RKNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPK-------EERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESE---SNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQSRKKERKRLIMNSK----------------ASNIVSKDEFVNERLGGSSEKIIEV------PTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGEQNFENKANGEGSVGL----------IYEDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQPVRRNPGTPIVINKTNNSLPKEMEVI 2435
            R  KV+V++R RPSQ F+ D  K+  + +++ I +P+       ++R +  NNQ S+WSF  DGIF N  Q +++  +G +L+ S L+G N T MCYGQTGAGKTFT+TGATE F+NRGL+PRALS+LY+ IE   + +I+VRI+Y+EIYN+ + DLLA   P+S+   S L I E E G  +VKGL  HLAQ+EEEALN LFEGE+NR TAAH LNK SSRSH +FTVYLE+RSR QS + ++++K+ FVDLAGSERLQKT STGK  QEASYINKSLSFLEQTVIAL++K R+H+P+RQSKLTH+LKDSIGG CKTILIAN+W D+  ++ET+STMRFA RM  V SEP+EN + DP I+V+ L+ EI+ALK ELAMH+ L N+ HI YEP+S+QQ+F++R+QV++Y++G++ ++D+ +IRQI+ V+E F     ++++E + +++ LL                       +          G A S+  S T   Q     VGD+D  S FG+       +DE+G +LQS+++E       S                  +   +  E   + +G S             P+R++AFEEFK E G EI  IL EN+  + +KKKEYS LA+++N  K+EID S ++L+ LK ERE QG  YT++GELII EEEF EI+KL   K+ Y+  ++ LK LK+ I +CQKMVDLTRQ+LI+EFD WY ES+LDG  +    A      GL           YEDP+E+FD +KH + E   D EAYNRAKE+  HR +F +A  Q QPVRR PGTP+V  +  N  P  +E++
Sbjct:    9 RSKKVKVWVRVRPSQNFADDAIKLDPEGRSLQISVPRPGGDQQPQQRGF-ANNQRSDWSFRTDGIFSNSSQQEVYETVGADLIESGLAGYNGTIMCYGQTGAGKTFTITGATEMFHNRGLVPRALSHLYKEIEAKSDLAITVRITYLEIYNDTMLDLLATM-PDSQEAGSPLVITE-ENGGVYVKGLNVHLAQSEEEALNLLFEGETNRATAAHALNKNSSRSHTIFTVYLETRSRFQSNSKYTMSKINFVDLAGSERLQKTLSTGKTQQEASYINKSLSFLEQTVIALTEKNRDHVPYRQSKLTHYLKDSIGGGCKTILIANIWGDVRQLDETVSTMRFAQRMSCVASEPVENQRTDPSIMVKVLEAEIAALKKELAMHNTLHNKSHIHYEPISEQQRFELRQQVQRYIDGDLDDIDLTSIRQIQAVFELFREACLASREEADARLQELL--------------------AAQQAGGVAATPPEGAARSLGPS-TSGAQLGGEAVGDLDGRS-FGIAARSEVGMDESGVFLQSKRREAAAATAASSKKQRQHPLGAGGGSSSGAAAGADSEGTLDAVGSSDPAAAAAARPGTPPSRTQAFEEFKKELGSEIYRILNENRTTMMDKKKEYSNLASQVNTTKTEIDRSRLRLDALKVEREAQGNLYTDEGELIINEEEFVEIKKLRQLKESYKADFDRLKELKTQIHYCQKMVDLTRQKLIQEFDKWYAESFLDGSPDKRGVAPNSLEAGLGVRPEVLPPKPYEDPLERFDKVKHRQLEHTVDLEAYNRAKETTVHRHVFSKAGQQGQPVRRKPGTPLVNQR--NEPPSRLEIM 814          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A1I8HAS3 (Kinesin-like protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 401/833 (48.14%), Postives = 544/833 (65.31%), Query Frame = 3
Query:   63 RKNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPK-------EERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESE---SNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQSRKKERKRLIMNSK----------------ASNIVSKDEFVNERLGGSSEKIIEV------PTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGEQNFENKANGEGSVGL----------IYEDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQPVRRNPGTPIVINKTNNSLPKEMEVI 2435
            R  KV+V++R RPSQ F+ D  K+  + +++ I +P+       ++R +  NNQ S+WSF  DGIF N  Q +++  +G +L+ S L+G N T MCYGQTGAGKTFT+TGATE F+NRGL+PRALS+LY+ IE   + +I+VRI+Y+EIYN+ + DLLA   P+S+   S L I E E G  +VKGL  HLAQ+EEEALN LFEGE+NR TAAH LNK SSRSH +FTVYLE+RSR QS + ++ +K+ FVDLAGSERLQKT STGK  QEASYINKSLSFLEQTVIAL++K R+H+P+RQSKLTH+LKDSIGG CKTILIAN+W D+  ++ET+STMRFA RM  V SEP+EN + DP I+V+ L+ EI+ALK ELAMH+ L N+ HI YEP+S+QQ+F++R+QV++Y++G++ ++D+ +IRQI+ V+E F     ++++E + +++ LL                       +          G A S+  S T   Q     VGD+D  S FG+       +DE+G +LQS+++E       S                  +   +  E   + +G S             P+R++AFEEFK E G EI  IL EN+  + +KKKEYS LA+++N  K+EID S ++L+ LK ERE QG  YT++GELII EEEF EI+KL   K+ Y+  ++ LK LK+ I +CQKMVDLTRQ+LI+EFD WY ES+LDG  +    A      GL           YEDP+E+FD +KH + E   D EAYNRAKE+  HR +F +A  Q QP RR PGTP+V  +  N  P  +E++
Sbjct:   12 RSKKVKVWVRVRPSQNFADDAIKLDPEGRSLQISVPRPGGDQQPQQRGF-ANNQRSDWSFRTDGIFSNSSQQEVYETVGADLIESGLAGYNGTIMCYGQTGAGKTFTITGATEMFHNRGLVPRALSHLYKEIEAKSDLAITVRITYLEIYNDTMLDLLATM-PDSQEAGSPLVITE-ENGGVYVKGLNVHLAQSEEEALNLLFEGETNRATAAHALNKNSSRSHTIFTVYLETRSRFQSNSKYTTSKINFVDLAGSERLQKTLSTGKTQQEASYINKSLSFLEQTVIALTEKNRDHVPYRQSKLTHYLKDSIGGGCKTILIANIWGDVRQLDETVSTMRFAQRMSCVASEPVENQRTDPSIMVKVLEAEIAALKKELAMHNTLHNKSHIHYEPISEQQRFELRQQVQRYIDGDLDDIDLTSIRQIQAVFELFREACLASREEADTRLQELL--------------------AAQQAGGVAATPPEGAARSLGPS-TSGAQLGGEAVGDLDGRS-FGIAARSEVGMDESGVFLQSKRREAAAATAASSKKQRQHPLGAGGGSSSGAAAGADSEGTLDAVGSSDPAAAAAARPGTPPSRTQAFEEFKKELGSEIYRILNENRTTMMDKKKEYSNLASQVNTTKTEIDRSRLRLDALKVEREAQGNLYTDEGELIINEEEFVEIKKLRQLKESYKADFDRLKELKTQIHYCQKMVDLTRQKLIQEFDKWYAESFLDGSPDKRGVAPTSLEAGLGVRPEVLPPKPYEDPLERFDKVKHRQLEHMVDLEAYNRAKEATVHRHVFSKAGQQGQPARRKPGTPLVNQR--NEPPSRLEIM 817          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A267GIZ7 (Kinesin-like protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028807g3 PE=3 SV=1)

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 401/833 (48.14%), Postives = 544/833 (65.31%), Query Frame = 3
Query:   63 RKNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPK-------EERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESE---SNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQSRKKERKRLIMNSK----------------ASNIVSKDEFVNERLGGSSEKIIEV------PTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGEQNFENKANGEGSVGL----------IYEDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQPVRRNPGTPIVINKTNNSLPKEMEVI 2435
            R  KV+V++R RPSQ F+ D  K+  + +++ I +P+       ++R +  NNQ S+WSF  DGIF N  Q +++  +G +L+ S L+G N T MCYGQTGAGKTFT+TGATE F+NRGL+PRALS+LY+ IE   + +I+VRI+Y+EIYN+ + DLLA   P+S+   S L I E E G  +VKGL  HLAQ+EEEALN LFEGE+NR TAAH LNK SSRSH +FTVYLE+RSR QS + ++ +K+ FVDLAGSERLQKT STGK  QEASYINKSLSFLEQTVIAL++K R+H+P+RQSKLTH+LKDSIGG CKTILIAN+W D+  ++ET+STMRFA RM  V SEP+EN + DP I+V+ L+ EI+ALK ELAMH+ L N+ HI YEP+S+QQ+F++R+QV++Y++G++ ++D+ +IRQI+ V+E F     ++++E + +++ LL                       +          G A S+  S T   Q     VGD+D  S FG+       +DE+G +LQS+++E       S                  +   +  E   + +G S             P+R++AFEEFK E G EI  IL EN+  + +KKKEYS LA+++N  K+EID S ++L+ LK ERE QG  YT++GELII EEEF EI+KL   K+ Y+  ++ LK LK+ I +CQKMVDLTRQ+LI+EFD WY ES+LDG  +    A      GL           YEDP+E+FD +KH + E   D EAYNRAKE+  HR +F +A  Q QP RR PGTP+V  +  N  P  +E++
Sbjct:   10 RSKKVKVWVRVRPSQNFADDAIKLDPEGRSLQISVPRPGGDQQPQQRGF-ANNQRSDWSFRTDGIFSNSSQQEVYETVGADLIESGLAGYNGTIMCYGQTGAGKTFTITGATEMFHNRGLVPRALSHLYKEIEAKSDLAITVRITYLEIYNDTMLDLLATM-PDSQEAGSPLVITE-ENGGVYVKGLNVHLAQSEEEALNLLFEGETNRATAAHALNKNSSRSHTIFTVYLETRSRFQSNSKYTTSKINFVDLAGSERLQKTLSTGKTQQEASYINKSLSFLEQTVIALTEKNRDHVPYRQSKLTHYLKDSIGGGCKTILIANIWGDVRQLDETVSTMRFAQRMSCVASEPVENQRTDPSIMVKVLEAEIAALKKELAMHNTLHNKSHIHYEPISEQQRFELRQQVQRYIDGDLDDIDLTSIRQIQAVFELFREACLASREEADTRLQELL--------------------AAQQAGGVAATPPEGAARSLGPS-TSGAQLGGEAVGDLDGRS-FGIAARSEVGMDESGVFLQSKRREAAAATAASSKKQRQHPLGAGGGSSSGAAAGADSEGTLDAVGSSDPAAAAAARPGTPPSRTQAFEEFKKELGSEIYRILNENRTTMMDKKKEYSNLASQVNTTKTEIDRSRLRLDALKVEREAQGNLYTDEGELIINEEEFVEIKKLRQLKESYKADFDRLKELKTQIHYCQKMVDLTRQKLIQEFDKWYAESFLDGSPDKRGVAPTSLEAGLGVRPEVLPPKPYEDPLERFDKVKHRQLEHMVDLEAYNRAKEATVHRHVFSKAGQQGQPARRKPGTPLVNQR--NEPPSRLEIM 815          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A1S3ISC3 (Kinesin-like protein OS=Lingula unguis OX=7574 GN=LOC106166855 PE=3 SV=1)

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 400/840 (47.62%), Postives = 533/840 (63.45%), Query Frame = 3
Query:   75 VQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANF----NPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQS------RKKERKRL----------IMNSKASNIVSKD----EFVNERLGGSS----------------EKIIEVPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGEQNFENKANGEGSVGL-------------IYEDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQP-VRRNPGTPIVINKTNNSLPKEMEV 2432
            V+V++R RP+ +F++D   +Q D KTI+IH  ++E+  +VNNQI +WSF  DGI HN  Q+ ++  +G  +V  AL G N T MCYGQTGAGKTFT+TGATEN+ +RGLIPRA+S LYR IE+   Y+I+VRISY+EIYNE ++DLL++     N      +TI E E    +VKGL  HLAQ+EEEALN LFEGE+NR  A H LNK+SSRSHC+FTV++ESRSR+QS A ++ +KL FVDLAGSERL KT+S GK  QEA YINKSLSFLEQTVIAL+D++R+H+PFRQ+KLTH LKDSIGG C T+LIANVW +   +EETIST+RFA RMM V +EP  N  YDP I+V+ L+KEI  L++ELAMHD L NR  + YEPLS+QQK++I++QVR+Y+EG + E+DIVN+RQI+GV+++F  L+   ++E EE+++   T                           +K   A IA++        I      VG+ D  S FGVG A ++   E    + +      ++K R+R             ++KA +I+S      E  +ER  G                  E+    P R+ AFEEFK E+G EI+ IL ENKEIL+ KKK Y+ LA +IN+ K EID+S  KL+ LKRERE QG +Y  DGE II+EEEF EI++L + K+ YR  +E+LKNLKS + +CQK+VD  RQRLI+EFD WY ES+L      +       ++GL             + ED  EKFD L+       PD  A+  AK   + RK +  A+ Q QP +RR PGTP +  +T    P  +EV
Sbjct:    8 VKVWVRIRPTPEFAHDIIDLQPDSKTINIHCKRDEKQGVVNNQILDWSFGMDGILHNASQEQVYQTVGQNMVTQALEGFNGTLMCYGQTGAGKTFTVTGATENYRHRGLIPRAISQLYREIEDRPEYAINVRISYLEIYNETMFDLLSSLPETMNASQGQQMTIAE-EGSVVYVKGLTTHLAQSEEEALNLLFEGETNRAIATHSLNKQSSRSHCIFTVHIESRSRVQSTAKYTTSKLNFVDLAGSERLGKTKSGGKTQQEAMYINKSLSFLEQTVIALADRKRDHVPFRQTKLTHCLKDSIGGTCSTVLIANVWGEAAQIEETISTLRFATRMMCVANEPAINEHYDPAIMVKKLEKEILHLRNELAMHDTLTNRSMVTYEPLSEQQKYEIKQQVRRYLEGSLDEIDIVNVRQIQGVFDSFKELYGQMEKEIEEKLRVKYTLV-------------------------DKTDPASIAAAQKAGVA--ITDDGTLVGEADGQS-FGVGVAPKSAKAEQSATVSAIKKASLKRKSRERASPTAKGPLSPSHSAKAQDIISPQTPSGEKKDEREAGEPTTPSSTAPPAPAPVQQERPSTPPPRTVAFEEFKAERGSEINRILSENKEILAVKKKAYADLARQINSTKVEIDKSRDKLDALKRERESQGFTYNEDGETIISEEEFLEIKQLKEFKQNYRTDHEELKNLKSEVQYCQKLVDQCRQRLIQEFDDWYAESFLLPADELQTSM----AMGLGLRPGALPPYPLQVPEDEQEKFDRLQGELLMENPDSAAFYNAKMRTERRKTYEAAMSQPQPSMRRKPGTPTMEVRTKP--PTMLEV 812          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A2T7PW33 (Kinesin-like protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00243 PE=3 SV=1)

HSP 1 Score: 722.235 bits (1863), Expect = 0.000e+0
Identity = 392/843 (46.50%), Postives = 530/843 (62.87%), Query Frame = 3
Query:   63 RKNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANF----NPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQ-------------SRKKERKRLIMNSKASNIVSKDEFVNERLGGSSEKIIEVPT-----------------------RSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLD--GEQNFENKANGEGS---------VGLIYEDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQP--VRRNPGTPIVINKTNNSLPKEMEV 2432
            R  KV+V+ R RPS  F++D  ++  DKK+I++H+ ++ +  IVNNQI +WSF  DGIFHN  Q+ +F+ +   LV SA+ G N T MCYGQTGAGKTFT+TGATENF +RGLIPRALS L++ IEE L +SI VRISY+EIYNEV+YDLLA+     NP  +  + + E++ G  +VKGL CHLAQ EEEALN LFEGE+NRT AAH+LN+ SSRSHC+FTVYLESRSR+ S A ++V+KL FVDLAGSER+ KT+S GK+  EA YINKSL+FLEQ VIAL+D++REHIPFRQSKLTH+LKDSIGG C T+LI N+W++   +EET+S++RFA RMM V SEP  N   DP ILV+ L +EI  LK ELAMHD L NR  + Y+PLS+QQK++IR+Q R+Y+EG + E+DIVN+RQI+G +EAF  ++   + + E++++   T                     + R     M  A  A  ++T++ P +      VG+ D  +GFGVG A ++   E    +Q             +R      + + S  +     ++     L        E PT                       R+ AFEEFK E+G EI+ IL+ENKEIL++KKK YS LA KINNIK +ID +   LE  + ER+ +GP + NDG+++I+EEEF E+Q+L D KK Y+  YE+LK LK+ + +CQK+VD  RQ+L+ EFD WY ES+L+  GE+   +   G G             + ED  EKFD L ++     PD  ++  AK   + RKI+  A+ QAQP       GTP      +  LP  ++V
Sbjct:    8 RNKKVKVWARIRPSSNFAHDNLELLPDKKSINLHLKRDPKKGIVNNQILDWSFKLDGIFHNATQEHVFSTVASNLVTSAIDGYNGTLMCYGQTGAGKTFTITGATENFRHRGLIPRALSQLFKEIEERLEFSIIVRISYMEIYNEVMYDLLASLPDVENPSGKETMVLTENQDG-VYVKGLSCHLAQNEEEALNLLFEGETNRTIAAHVLNRMSSRSHCLFTVYLESRSRVHSNAKYTVSKLHFVDLAGSERIGKTKSEGKMQTEALYINKSLTFLEQVVIALADRKREHIPFRQSKLTHYLKDSIGGRCNTVLITNIWSERAQLEETVSSLRFATRMMCVASEPAVNEVCDPAILVKTLHQEIEHLKSELAMHDTLANRSSVNYDPLSEQQKYEIRQQCRRYLEGTLDEIDIVNLRQIQGTFEAFREIYHQIENDVEDKLRQKFTL--------------------SDRADVAAMGGAQQAH-MSTADEPNM------VGETD-GTGFGVGSAPKSAKAEPSAVVQLKKKEREREKKRAARGGSPVGVKVTSSPTQSAKGEQDSKSPLTSVDRDKEEGPTSPVSSAGGAQRPDKSLHPHSPPSRTAAFEEFKQEKGSEINRILIENKEILASKKKAYSDLAKKINNIKLDIDNTRQTLERFRAERDTEGPVFNNDGDIVISEEEFMEVQRLKDLKKTYQIDYEELKTLKTQVQYCQKLVDQCRQKLLNEFDKWYAESFLNLPGEEVQTSVQAGYGPRLGAFLPIIPSAMLEDEEEKFDRLHNALLMNNPDSVSFFNAKMRTERRKIYQAAMSQAQPSYAHHKSGTPTT--NVHKKLPNMLQV 819          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: KIF9 (kinesin family member 9 [Source:HGNC Symbol;Acc:HGNC:16666])

HSP 1 Score: 530.406 bits (1365), Expect = 2.469e-178
Identity = 292/701 (41.65%), Postives = 422/701 (60.20%), Query Frame = 3
Query:   69 NKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFN---PESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQSRKKERKRLIMNSKASNIVSKDEFVNERLGGSSEKIIEVPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYL 2162
            ++V+VF+RTRP+  F+ D  +   DK+T+++   +E R  +VNNQ+S+WSF  DG+ HN+ Q++++  +   +V  AL G N T MC+GQTGAGKT+TMTGATE++  RG+IPRAL  ++  +E+ ++++ SV +S++EIYNE + DLLA+           LTIVED  G   VKGL  H    EEEA N LFEGE NR    H LNK SSRSHC+FT+++ESRSR  S A +  +KL  VDLAGSERL KT S G++ +EA YIN+SLSFLEQ +IAL+D++REH+PFRQSKLTH LKDS+GGNC T+L+AN++ +   +EET+ST+RFA RM  V ++P  N   DP + VR LQKEI  LK EL++HD L NR  +  E LSD+Q  +I+ QV++Y+ G + E+ IV+IRQI+   E F+   ++ +Q                                   EQK K   +   S V  SE          VG+++  SGFG+G A  +   +      S  K + + I  +K   +   ++   + L  + +     P + EAFE+FK+ +G EI+ IL ENK +L  +  +   L   IN+ K +ID    +L+  + +R+ QG      GE ++ E E   +  L + K  YR+ YE+L + K+ + +CQ +VD  R RL+ EF+ WY ES+L
Sbjct:    6 SEVKVFVRTRPTACFAQDLIEYLPDKQTVNVRHRRESRKGVVNNQMSSWSFKLDGVMHNMSQEEVYQSVAHSVVLRALEGYNGTIMCFGQTGAGKTYTMTGATESYQQRGIIPRALQEVFYEVEQRVDHTFSVFLSFLEIYNETLVDLLASIKRGRAVQGGALTIVEDPGGGVSVKGLTLHPVHNEEEAFNLLFEGEMNRIIGEHALNKNSSRSHCIFTIHIESRSRTLSDAPYVTSKLNLVDLAGSERLSKTGSEGQVQREALYINRSLSFLEQAIIALTDRRREHVPFRQSKLTHSLKDSLGGNCNTVLVANIYGEAAQIEETLSTLRFATRMKCVRTQPSINEHIDPALQVRRLQKEIQLLKQELSLHDTLANRAVVPNESLSDRQVDEIKSQVQRYLAGTLDEITIVSIRQIQ---EMFTQFKKAVEQ-----------------------------------EQKVKEQLSQKYSLVEKSEN-----TVGSVGEVE--SGFGLGLAAPS---QKHTQASSPNKSKGKKIKENKGGTV---NQSETDALTPNCDS---PPCKFEAFEDFKLGRGSEINRILKENKGVLLERMDQLHKLTQAINSCKRDIDHMSSELQLCREQRQSQGQFVGEKGEPVLEEAELILLVGLREKKDQYRQSYEELLSTKAEVRYCQHLVDQCRIRLLTEFESWYNESFL 652          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: KIF9 (kinesin family member 9 [Source:HGNC Symbol;Acc:HGNC:16666])

HSP 1 Score: 235.728 bits (600), Expect = 7.657e-68
Identity = 108/225 (48.00%), Postives = 153/225 (68.00%), Query Frame = 3
Query:   69 NKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFN---PESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESR 734
            ++V+VF+RTRP+  F+ D  +   DK+T+++   +E R  +VNNQ+S+WSF  DG+ HN+ Q++++  +   +V  AL G N T MC+GQTGAGKT+TMTGATE++  RG+IPRAL  ++  +E+ ++++ SV +S++EIYNE + DLLA+           LTIVED  G   VKGL  H    EEEA N LFEGE NR    H LNK SSRSHC+FT+++E R
Sbjct:    6 SEVKVFVRTRPTACFAQDLIEYLPDKQTVNVRHRRESRKGVVNNQMSSWSFKLDGVMHNMSQEEVYQSVAHSVVLRALEGYNGTIMCFGQTGAGKTYTMTGATESYQQRGIIPRALQEVFYEVEQRVDHTFSVFLSFLEIYNETLVDLLASIKRGRAVQGGALTIVEDPGGGVSVKGLTLHPVHNEEEAFNLLFEGEMNRIIGEHALNKNSSRSHCIFTIHIEVR 230          

HSP 2 Score: 110.153 bits (274), Expect = 1.147e-24
Identity = 92/317 (29.02%), Postives = 151/317 (47.63%), Query Frame = 3
Query: 1212 LSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQSRKKERKRLIMNSKASNIVSKDEFVNERLGGSSEKIIEVPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYL 2162
            LSD+Q  +I+ QV++Y+ G + E+ IV+IRQI+   E F+   ++ +QE                                   QK K   +   S V  SE          VG+++  SGFG+G A  +   +      S  K + + I  +K   +   ++   + L  + +     P + EAFE+FK+ +G EI+ IL ENK +L  +  +   L   IN+ K +ID    +L+  + +R+ QG      GE ++ E E   +  L + K  YR+ YE+L + K+ + +CQ +VD  R RL+ EF+ WY ES+L
Sbjct:  234 LSDRQVDEIKSQVQRYLAGTLDEITIVSIRQIQ---EMFTQFKKAVEQE-----------------------------------QKVKEQLSQKYSLVEKSENT-----VGSVGEVE--SGFGLGLAAPS---QKHTQASSPNKSKGKKIKENKGGTV---NQSETDALTPNCDS---PPCKFEAFEDFKLGRGSEINRILKENKGVLLERMDQLHKLTQAINSCKRDIDHMSSELQLCREQRQSQGQFVGEKGEPVLEEAELILLVGLREKKDQYRQSYEELLSTKAEVRYCQHLVDQCRIRLLTEFESWYNESFL 496          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif17 (kinesin family member 17 [Source:NCBI gene;Acc:103022265])

HSP 1 Score: 218.009 bits (554), Expect = 1.327e-59
Identity = 137/371 (36.93%), Postives = 197/371 (53.10%), Query Frame = 3
Query:   60 MRKNKVQVFLRTRP---SQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGI-FHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALK 1154
            M    V+V +R RP    +K       +  D       I K E S     Q     F FDG  F N   + ++N+I   LV     G N T   YGQTG+GK+FTM G  +    RG+IPRA  +++  I+   N    VR SY+EIY E + DLL     +S+  L + E  +   +V+ L  H   +  E    + +G  NR+    ++NK SSRSH +FT++LE  ++    + +    KL  VDLAGSER  KT +TG  LQEA+ IN SLS L   + AL D + +HIP+R SKLT  L+DS+GGN +T+++A +     + EE++ST+R+A R   + + P   I  DP   L+R  Q+EI  L+
Sbjct:    1 MASESVKVVIRCRPLNDREKALNCKMVVSVDTGCCQCFIEKPEASEEPPKQ-----FTFDGTYFINQTTEQMYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGVADPAAQRGVIPRAFEHIFETIQCAENTKFLVRASYLEIYKEEIRDLLGK---DSKLKLELKEHPERGVYVRDLSMHTVHSVGECERIMEQGWKNRSVGYTLMNKDSSRSHSIFTIHLEICKTDAAGEDHLRAGKLNLVDLAGSERQSKTGATGDRLQEATKINLSLSALGNVISALVDGRSKHIPYRDSKLTRLLQDSLGGNTRTLMVACLSPADNNYEESLSTLRYANRAKSIQNRP--RINEDPKDALLREYQEEIKQLR 361          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif3cb (kinesin-like protein KIF3B [Source:NCBI gene;Acc:103037192])

HSP 1 Score: 210.69 bits (535), Expect = 3.811e-58
Identity = 137/386 (35.49%), Postives = 203/386 (52.59%), Query Frame = 3
Query:   78 QVFLRTRPSQK----FSYDFFKIQEDKK--TIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVP-QDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHELAMHDALRNRGHIAYE 1208
            QV +R RP  K     S++   ++ D K   + +H PK   + +        +F FD ++     Q DL++     L+ S L G N T   YGQTG GKT+TM G   +   RG+IP +  +++  I    N    VR+SY+EIY + + DL+   N      L + E+ +   +VKGL   + +  +E  + +  G  +R+     +N+RSSRSH +F V +E S   +  + +  V KL  VDLAGSER  KT   G   +EA+ IN SL  L   + AL D +  HIP+R SKLT  L+DS+GGN KT+++A +     H EET++T+RFA R   + + P   I  DP   L+R  Q+EI+ LK +      L  RG +A E
Sbjct:   14 QVVVRCRPVNKKEEAMSHEKI-VEVDIKLGQVRVHNPKGPGTLV-------KAFTFDAVYDMASKQTDLYDYSCKPLIDSVLQGFNGTVFAYGQTGTGKTYTMQGLPMDPERRGVIPNSFQHIFTHISRSQNQQYLVRVSYLEIYQDEIRDLVCKDN---NKKLELKENPELGVYVKGLSSVVTKNIKEIEHVMNLGNQSRSVGFTKMNERSSRSHAIFVVTIECSEMGIDGEEHIRVGKLNMVDLAGSERQSKTGVQGMRFKEAAKINLSLCALGNVISALVDGKSSHIPYRDSKLTRLLQDSLGGNSKTVMVATIGPTSCHYEETLTTLRFANRAKNIKNRP--KINEDPKDALLREFQEEIARLKAQ------LEERGMLAKE 380          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif3b (kinesin family member 3B [Source:NCBI gene;Acc:103035116])

HSP 1 Score: 211.46 bits (537), Expect = 1.594e-57
Identity = 123/318 (38.68%), Postives = 181/318 (56.92%), Query Frame = 3
Query:  219 FPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHEL 1163
            F FD ++  N  Q DL+++    LV S L G N T   YGQTG GKT+TM G   +   RG+IP +  +++  I    N    VR SY+EIY E + DLL+    +    L + E      +VK L   + ++  E  + +  G  NR+  A  +N+ SSRSH +F + +E S      + +  V KL  VDLAGSER  KT + G+ L+EA+ IN SLS L   + AL D +  HIP+R SKLT  L+DS+GGN +T+++AN+     +VEET++T+R++ R   + ++P   I  DP   L+R  Q+EI+ LK +L
Sbjct:   58 FTFDSVYDWNSKQIDLYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRNDPERRGVIPNSFEHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSK---DQSRRLELKERPDTGVYVKDLSSFVTKSVREIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSELGPDGENHIRVGKLNLVDLAGSERQTKTGAQGERLKEATKINLSLSALGNVISALVDGRSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYSNRAKNIKNKP--RINEDPKDALLREFQEEIARLKEQL 370          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: KIF9 (kinesin family member 9 [Source:HGNC Symbol;Acc:HGNC:16666])

HSP 1 Score: 543.888 bits (1400), Expect = 0.000e+0
Identity = 312/798 (39.10%), Postives = 459/798 (57.52%), Query Frame = 3
Query:   75 VQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQ---SRKKERKRLIMNSKASNIVSKDE----------FVNERLGGSSEKII-----EV----------------PTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGEQNFENKANGEGSVGLIYEDPI------------EKFDTLKHSKYEGKPDEEAYNRAKESLKHRKI 2330
            V+V LRTRPS +F+     I    KT++I + +  +  IVNNQ++ WSF  DG  HN  Q+ ++ +   E+V   L G N T MCYGQTGAGK++TMTG+TENF+ RG+IPR L  ++  IEE +   I+VR+SY+EIYNE + DL A    ++      + DE+G   VKGL C L  ++EEAL  LFEGE NR  A H LNK+SSRSHC+FT+Y+ESRS+  + + ++++KL  VDLAGSERL K  S G++ +EA+YINKSLSFLEQ VIAL+D++REH+PFRQSKLTH LKD+IGGNC T+LIAN+  + E +EET+ST+RFA RM  V   P+    +DP   V++L+KEI  LK+ELAMHD L NR  ++YEPL + Q  +I+ QVR+Y++G ++E+ + N+RQI+ V+  F  +F   ++E E  ++   +                    Q RR    K  +  +     ++E   +       G+++++ GFG+G A  +    +  YL    + KK R +  +   AS+I  ++           FV E  GG  E  +     EV                P  + AFE FK E+G EI+ I  ENK I   K+ +   LA  IN +K EID +   LE   ++R+ QG   +++G+++I EEE+  + ++ + +  YR  YE+L+++K+ +  CQ  V+L RQRL+ EF  WY E+Y    +N    AN   +   +   P             EK + +        PD  A+  AK  ++ +K+
Sbjct:    7 VRVVLRTRPSPRFAESQIDINPTDKTVNIRLKEHNQKEIVNNQVTEWSFKVDGSLHNTNQEMVYRETAREVVSRTLDGYNGTIMCYGQTGAGKSYTMTGSTENFSERGIIPRVLEQVFHDIEERVEQDITVRVSYLEIYNESLCDLCAMPACQAIDKQLSIMDERGMVSVKGLTCQLVSSQEEALTKLFEGEMNRAVACHTLNKKSSRSHCIFTLYIESRSKTITNSKYTMSKLNLVDLAGSERLGKATSEGQVEREATYINKSLSFLEQAVIALADRRREHVPFRQSKLTHVLKDAIGGNCNTVLIANIIGETEQIEETLSTLRFAARMACVPVNPVPIELHDPQRTVKDLEKEIRLLKNELAMHDILANRKKVSYEPLLEHQVAEIQSQVRRYLDGSLNEITLANVRQIQEVFAQFKVIFLQQEEEVEANLRQKFSL-------------------QERR----KGPSLDVIQKAGSTENEVVL-----AGELERD-GFGLGLAPTS----SKLYLSPVVTAKKNRNKKTLKDSASSISKRERPGSPQLRESPFVGE--GGQREHDVTSVASEVSEQLNRSNYCIYGSTPPMPAVAFEAFKAERGSEINRIFKENKLIYKEKQTKAIELAKHINTLKQEIDVAREALEAKTKKRQEQGEFMSSEGQMVIDEEEYCFLLRMRELQSQYRLHYEELRDIKAEVQWCQHQVNLCRQRLVSEFGTWYAEAYQVPSEN--APANSITTASPVVAHPAVGKTQPLVEGEQEKLERIHVELMTENPDAMAFYEAKARIERKKV 767          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif6 (kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-061027-130])

HSP 1 Score: 298.901 bits (764), Expect = 6.208e-90
Identity = 168/437 (38.44%), Postives = 252/437 (57.67%), Query Frame = 3
Query:   60 MRKNKVQVFLRTRPSQKFSYDFFKIQED---KKTIHIHIPKEERSYIVNNQISNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESN-------LTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNL 1337
            M K  +Q++ R +P+++ +   + ++ED      +   +P++     VNN+  ++ F F  IF     Q+++F  I   +  S LSG N T   YGQTG+GKTFT+TG  E F +RG+IPR L  L+ + ++D N   +  ISY+EIYNE  YDLL   NP  E++       +T++ED      +K L  H A ++EEALN LF G++NR  A   +N+ S+RSHC+FT+++  R           +KL  VDLAGSER+ KT   G +L EA YIN SL +LEQ +IALS+K R H+P+R S +T  L+DS+GGNC T +IA +  D  +++E+IST RFA R+  + +E I N + DP +++  L+KEI  L+ ELA+       G    E L   +   + E VR YVE   ++  +     +  ++  FS L
Sbjct:    1 MVKQTIQIYARLKPARR-NAGLYSVEEDDGRTPLLEFVVPRDLAEGFVNNKRESYKFQFKKIFDQQAKQEEIFETIARPVADSVLSGYNGTIFAYGQTGSGKTFTITGGAERFADRGIIPRILGYLFEQFQKDTNRVYTAHISYLEIYNENGYDLL---NPRHEASKLEDLPKVTLMEDTDQIVHLKNLSLHQASSQEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTLHVCGRE--PGSTTLCRSKLHLVDLAGSERVSKTGVGGILLTEAKYINLSLHYLEQVIIALSEKNRSHVPYRNSMMTSVLRDSLGGNCMTTMIATLAVDKRNIDESISTCRFAQRVALIKNEAILNEEVDPRLVIVRLKKEIQQLRDELAL-----VTGQPRTEDLDAVELQQLEEMVRGYVEDADADASLEVGADMRKIHHCFSLL 426          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 206.068 bits (523), Expect = 1.071e-56
Identity = 125/321 (38.94%), Postives = 180/321 (56.07%), Query Frame = 3
Query:  216 SFPFDGIFHN-VPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEE-DLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHELA 1166
            +F FD +F     Q D++N     +V S L G N T   YGQTG GKTFTM G       RG+IP + ++++  I + + +    VR+SY+EIYNE V DLL     +    L + E      +VK L   +    ++    +  G  NR+  +  +N+ SSRSH +FT+ +E S   +    +  + KL  VDLAGSER  KT +TG+ L+EA+ IN SLS L   + AL D +  H+P+R SKLT  L+DS+GGN KT++ AN+     + +ETIST+R+A R   + ++    I  DP   L+R  QKEI  LK +LA
Sbjct:   61 TFTFDTVFGTESKQVDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGIRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVKDLLGK---DQTQRLEVKERPDVGVYVKDLSAFVVNNADDMDRIMTLGHKNRSVGSTNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKA--RINEDPKDALLRQFQKEIEDLKKKLA 376          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 202.601 bits (514), Expect = 2.571e-56
Identity = 118/320 (36.88%), Postives = 180/320 (56.25%), Query Frame = 3
Query:  216 SFPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSIS-VRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHEL 1163
            +F FD ++  +  Q D++ +    LV S L G N T   YGQTG GKT+TM G   +   RG+IP +  +++  I    N  +  VR SY+EIY E + DLL+    +    L + E       VK L   + ++  E  + +  G  NR+  A  +N+ SSRSH +F + +E S      +++  V KL  VDLAGSER  KT + G+ L+EA+ IN SLS L   + AL D +  H+P+R SKLT  L+DS+GGN +T+++ANV     + +E+++T+R+A R   + + P   +  DP   L+R  Q+EI+ LK +L
Sbjct:   65 TFTFDAVYGGDAKQLDIYEESFRPLVDSVLCGFNGTIFAYGQTGTGKTYTMEGVRSDPERRGVIPNSFEHIFTHISRSQNQPVPEVRASYLEIYQEEIRDLLSR---DQSRRLELRERPDTGIHVKDLSSFVTKSAREIEHVMGIGNQNRSVGATNMNEHSSRSHAIFVITVECSELGADGESHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHVPYRDSKLTRLLQDSLGGNARTVMVANVGPASYNYDESLTTLRYANRAKNIRNRP--RVNEDPKDALLREFQEEIARLKEQL 379          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010617.1 (pep scaffold:Pmarinus_7.0:GL476849:1993:16233:1 gene:ENSPMAG00000009612.1 transcript:ENSPMAT00000010617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.986 bits (515), Expect = 1.288e-54
Identity = 113/287 (39.37%), Postives = 168/287 (58.54%), Query Frame = 3
Query:  300 LSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALK 1154
            + G N T   YGQTG GK+FTM G +E    RG+IPRA  +++  I+   N     R SY+EIYNE + DLL     +++  L + E  +   +V+ L  H   +  E    +  G SNR T A ++NK SSRSH +F+++LE   +  Q + +    KL  VDLAGSER  KT + G  L+EA+ IN SLS L   + AL D + +H+P+R SKLT  L+DS+GGN KT+++A +     + EE++ST+R+A R   + + P   +  DP   ++R  ++EI+ LK
Sbjct:    4 VEGYNGTVFAYGQTGCGKSFTMQGVSEPSAQRGVIPRAFEHIFESIQCAENTKFLFRASYLEIYNEEIRDLLGK---DTKQRLELKEHPERGVYVRDLSMHTVHSVAECERIMQAGWSNRATGATLMNKDSSRSHSIFSIHLEMCTTDDQGEDHIRAGKLNLVDLAGSERQSKTGAQGDRLKEATKINLSLSALGNVISALVDGRSKHVPYRDSKLTRLLQDSLGGNTKTLMVACISPADNNYEESLSTLRYANRAKSIRNRP--RVNEDPKDAMLREYREEITRLK 285          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 184.496 bits (467), Expect = 1.497e-48
Identity = 140/408 (34.31%), Postives = 208/408 (50.98%), Query Frame = 3
Query:  207 SNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTG---------ATENF---NNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLL--------ANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYL-----ESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHI--------AYEP---LSDQQKFDI---REQVRKYVEGEISELDIVNIRQIE 1310
            S  ++ FD +F     Q+ +FN      +   L G N T   YGQTG GKT+TM+G         +T+N     + G+IPR L +L++ +   LN   SV+IS++E+YNE + DLL        A  +P+ +  +    +   S  VKG+      +  E LN L +G   R  AA   N  SSRSH VFT+       +S+   Q++    + KL  VDLAGSE + ++ +  K  QEA  INKSL  L + + AL D    HIP+R+SKLT  L+DS+GG  KT +IA +      +EET ST+ +A R   + + P  N        +++  +EI  L+++L      RN+  I         YE    L D+Q   I   REQ++K+ E  +++LDI N+ Q E
Sbjct:   98 SKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSS-LNKEYSVKISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD-HSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNS---RNKQGIFITQDQLDLYESNSILIDEQNLKIHNLREQIKKFKENYLNQLDINNLLQSE 500          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 174.481 bits (441), Expect = 9.366e-46
Identity = 113/305 (37.05%), Postives = 172/305 (56.39%), Query Frame = 3
Query:  219 FPFDGIFHNVP-QDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRI---EEDLNYSISVRISYVEIYNEVVYDLLANFNPESESN-LTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRM---QSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTV--IALSDKQRE-HIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQ 1100
            F FD +F     Q  ++ +    L+ S L G NST   YG TG GKT+T++G     +  G+I  A+  L+ +I   +++ ++ IS  +SY+EIYNE + DLL    PE+ S  L I ED +    V  L  H   T E+ ++ + +G  NRTT+    N+ SSRSH V  +++   +++    SQ  F  A L  +DLAGSER   T++ G  L E + IN+SL  L   +  + L+D  R  HIP+R SKLT  LK S+GGNCKT++I  +     H +ET++T+++A R  ++ ++ I N Q
Sbjct:  153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTP---SQPGIIFLAMEELFNKITDLKDEKDFEIS--LSYLEIYNERIRDLL---KPETPSKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTF--ATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRNQQ 447          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 156.762 bits (395), Expect = 3.419e-40
Identity = 110/296 (37.16%), Postives = 162/296 (54.73%), Query Frame = 3
Query:  219 FPFDGIFHNVPQD---DLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEE--DLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDE-------KGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALS--DKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRM 1064
            F FD IF    QD   D+F ++G +LV S+L G N     YGQTG+GKTFTM    +     G+IP  +S+++  I +     +   V   ++EIYNE + DLL + N   E     ++ E       K +T      C L ++EE     L +    R+TA+   N+ SSRSH +F ++L S S  ++ A+ S   L  VDLAGSER+  +Q  G  L+E   INKSLS L   + AL   D  + HIPFR SKLT+ L+ S+ G+ KT++  N+     H+ ET++++RFA ++
Sbjct:  436 FKFDKIFDQ--QDTNVDVFKEVG-QLVQSSLDGYNVCIFAYGQTGSGKTFTMLNPGD-----GIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKL-ESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHL-SGSNAKTGAH-SYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 128.642 bits (322), Expect = 3.782e-31
Identity = 115/378 (30.42%), Postives = 162/378 (42.86%), Query Frame = 3
Query:  102 SQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRI-EEDLN--YSISVRISYVEIYNEVVYDLLAN---------------FNPESESN-----LTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALS-DKQRE-----------------------------HIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKV 1073
            S  F  D + I  DK  +H  I                 F FD +F  +    +++ +    ++   L G N+T   YG TG+GKTFTM+G  +     GLIP ++S L+  I E+ +N      V ISY+EIYNE +YDLL +               +  +S SN     L I +D +    V GL     ++ EE L ++  G+ +R       N RSSRSH +  + L S +     +  S   L   DLAGSER    Q   K   E S+INKSL  L   +  LS DK                                HIP+R SKLT  L+ ++ G+     I  V    +   ET++T+RFA R   V
Sbjct:  139 SNTFVRDPWFITNDKTIVHEEI---------------GEFKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQEL---GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVKNGTSRSST--LSLCDLAGSERATGQQERRK---EGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNV 493          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 115.546 bits (288), Expect = 8.978e-27
Identity = 72/201 (35.82%), Postives = 113/201 (56.22%), Query Frame = 3
Query:  561 DEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHEL 1163
            D+    +++ L         E LN L +G  +R  A+  +N  SSRSH +FT+ L  + + +    F ++K+  VDLAGSE + ++ +  +  +EA  IN+SL  L + + AL DK   HIPFR+SKLT  L+DS+GGN KT LIA +       EET ST+ +A +   + ++P         ILV+N+  E++ +K +L
Sbjct:  311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL---FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSG-HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNITMELAKIKSDL 507          

HSP 2 Score: 66.6254 bits (161), Expect = 1.151e-11
Identity = 38/111 (34.23%), Postives = 60/111 (54.05%), Query Frame = 3
Query:  201 QISNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNR-----GLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLL 515
            Q++   +  D +F     QD +F+++   L    + G N T + YG T  GKT+TMTG  + +N       G+IPR L  L+  +E   N  + V+ S++E+YNE + DLL
Sbjct:   83 QMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYV-VKCSFIELYNEELKDLL 192          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO44491 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVQ1])

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 339/799 (42.43%), Postives = 482/799 (60.33%), Query Frame = 3
Query:   72 KVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFN---PESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQAD---RNLLDENGGYLQSRKKERKRLIMNSKAS------NIVSKDEFVNERLGGSSEKIIEVPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGEQNFENKANGEGSV---GLIYEDPIEKFDTLKHSKYEGKPDEEAYNRAK----------ESLKHRKIFGEALYQAQPVRRNPGTPIVI 2393
            KV+  +R RP+ +F+ D   +Q+D K++ IH  K+ R   +NNQ+ +W+F  + + HN  Q+ ++ +   +LV S L G N T M YGQTG+GKTFTMTG+TE F +RG+IPR++  L+R I +  N S++VRISY+EIYNE +YDLL+      P   S +T+ ED  G T VKGL  H A  EEEALN LFEGE+NR  A H LNKRSSRSHC+FT+Y+E+ SR++S   ++++KL  VDLAGSERL KT+S G    EA YINKSL+FLEQ VIAL D  R+H+P+RQSKLTH LKDSIGG CK +LIAN+W +   +EET+ST+RFA RMM V  EP     +D + L +  QKEI  L+ ELAMHD L NR  I+YEPLS+ Q  D+++QV++++ G++ ++++VN+RQI+  +  F  +  S ++E EE++                        KQN  +++   S AG       +    +      VGD+D N GFGVG A    R  +    G  +S+ ++ +      K S      N +  D+  +    GS  +    P ++EAFE+FK E+G EI+ IL ENK+IL  KK+    L++++N+IKSEID+    LE+ + ER  QG   T +G+  I E+E+  ++KL + K  YRE YE+LK+ KS + +C+K+VD  RQRL+ EFD WYTES+L  ++  ++   G   V   G + ED  EKFD L+       PD   Y  AK           S + R++   A+     VR  P T ++I
Sbjct:    6 KVEAVVRIRPTARFAQDMIDLQQDGKSMTIHCSKDTRRGYINNQVLDWNFQLNKVLHNASQETVYEECARKLVTSTLDGYNGTVMAYGQTGSGKTFTMTGSTEKFEHRGIIPRSIQQLFREIADRPNSSVTVRISYLEIYNEGMYDLLSTLPGVLPVDPSTMTVSEDVTGLTHVKGLSVHTAINEEEALNLLFEGETNRIIAQHSLNKRSSRSHCIFTLYVETHSRVESNTKYTLSKLNLVDLAGSERLGKTESQGSTQTEAMYINKSLTFLEQAVIALGDNHRDHVPYRQSKLTHVLKDSIGGRCKMMLIANIWGEASQIEETLSTLRFASRMMNVPCEPAIMEHFDYMKLCQEYQKEIKNLRKELAMHDTLTNRSQISYEPLSESQIEDVKDQVKRFLSGDLDDIELVNMRQIKETFAQFRKIVNSMEEEVEERV------------------------KQNLEQERSVASAAGGKPGTAMAGEGGL------VGDVDGN-GFGVGVAGTGVRPNVSALVGSKRSKSRKSRDRDSTGKKSPAAPGDNGLDGDKASSPTSEGSGNRPTTPPPKNEAFEDFKKERGSEINRILNENKQILREKKRSAKELSSRVNSIKSEIDQEAAILESKQDERLEQGDYITQNGQRFIDEDEYEHLKKLKELKASYRESYEELKSTKSDVTYCEKLVDQCRQRLLTEFDSWYTESFLGPDEQTDSSVPGVRKVSRDGHVPEDEQEKFDRLQLELLMENPDSVPYYNAKMQTERRMHLTASGRQRRLKPGAIVAT--VRNKPPTTLII 771          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO32880 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU5])

HSP 1 Score: 296.975 bits (759), Expect = 4.085e-92
Identity = 162/413 (39.23%), Postives = 247/413 (59.81%), Query Frame = 3
Query:   60 MRKNKVQVFLRTRPSQKFSYDFFKIQEDKKT--IHIHIPKEERSYIVNNQISNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESN-------LTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFD-IREQVRKYVE 1265
            M K  +Q++ R +P++  +  +  +++D  +  I   IPKE     +NN+   + F F+ +F     QD++F  +   +  + LSG N T   YGQTG+GKTFT+TG  E + +RGLIPR LS ++   E+  +   +V ISY+EIYNE  YDLL   +P+ E++       ++++ED   +  +K L  H A  EEEALN LF G++NR  A   +N+ S+RSHC+FT+++ +R     +A    AKL  VDLAGSER+ KT   G  L EA YIN SL FLEQ ++ALS+K R HIP+R S +T  L+DS+GGNC T +IA    + ++++E+IST RFA R+  + ++ + N + DP +++  L++EI  LK ELAM       G +      D  ++D +R  V  ++E
Sbjct:    1 MVKQGIQIYARVKPTKAKTGTYEIVEDDSGSSVIEYTIPKELSDGYINNKREVYKFRFNKVFDQKCSQDEVFESVAQGVADNVLSGYNGTIFAYGQTGSGKTFTITGGAERYQDRGLIPRTLSYIFDYFEKHPDNVYTVHISYLEIYNEKGYDLL---DPKHEASKLEDLPKVSLLEDADNNIHLKNLSLHQANNEEEALNCLFLGDTNRMIAETPMNQASTRSHCIFTIHVSTRE--SGKATIRRAKLHLVDLAGSERIAKTGVAGIQLAEAKYINVSLHFLEQVIVALSEKSRSHIPYRNSMMTSVLRDSLGGNCMTTMIATCSVEKKNIDESISTCRFAQRVAMIKNDVLLNEEIDPKLMIAQLKREIQQLKAELAMATGQEYTGQL------DDNEYDRLRRLVNSFIE 402          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO40836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5X0])

HSP 1 Score: 219.935 bits (559), Expect = 3.310e-61
Identity = 126/318 (39.62%), Postives = 187/318 (58.81%), Query Frame = 3
Query:  219 FPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHEL 1163
            F +D ++  N  Q DL+++   +LV S L G N T   YGQTG GKTFTM G   + + RG+IP +  +++  I    N    VR SY+EIY E V DLL     + +  L + E      +VK L   + ++ +E  + +  G  NR+  A  +N+ SSRSH +F + +E S+     + +  V KL  VDLAGSER  KT++TG  L+EA+ IN SLS L   + AL D +  HIP+R SKLT  L+DS+GGN +T+++AN+     + EE+I+T+R+A R   + ++P  +I  DP   L+R  Q+EI+ LK+EL
Sbjct:   38 FTYDAVYDWNSKQIDLYDETFRQLVESVLEGYNGTIFAYGQTGTGKTFTMEGVRSDPDLRGVIPNSFDHIFTHIARTTNQQYLVRASYLEIYQEEVRDLLGK---DQKKRLELKERPDTGVYVKDLQSFVCKSVKEIEHVMNVGNQNRSVGATKMNEHSSRSHAIFIITIECSQLNAVGECHIRVGKLNMVDLAGSERQTKTEATGDRLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNYEESITTLRYANRAKNIKNKP--HINEDPKDALLREFQEEIARLKNEL 350          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO37529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFN7])

HSP 1 Score: 206.453 bits (524), Expect = 1.655e-59
Identity = 132/371 (35.58%), Postives = 193/371 (52.02%), Query Frame = 3
Query:   75 VQVFLRTRPSQKFSYDF-----FKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGI-FHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHEL 1163
            V+V +R RP  K   D       ++  D     +H P ++            +F FDG  F +   ++++N I   LV   L G N T   YGQTG GK+F+M G T+    RG+IPRA  +++  I    +    V  SY+EIYNE + DLL     + ++ L + E      +VK L         E  + +  G  NR+  A ++N  SSRSH +F++ LE      +   +    KL  VDLAGSER  KT +TG  L+EA+ IN SLS L   + AL D + +HIP+R SKLT  L+DS+GGN KT+++A +     + +ET+ST+R+A R   + ++P   I  DP   L+R   +EI  LK  L
Sbjct:    5 VRVIVRCRPLNKREKDLKCETVLEMDSDTGQCRLHKPGDKTQ-------PPKAFTFDGAYFIDSTTENIYNDICFPLVEGVLEGYNGTVFAYGQTGCGKSFSMMGITDPPTQRGIIPRAFEHIFESINVADDSKFLVHASYLEIYNEEIRDLLGK---DHKAKLDLKEHPDKGVYVKDLTMIPVNCVSEIEHVMDLGSKNRSVGATLMNADSSRSHSIFSINLEILDDDSEGNEHIRAGKLNLVDLAGSERQSKTGATGGRLKEATKINLSLSALGNVISALVDGKAKHIPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIKNKP--KINEDPKDALLRQYSEEIERLKKML 363          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO49131 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGY3])

HSP 1 Score: 195.282 bits (495), Expect = 2.938e-55
Identity = 119/315 (37.78%), Postives = 173/315 (54.92%), Query Frame = 3
Query:  141 DKKTIHIHIPKEERSY---IVNNQISNWSFPFDGIFHNVPQD-DLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLN-YSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQS-QANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQRE--HIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMR 1061
            D++   I+ P   R     +   +  +  F FD +F+    + D+F     +++   L G N T   YG TGAGKT TM G+    NN G++   + +LYRRI E  +  +  V +SY+E+YNE + DLL          L + ED +    V GL  H   + EE L+ L  G +NRT      N +SSRSH VF V++  + R    +AN  +AK+  +DLAGSER   T + G   +E + INKSL  L   + AL+DK+ +  HIP+R SKLT  LKDS+GGNCKT++IA V   +   E+T +T+++A R
Sbjct:   38 DEECEAINFPGASRKRARSVTGRRARDLRFIFDRVFNEEANNTDVFENTTKDIIDGVLDGFNCTVFAYGATGAGKTHTMLGSN---NNPGVMFLTMMDLYRRIHEMKDEKTCDVAVSYLEVYNETIRDLLL-----PGPALAVREDPQRGVCVSGLTLHKPHSAEELLSMLEFGNNNRTQHPTDANAQSSRSHAVFQVFVRQKDRTAGLKANVRLAKMSLIDLAGSERATVTTNRGARFREGANINKSLLALGNCINALADKENKSGHIPYRNSKLTRLLKDSLGGNCKTVMIAAVSPSMLSYEDTYNTLKYADR 344          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif6 (kinesin family member 6 [Source:NCBI gene;Acc:101160372])

HSP 1 Score: 294.664 bits (753), Expect = 1.163e-86
Identity = 158/379 (41.69%), Postives = 232/379 (61.21%), Query Frame = 3
Query:   60 MRKNKVQVFLRTRPSQKFSYDFFKIQEDK--KTIHIHIPKEERSYIVNNQISNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESN-------LTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELA 1166
            M +  +Q+F R +P+ K +  F    ED    ++   +P++     VNN+  ++ F F  +F  +  Q+D+F  I   +  S L+G N     YGQTG+GKTFT+TG  E + +RG+IPR LS L+ R  +D +   ++ ISY+EIYNE+ YDLL   +P  E++       + I+ED   +  ++ L    A  EEEALN LF G++NR  A   LN+ S+RSHC+FTV+L  R      A    +KL  VDLAGS+R+ KT   G +L EA YIN SL FLEQ ++ALS++ R HIP+R S LT  L+DS+GGNC T +IA +  D  +++E+IST RFA R+  + +E I N + DP++L+ +L++EI  LK +LA
Sbjct:    1 MVQQTIQIFGRIKPTGKPAAVFSVDNEDPTGASLDFLLPRDLSDGFVNNKRESYKFRFKKVFDQHAKQEDIFENIARPVADSVLAGFNGAIFAYGQTGSGKTFTITGGAERYADRGIIPRTLSYLFERFSQDSSTVYTMHISYLEIYNELGYDLL---DPRHEASRLEDLPKVLIMEDADQNIHLRNLSLQQAANEEEALNLLFLGDTNRMIAETPLNQASTRSHCIFTVHLCRRE--PGSATLQRSKLHLVDLAGSDRVSKTGLNGVLLTEAKYINLSLHFLEQVILALSERSRSHIPYRNSMLTSVLRDSLGGNCMTTMIATLAVDKRNLDESISTCRFAQRVALIKNEAILNEELDPVLLIAHLKEEILTLKKQLA 374          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif3b (kinesin family member 3B [Source:NCBI gene;Acc:101155428])

HSP 1 Score: 208.764 bits (530), Expect = 7.904e-57
Identity = 122/318 (38.36%), Postives = 180/318 (56.60%), Query Frame = 3
Query:  219 FPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHEL 1163
            F FD ++  N  Q DL+++    LV S L G N T   YGQTG GKT+TM G  ++   RG+IP +  +++  I    N    V  SY+EIY E + DLL+    +    L + E       V+ L   + ++  E  N +  G  NR+  A  +N+ SSRSH +F + +E S   +  + +  V KL  VDLAGSER  KT + G+ L+EA+ IN SLS L   + AL D +  HIP+R SKLT  L+DS+GGN +T+++AN+     +VEET++T+R+A R   + ++P   I  DP   ++R  Q+EI  LK +L
Sbjct:   58 FTFDSVYDWNSKQIDLYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRKDPERRGVIPNSFEHIFTHISRSQNQQYLVSASYLEIYQEEIRDLLSK---DQSRRLELRERPDVGVHVRDLSSFVTKSVREIENVMNIGNQNRSVGATNMNEHSSRSHAIFVITVECSEMGVDEENHIRVGKLNLVDLAGSERQSKTGAQGERLKEATKINLSLSALGNVISALVDGRSSHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKP--RINEDPKDAMLRTFQEEILRLKEQL 370          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif3b (kinesin family member 3B [Source:NCBI gene;Acc:101155428])

HSP 1 Score: 208.764 bits (530), Expect = 7.904e-57
Identity = 122/318 (38.36%), Postives = 180/318 (56.60%), Query Frame = 3
Query:  219 FPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHEL 1163
            F FD ++  N  Q DL+++    LV S L G N T   YGQTG GKT+TM G  ++   RG+IP +  +++  I    N    V  SY+EIY E + DLL+    +    L + E       V+ L   + ++  E  N +  G  NR+  A  +N+ SSRSH +F + +E S   +  + +  V KL  VDLAGSER  KT + G+ L+EA+ IN SLS L   + AL D +  HIP+R SKLT  L+DS+GGN +T+++AN+     +VEET++T+R+A R   + ++P   I  DP   ++R  Q+EI  LK +L
Sbjct:   58 FTFDSVYDWNSKQIDLYDETFRPLVDSVLLGFNGTIFAYGQTGTGKTYTMEGVRKDPERRGVIPNSFEHIFTHISRSQNQQYLVSASYLEIYQEEIRDLLSK---DQSRRLELRERPDVGVHVRDLSSFVTKSVREIENVMNIGNQNRSVGATNMNEHSSRSHAIFVITVECSEMGVDEENHIRVGKLNLVDLAGSERQSKTGAQGERLKEATKINLSLSALGNVISALVDGRSSHIPYRDSKLTRLLQDSLGGNARTVMVANIGPASYNVEETLTTLRYANRAKNIKNKP--RINEDPKDAMLRTFQEEILRLKEQL 370          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif3a (kinesin-like protein KIF3A [Source:NCBI gene;Acc:101164388])

HSP 1 Score: 207.608 bits (527), Expect = 1.363e-56
Identity = 137/374 (36.63%), Postives = 202/374 (54.01%), Query Frame = 3
Query:   69 NKVQVFLRTRP-SQKFSYDFFK----IQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEE-DLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHEL 1163
            + V+V +R RP +Q+     FK    + E + TI ++            Q    +F FD +F  +  Q D++N     +V S L G N T   YGQTG GKTFTM G       RG+IP + ++++  I + + +    VR+SY+EIYNE V DLL     +    L + E      ++K L  + A   ++    +  G  NR+  A  +N+ SSRSH +FTV +E S   +    +  + KL  VDLAGSER  KT +TG+ L+EA+ IN SLS L   + AL D +  H+P+R SKLT  L+DS+GGN KT++ AN+     + +ETIST+R+A R   + ++    I  DP   L+R  QKEI  L+ +L
Sbjct:   15 DNVKVVVRCRPLNQREKMTGFKQAVTVDEIRGTITVN-------KFETAQEPPKTFTFDTVFGPDSKQLDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGK---DQMQRLEVKERPDIGVYIKDLTSYAANNADDMDRIMTVGHKNRSVGATNMNEHSSRSHAIFTVTIEYSEKGLDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKA--RINEDPKDALLRQFQKEIEDLRKKL 376          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: kif3a (kinesin-like protein KIF3A [Source:NCBI gene;Acc:101164388])

HSP 1 Score: 206.838 bits (525), Expect = 1.458e-56
Identity = 125/320 (39.06%), Postives = 181/320 (56.56%), Query Frame = 3
Query:  216 SFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEE-DLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHEL 1163
            +F FD +F  +  Q D++N     +V S L G N T   YGQTG GKTFTM G       RG+IP + ++++  I + + +    VR+SY+EIYNE V DLL     +    L + E      ++K L  + A   ++    +  G  NR+  A  +N+ SSRSH +FTV +E S   +    +  + KL  VDLAGSER  KT +TG+ L+EA+ IN SLS L   + AL D +  H+P+R SKLT  L+DS+GGN KT++ AN+     + +ETIST+R+A R   + ++    I  DP   L+R  QKEI  L+ +L
Sbjct:   31 TFTFDTVFGPDSKQLDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGK---DQMQRLEVKERPDIGVYIKDLTSYAANNADDMDRIMTVGHKNRSVGATNMNEHSSRSHAIFTVTIEYSEKGLDGNQHVRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKA--RINEDPKDALLRQFQKEIEDLRKKL 345          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000073771.1 (SMESG000073771.1)

HSP 1 Score: 1586.62 bits (4107), Expect = 0.000e+0
Identity = 791/795 (99.50%), Postives = 792/795 (99.62%), Query Frame = 3
Query:   60 MRKNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLXXXXXXXXXXXXXXXXXXXGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQSRKKERKRLIMNSKASNIVSKDEFVNERLGGSSEKIIEVPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGEQNFENKANGEGSVGLIYEDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQPVRRNPGTPIVINKTNNSLPKEMEVIQPN 2444
            MRKNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLTSSIQNQQVTQQTVTSS QGKQNRRE +EKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQSRKKERKRLIMNSKASNI SKDEFVNERLGGSSEKIIEVPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGEQNFENKANGEGSVGLIYEDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQPVRRNPGTPIVINKTNNSLPKEMEVIQPN
Sbjct:    1 MRKNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQISNWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLTSSIQNQQVTQQTVTSSPQGKQNRREPREKMSTAGIASSVTTSETPQIQQPSPKVGDIDKNSGFGVGQADRNLLDENGGYLQSRKKERKRLIMNSKASNIGSKDEFVNERLGGSSEKIIEVPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESYLDGEQNFENKANGEGSVGLIYEDPIEKFDTLKHSKYEGKPDEEAYNRAKESLKHRKIFGEALYQAQPVRRNPGTPIVINKTNNSLPKEMEVIQPN 795          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000016386.1 (SMESG000016386.1)

HSP 1 Score: 291.582 bits (745), Expect = 1.324e-86
Identity = 164/449 (36.53%), Postives = 267/449 (59.47%), Query Frame = 3
Query:   60 MRKNKVQVFLRTRPSQ-KFSYDFFKIQEDK--KTIHIHIPKE-ERSYIVNNQISNWSFPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESE-----SNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPLILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYV---EGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEE 1367
            M K  +Q++LR RP++ KF    ++I +    + + + +P E + +Y  NN+  N+SF +  IF  +  QD +F  +   ++ + L G N T   YGQTG+GKTFT+TG  E +++RG+IPRALS ++    +D   S SV+ISY+EIYNE  YDLL   +  ++     + +T+ ED+  +  +K L  H A  EE+ALN LF G++NR  A   +N+ S+RSHC+FT++L +R      A  + +KL  VDLAGSER+ KT   G +L EA YIN SL +LEQ ++ALS+K R HIP+R S +T  L+DS+GGNC T ++A +  +  ++ E+IST RF+ R+  + +E I N   DP ++++ L+ ++  L+ ++ + D      ++    L++      R +V  ++   E +IS   + + R+I   ++    L++ TK +  E
Sbjct:    1 MVKQSIQIYLRIRPAEPKFPKGEYEITDSNSGEKLRLKVPLEIDNNYGANNKKDNYSFKYSKIFDKDSLQDSVFEAVARPVIDNFLKGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPRALSYIFEHCNKDKTCSTSVQISYLEIYNENGYDLLDAKHDTAQKLEDLNKVTLYEDQDSNVNLKNLSIHSAVNEEDALNLLFVGDTNRMVAETPMNQASTRSHCIFTIHLTTRQ--TDSAVITRSKLHLVDLAGSERVYKTGVDGTLLTEAKYINLSLHYLEQVIVALSEKNRTHIPYRNSMMTAVLRDSLGGNCMTSMVATISIEKRNLMESISTCRFSQRVALIKNEAILNEAVDPQLIIKQLRDQVEQLRLQMQLTDQSEEWQNVE---LTEDVIRRCRNEVVNFMEENESQISRDILKDYRKINLAFDIMKELYQKTKMKISE 444          

HSP 2 Score: 51.6026 bits (122), Expect = 2.242e-6
Identity = 42/141 (29.79%), Postives = 74/141 (52.48%), Query Frame = 3
Query: 1755 RSEAFEEFKIEQGKEISSILLENKEILSNKKKEYSVLANKINN-------IKSEIDESIIKLETLKREREFQGPSYTNDG-ELIITEEEFGEIQKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTE 2153
            R EAFE +K      ++S ++  +E L  K  +   L N INN       IKSEI +  I+      +     P+  N+   LI+T++E     ++   K  Y+E Y +LKNLK+ I H Q +++ ++ +++K+F+ W+ +
Sbjct:  560 REEAFEVYK--NNYPLNSQIISQREELKIKYNQAKELGNAINNARETTNRIKSEISKVRIQ------QAISADPNQNNENVSLIMTDQEVRLRHQMEVEKARYKEAYINLKNLKTVIEHMQHLLETSKVKMMKDFEQWWQD 692          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000035453.1 (SMESG000035453.1)

HSP 1 Score: 219.55 bits (558), Expect = 2.826e-60
Identity = 136/362 (37.57%), Postives = 197/362 (54.42%), Query Frame = 3
Query:  195 NNQISNWSFPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQAN-FSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGE 1271
            +N+     F FDG ++ +   + L++ I   LV +   G N T   YGQTG GK+FTM G       RG+IPRA  +++  I    N    V  SY+EIYNE + DLLA    + ++ L + E  +   +V GL  H      +    +  G  NR T + ++N  SSRSH +FT+YLE  +  +++ N     KL  VDLAGSER  KT +TG  L+EA+ IN SLS L   + AL D + +HIP+R SKLT  L+DS+GGN KT++IA +     + EET+ST+R+A R   + ++P   I  DP   L+R  Q EI+ LK  LA H  +        +P    +K  + E  R+ ++ E
Sbjct:   44 DNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRDLLAK---DVKAKLDLKEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKP--KINEDPKDALLREFQNEINRLKQMLAGHIPINMDAVSTAKPTDSSEKHRLTEIEREKIKAE 400          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000035453.1 (SMESG000035453.1)

HSP 1 Score: 219.164 bits (557), Expect = 3.295e-60
Identity = 136/362 (37.57%), Postives = 197/362 (54.42%), Query Frame = 3
Query:  195 NNQISNWSFPFDGIFH-NVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLESRSRMQSQAN-FSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKYVEGE 1271
            +N+     F FDG ++ +   + L++ I   LV +   G N T   YGQTG GK+FTM G       RG+IPRA  +++  I    N    V  SY+EIYNE + DLLA    + ++ L + E  +   +V GL  H      +    +  G  NR T + ++N  SSRSH +FT+YLE  +  +++ N     KL  VDLAGSER  KT +TG  L+EA+ IN SLS L   + AL D + +HIP+R SKLT  L+DS+GGN KT++IA +     + EET+ST+R+A R   + ++P   I  DP   L+R  Q EI+ LK  LA H  +        +P    +K  + E  R+ ++ E
Sbjct:   44 DNKTPQKPFFFDGSYNIDSTTEQLYSDIVYPLVENVTEGYNGTIFAYGQTGCGKSFTMQGIVNPSTQRGVIPRAFDHVFETISLAENSKYLVHASYLEIYNEEIRDLLAK---DVKAKLDLKEHPEKGVYVSGLSMHKVSNVRDCQVVMERGWKNRATGSTLMNVDSSRSHSIFTIYLEMFNTDENEENHIKAGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRMLQDSLGGNTKTLMIACLSPADNNYEETLSTLRYANRAKNIQNKP--KINEDPKDALLREFQNEINRLKQMLAGHIPINMDAVSTAKPTDSSEKHRLTEIEREKIKAE 400          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000075065.1 (SMESG000075065.1)

HSP 1 Score: 216.468 bits (550), Expect = 4.197e-60
Identity = 129/319 (40.44%), Postives = 185/319 (57.99%), Query Frame = 3
Query:  219 FPFDGIF-HNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTFTMTGATENFNNRGLIPRALSNLYRRIEE-DLNYSISVRISYVEIYNEVVYDLLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNRTTAAHILNKRSSRSHCVFTVYLE-SRSRMQSQANFSVAKLQFVDLAGSERLQKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLKDSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDPL-ILVRNLQKEISALKHEL 1163
            F FD +F  N  Q D++NK+   +V S LSG N T   YGQTG GKTFTM G  +    RG+IP + ++++  I + + N    VR+SY+EIYNE V DLL     +  + L + E      +VK L   +    +E    +  G  NR T A  +N+ SSRSH ++TV +E S +    +  F   KL  VDLAGSER  KT +TG  LQEA+ IN SL+ L   + AL D +  H+P+R SKLT  L+DS+GGN KT++IAN+     + +E++S++R+A R   + ++ I  I  DP   L+R  QKE+  L+ +L
Sbjct:   56 FTFDYVFGPNSKQVDVYNKVARPIVDSVLSGYNGTIFAYGQTGTGKTFTMEGKRDVPELRGIIPNSFAHVFGAIAKAETNVLFLVRVSYLEIYNEEVRDLLGK---DQTARLEVKERPDIGVYVKDLASFVVHGADEMDKLMTYGNKNRVTGATNMNEHSSRSHAIYTVTVEGSETLHDGEKTFRQGKLHLVDLAGSERQVKTGATGIRLQEANKINLSLATLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTLMIANIGPADYNFDESVSSLRYANRAKNIRNKAI--INEDPKDALLRQYQKELERLEQQL 369          
The following BLAST results are available for this feature:
BLAST of Kinesin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF92.926e-15548.97kinesin family member 9 [Source:HGNC Symbol;Acc:HG... [more]
KIF95.736e-15548.97kinesin family member 9 [Source:HGNC Symbol;Acc:HG... [more]
KIF95.736e-15548.97kinesin family member 9 [Source:HGNC Symbol;Acc:HG... [more]
KIF95.736e-15548.97kinesin family member 9 [Source:HGNC Symbol;Acc:HG... [more]
KIF91.379e-12150.76kinesin family member 9 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osm-33.513e-6241.72Osmotic avoidance abnormal protein 3 [Source:UniP... [more]
osm-38.371e-6241.72Osmotic avoidance abnormal protein 3 [Source:UniP... [more]
klp-111.674e-6137.34Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-201.024e-5537.50Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
klp-201.024e-5537.50Kinesin-like protein klp-20 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Klp64D6.460e-5735.94gene:FBgn0004380 transcript:FBtr0077157[more]
Kif3C9.475e-5338.89gene:FBgn0039925 transcript:FBtr0089196[more]
Klp31E2.404e-5036.02gene:FBgn0032243 transcript:FBtr0331642[more]
Klp31E2.568e-5036.02gene:FBgn0032243 transcript:FBtr0302039[more]
Klp31E2.568e-5036.02gene:FBgn0032243 transcript:FBtr0080018[more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif92.368e-16937.68kinesin family member 9 [Source:ZFIN;Acc:ZDB-GENE-... [more]
kif66.717e-8941.42kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
kif97.218e-6042.02kinesin family member 9 [Source:ZFIN;Acc:ZDB-GENE-... [more]
kif159.573e-5837.21kinesin family member 15 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3cb2.200e-5737.13kinesin family member 3Cb [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif150.000e+041.64kinesin family member 15 [Source:Xenbase;Acc:XB-GE... [more]
kif151.399e-16050.45kinesin family member 15 [Source:Xenbase;Acc:XB-GE... [more]
kif152.932e-14848.65kinesin family member 15 [Source:Xenbase;Acc:XB-GE... [more]
kif68.893e-9238.79kinesin family member 6 [Source:NCBI gene;Acc:1001... [more]
kif61.840e-8637.89kinesin family member 6 [Source:NCBI gene;Acc:1001... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif93.150e-16250.34kinesin family member 9 [Source:MGI Symbol;Acc:MGI... [more]
Kif91.461e-15850.34kinesin family member 9 [Source:MGI Symbol;Acc:MGI... [more]
Kif92.533e-15850.34kinesin family member 9 [Source:MGI Symbol;Acc:MGI... [more]
Kif96.257e-15850.34kinesin family member 9 [Source:MGI Symbol;Acc:MGI... [more]
Kif63.046e-9832.97kinesin family member 6 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WV04|KIF9_MOUSE1.022e-15750.34Kinesin-like protein KIF9 OS=Mus musculus OX=10090... [more]
sp|Q9HAQ2|KIF9_HUMAN2.754e-15448.97Kinesin-like protein KIF9 OS=Homo sapiens OX=9606 ... [more]
sp|P46870|KLP1_CHLRE4.325e-11834.87Kinesin-like protein KLP1 OS=Chlamydomonas reinhar... [more]
sp|Q6ZMV9|KIF6_HUMAN2.718e-9239.24Kinesin-like protein KIF6 OS=Homo sapiens OX=9606 ... [more]
sp|Q9GYZ0|KIF15_STRPU6.984e-6237.92Kinesin-like protein KIF15 OS=Strongylocentrotus p... [more]
back to top
BLAST of Kinesin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E8X30.000e+048.26Kinesin-like protein (Fragment) OS=Macrostomum lig... [more]
A0A1I8HAS30.000e+048.14Kinesin-like protein OS=Macrostomum lignano OX=282... [more]
A0A267GIZ70.000e+048.14Kinesin-like protein (Fragment) OS=Macrostomum lig... [more]
A0A1S3ISC30.000e+047.62Kinesin-like protein OS=Lingula unguis OX=7574 GN=... [more]
A0A2T7PW330.000e+046.50Kinesin-like protein OS=Pomacea canaliculata OX=40... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF92.469e-17841.65kinesin family member 9 [Source:HGNC Symbol;Acc:HG... [more]
KIF97.657e-6848.00kinesin family member 9 [Source:HGNC Symbol;Acc:HG... [more]
kif171.327e-5936.93kinesin family member 17 [Source:NCBI gene;Acc:103... [more]
kif3cb3.811e-5835.49kinesin-like protein KIF3B [Source:NCBI gene;Acc:1... [more]
kif3b1.594e-5738.68kinesin family member 3B [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF90.000e+039.10kinesin family member 9 [Source:HGNC Symbol;Acc:HG... [more]
kif66.208e-9038.44kinesin family member 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
kif3a1.071e-5638.94kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3ca2.571e-5636.88kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000010617.11.288e-5439.37pep scaffold:Pmarinus_7.0:GL476849:1993:16233:1 ge... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIP11.497e-4834.31Kinesin-related motor protein; required for mitoti... [more]
KIP39.366e-4637.05Kinesin-related antiparallel sliding motor protein... [more]
KAR33.419e-4037.16Minus-end-directed microtubule motor; functions in... [more]
KIP23.782e-3130.42Kinesin-related motor protein involved in mitotic ... [more]
CIN88.978e-2735.82Kinesin motor protein; involved in mitotic spindle... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO444910.000e+042.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328804.085e-9239.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408363.310e-6139.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375291.655e-5935.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491312.938e-5537.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif61.163e-8641.69kinesin family member 6 [Source:NCBI gene;Acc:1011... [more]
kif3b7.904e-5738.36kinesin family member 3B [Source:NCBI gene;Acc:101... [more]
kif3b7.904e-5738.36kinesin family member 3B [Source:NCBI gene;Acc:101... [more]
kif3a1.363e-5636.63kinesin-like protein KIF3A [Source:NCBI gene;Acc:1... [more]
kif3a1.458e-5639.06kinesin-like protein KIF3A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kinesin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073771.10.000e+099.50SMESG000073771.1[more]
SMESG000016386.11.324e-8636.53SMESG000016386.1[more]
SMESG000035453.12.826e-6037.57SMESG000035453.1[more]
SMESG000035453.13.295e-6037.57SMESG000035453.1[more]
SMESG000075065.14.197e-6040.44SMESG000075065.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012267 ID=SMED30012267|Name=Kinesin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2458bp
TTCTAGCTTATACCAATTTAAATATACATCTTTTTTGGAATATTTGTTAA
AAAATAATAATGCGTAAAAATAAAGTTCAAGTATTTTTAAGAACAAGACC
AAGTCAAAAGTTTTCATATGATTTTTTCAAAATCCAAGAAGATAAAAAGA
CTATTCATATTCATATACCAAAAGAAGAAAGGTCTTACATTGTCAATAAC
CAAATTTCAAATTGGTCATTTCCATTTGATGGAATTTTCCATAATGTACC
ACAGGATGATTTATTTAATAAAATCGGAATGGAATTAGTTGGATCTGCAC
TTAGTGGAATTAACAGTACTGCAATGTGCTATGGACAGACAGGAGCTGGG
AAGACTTTTACGATGACTGGAGCCACTGAAAATTTCAACAACAGAGGTTT
GATTCCTAGAGCCCTTTCAAACTTATATCGCCGAATCGAAGAGGATTTAA
ATTATTCCATATCTGTCAGGATATCTTATGTAGAAATTTACAACGAAGTA
GTCTATGATTTATTAGCCAACTTTAATCCAGAATCGGAATCCAATTTGAC
CATTGTTGAAGATGAAAAAGGATCTACTTGGGTCAAGGGATTAGGTTGTC
ACCTTGCACAAACGGAAGAAGAAGCTTTAAATTTTCTCTTTGAAGGTGAA
TCAAATCGAACTACAGCAGCCCATATATTGAATAAACGTTCTTCAAGGTC
GCATTGTGTTTTCACGGTTTATTTAGAGTCGCGGTCAAGAATGCAATCTC
AAGCCAATTTTTCAGTTGCTAAATTACAGTTTGTAGACTTAGCAGGATCA
GAAAGACTGCAGAAAACTCAATCTACTGGAAAAATACTTCAAGAGGCAAG
TTATATTAATAAATCATTATCTTTTCTGGAACAAACTGTTATTGCACTTT
CGGATAAGCAAAGAGAACATATCCCTTTTCGTCAAAGTAAACTTACCCAT
TTCTTGAAAGATTCAATTGGAGGAAATTGTAAAACTATTTTAATTGCAAA
TGTCTGGGCTGATTTGGAGCACGTTGAAGAAACAATTTCAACCATGAGAT
TTGCCATGAGAATGATGAAAGTTACAAGTGAACCAATTGAAAATATTCAA
TATGATCCCTTGATACTGGTCAGAAATTTACAAAAAGAAATTTCAGCTCT
TAAACACGAGTTAGCAATGCATGATGCACTGAGAAATAGGGGGCACATCG
CTTATGAACCATTAAGTGATCAACAAAAATTCGATATTAGAGAGCAAGTC
CGAAAGTATGTTGAAGGTGAAATATCCGAATTAGACATAGTTAATATACG
TCAAATAGAAGGAGTTTATGAAGCATTTAGCAATTTATTTCGATCAACGA
AACAAGAATATGAAGAGCAAATTAAAAATTTATTGACCTCGTCTATTCAA
AATCAACAAGTAACCCAACAAACAGTTACTTCAAGTTCACAAGGTAAGCA
AAATAGACGAGAACAAAAAGAAAAGATGAGCACCGCTGGAATTGCTTCTT
CAGTGACAACGTCAGAAACACCTCAAATACAGCAACCATCTCCCAAAGTT
GGTGATATTGACAAAAATTCCGGATTCGGTGTCGGCCAGGCTGATCGAAA
TTTATTAGATGAAAATGGGGGTTATTTGCAAAGTCGAAAGAAAGAAAGAA
AACGATTAATAATGAATTCAAAAGCTAGCAACATTGTTTCCAAAGATGAG
TTTGTGAATGAAAGACTAGGTGGTTCGAGTGAAAAGATTATCGAAGTTCC
AACTAGGTCAGAAGCGTTTGAAGAATTTAAGATAGAACAAGGAAAGGAAA
TATCTAGCATTTTGTTAGAAAATAAAGAAATATTGTCCAATAAGAAAAAG
GAATATTCTGTCTTGGCCAACAAAATAAATAATATAAAATCTGAAATCGA
TGAAAGTATAATAAAATTAGAAACTCTTAAACGCGAGAGAGAGTTTCAAG
GTCCTAGTTATACCAATGATGGTGAACTAATAATAACTGAAGAAGAATTT
GGAGAGATTCAAAAATTAAATGACAACAAAAAATGTTATCGAGAATTTTA
TGAAGATTTAAAAAATTTAAAAAGTGCTATTCTTCATTGCCAAAAAATGG
TTGATTTAACTCGCCAACGCCTAATTAAGGAGTTTGATTTATGGTATACC
GAGTCATATCTCGATGGTGAACAAAACTTTGAAAATAAAGCAAATGGTGA
AGGATCAGTTGGTTTAATCTATGAAGATCCGATAGAGAAATTCGATACAC
TCAAACATTCTAAATATGAAGGGAAACCGGATGAAGAAGCTTATAATAGA
GCTAAAGAATCTTTAAAACACAGAAAAATATTTGGAGAAGCACTTTATCA
GGCTCAACCAGTTCGAAGAAATCCTGGCACTCCTATAGTGATAAATAAAA
CAAATAATTCTTTACCAAAAGAAATGGAAGTTATTCAACCTAATTAGATA
AAATAGAT
back to top

protein sequence of SMED30012267-orf-1

>SMED30012267-orf-1 ID=SMED30012267-orf-1|Name=SMED30012267-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=796bp
MRKNKVQVFLRTRPSQKFSYDFFKIQEDKKTIHIHIPKEERSYIVNNQIS
NWSFPFDGIFHNVPQDDLFNKIGMELVGSALSGINSTAMCYGQTGAGKTF
TMTGATENFNNRGLIPRALSNLYRRIEEDLNYSISVRISYVEIYNEVVYD
LLANFNPESESNLTIVEDEKGSTWVKGLGCHLAQTEEEALNFLFEGESNR
TTAAHILNKRSSRSHCVFTVYLESRSRMQSQANFSVAKLQFVDLAGSERL
QKTQSTGKILQEASYINKSLSFLEQTVIALSDKQREHIPFRQSKLTHFLK
DSIGGNCKTILIANVWADLEHVEETISTMRFAMRMMKVTSEPIENIQYDP
LILVRNLQKEISALKHELAMHDALRNRGHIAYEPLSDQQKFDIREQVRKY
VEGEISELDIVNIRQIEGVYEAFSNLFRSTKQEYEEQIKNLLTSSIQNQQ
VTQQTVTSSSQGKQNRREQKEKMSTAGIASSVTTSETPQIQQPSPKVGDI
DKNSGFGVGQADRNLLDENGGYLQSRKKERKRLIMNSKASNIVSKDEFVN
ERLGGSSEKIIEVPTRSEAFEEFKIEQGKEISSILLENKEILSNKKKEYS
VLANKINNIKSEIDESIIKLETLKREREFQGPSYTNDGELIITEEEFGEI
QKLNDNKKCYREFYEDLKNLKSAILHCQKMVDLTRQRLIKEFDLWYTESY
LDGEQNFENKANGEGSVGLIYEDPIEKFDTLKHSKYEGKPDEEAYNRAKE
SLKHRKIFGEALYQAQPVRRNPGTPIVINKTNNSLPKEMEVIQPN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR001752Kinesin_motor_dom
IPR019821Kinesin_motor_CS
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule