Elongator complex protein 3

Overview
NameElongator complex protein 3
Smed IDSMED30012263
Length (bp)1809
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Elongator complex protein 3 (SMED30012263) t-SNE clustered cells

Violin plots show distribution of expression levels for Elongator complex protein 3 (SMED30012263) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Elongator complex protein 3 (SMED30012263) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Elongator complex protein 3 (SMED30012263) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012263

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012263h1SMcG0014983 SmedASXL_009384SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012263h1SMcG0014983 SmedASXL_009384SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Elongator complex protein 3 vs. Ensembl Human
Match: ELP3 (elongator acetyltransferase complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:20696])

HSP 1 Score: 902.894 bits (2332), Expect = 0.000e+0
Identity = 434/557 (77.92%), Postives = 496/557 (89.05%), Query Frame = 3
Query:   51 MGKAKKVDKS-QDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            M + +K D S  + MM TI ++I++LI+A+ + + +DLNK+KTK ++K GL  QPRLVDII  VP +Y+K+L+P+LKAKP+R+ASGI VVAVMCKPHRCPHIS TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  EYRDYFIRNLHDALSGH S N+ EAVKYSERS TKC+GITIETRPDYC+K+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH +KD+GFKVVAHMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWK+ +Y SY P+ L++L+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG++CRDVRTREVG+QEI+HK+RPYQ+ELVRRDYVANGGWETFLSYEDPDQDIL+GL RLR+CS E FR EL         G   G SI+RELHVYG+ VP++++DPTKFQHQGFG LL+EE+ERIAR+EHGS KIA+ISGVGTRNYYRK+GY L+GPYMVKML
Sbjct:    1 MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFEL--------GG---GVSIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGPYMVKML 546          
BLAST of Elongator complex protein 3 vs. Ensembl Human
Match: ELP3 (elongator acetyltransferase complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:20696])

HSP 1 Score: 902.123 bits (2330), Expect = 0.000e+0
Identity = 430/543 (79.19%), Postives = 489/543 (90.06%), Query Frame = 3
Query:   90 MMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MM TI ++I++LI+A+ + + +DLNK+KTK ++K GL  QPRLVDII  VP +Y+K+L+P+LKAKP+R+ASGI VVAVMCKPHRCPHIS TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  EYRDYFIRNLHDALSGH S N+ EAVKYSERS TKC+GITIETRPDYC+K+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH +KD+GFKVVAHMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWK+ +Y SY P+ L++L+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG++CRDVRTREVG+QEI+HK+RPYQ+ELVRRDYVANGGWETFLSYEDPDQDIL+GL RLR+CS E FR EL         G   G SI+RELHVYG+ VP++++DPTKFQHQGFG LL+EE+ERIAR+EHGS KIA+ISGVGTRNYYRK+GY L+GPYMVKML
Sbjct:    1 MMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFEL--------GG---GVSIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGPYMVKML 532          
BLAST of Elongator complex protein 3 vs. Ensembl Human
Match: ELP3 (elongator acetyltransferase complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:20696])

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 399/485 (82.27%), Postives = 443/485 (91.34%), Query Frame = 3
Query:  264 VPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            +P+LKAKP+R+ASGI VVAVMCKPHRCPHIS TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  EYRDYFIRNLHDALSGH S N+ EAVKYSERS TKC+GITIETRPDYC+K+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH +KD+GFKVVAHMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWK+ +Y SY P+ L++L+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG++CRDVRTREVG+QEI+HK+RPYQ+ELVRRDYVANGGWETFLSYEDPDQDIL+GL RLR+CS E FR EL         G   G SI+RELHVYG+ VP++++DPTKFQHQGFG LL+EE+ERIAR+EHGS KIA+ISGVGTRNYYRK+GY L+GPYMVKML
Sbjct:    1 MPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFEL--------GG---GVSIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGPYMVKML 474          
BLAST of Elongator complex protein 3 vs. Ensembl Human
Match: ELP3 (elongator acetyltransferase complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:20696])

HSP 1 Score: 801.586 bits (2069), Expect = 0.000e+0
Identity = 384/465 (82.58%), Postives = 424/465 (91.18%), Query Frame = 3
Query:  324 MCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MCKPHRCPHIS TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  EYRDYFIRNLHDALSGH S N+ EAVKYSERS TKC+GITIETRPDYC+K+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH +KD+GFKVVAHMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWK+ +Y SY P+ L++L+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG++CRDVRTREVG+QEI+HK+RPYQ+ELVRRDYVANGGWETFLSYEDPDQDIL+GL RLR+CS E FR EL         G   G SI+RELHVYG+ VP++++DPTKFQHQGFG LL+EE+ERIAR+EHGS KIA+ISGVGTRNYYRK+GY L+GPYMVKML
Sbjct:    1 MCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFEL--------GG---GVSIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGPYMVKML 454          
BLAST of Elongator complex protein 3 vs. Ensembl Human
Match: ELP3 (elongator acetyltransferase complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:20696])

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 346/426 (81.22%), Postives = 386/426 (90.61%), Query Frame = 3
Query:  441 PTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            PTSMRAIRARYDPFLQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  EYRDYFIRNLHDALSGH S N+ EAVKYSERS TKC+GITIETRPDYC+K+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH +KD+GFKVVAHMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWK+ +Y SY P+ L++L+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG++CRDVRTREVG+QEI+HK+RPYQ+ELVRRDYVANGGWETFLSYEDPDQDIL+GL RLR+CS E FR EL         G   G SI+RELHVYG+ VP++++DPTKFQHQGFG LL+EE+ERIAR+EHGS KIA+ISGVGTRNYYRK+GY L+GPYMVKML
Sbjct:   13 PTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFEL--------GG---GVSIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGPYMVKML 427          
BLAST of Elongator complex protein 3 vs. Ensembl Celegans
Match: elpc-3 (Probable elongator complex protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q23651])

HSP 1 Score: 840.491 bits (2170), Expect = 0.000e+0
Identity = 399/543 (73.48%), Postives = 472/543 (86.92%), Query Frame = 3
Query:   90 MMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            + +TI+EI++ LI+A+++ + V+LN+LK  ++ KNGL +QP+LVDII GVP +YK  L+P+LKAKPVR+ASGI VVAVM KPHRCPHI+ TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARY+P+LQTR RL QL QLGHSVDKVEFIVMGGTFM+L  +YRD+FIRNLHDALSGH S +VEEAV YSERS  KC+GITIETRPDYCL +HL+DML YGCTRLEIGVQS YEDVARDTNRGHTVK+VCE+FH +KD G+KVV HMMPDLPNVG +RD+ QF E FE+PAFR DGLK+YPTLVIRGTGLYELWKT +Y SYPP+VL+DLIA IL+LVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+ A+A+M ELG+KCRDVRTREVG+QEI++K+RP  +EL+RRDY ANGGWETF+SYEDP QDIL+GL RLR+ S +  RPEL    K ++       S++RELHVYG+ V +  +DP KFQHQG+G LL+EE+ERIAR+EHGS KIA+ISGVGTR YYRK+GYEL+GPYM KML
Sbjct:   11 LAQTINEIVKLLIEAHNQKKDVNLNRLKCIVAQKNGLSFQPKLVDIIAGVPSDYKDSLLPKLKAKPVRTASGIAVVAVMSKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYLQTRGRLNQLMQLGHSVDKVEFIVMGGTFMSLPEDYRDFFIRNLHDALSGHTSASVEEAVAYSERSKMKCIGITIETRPDYCLPRHLNDMLLYGCTRLEIGVQSTYEDVARDTNRGHTVKSVCETFHMAKDTGYKVVIHMMPDLPNVGLERDKEQFLELFESPAFRPDGLKLYPTLVIRGTGLYELWKTGRYQSYPPSVLVDLIATILSLVPPWTRVYRVQRDIPMPLVSSGVEHGNLREHAMAKMKELGLKCRDVRTREVGIQEIHNKVRPEDVELIRRDYTANGGWETFISYEDPKQDILIGLLRLRKISDKAHRPEL----KGNV-------SVVRELHVYGSVVSVADRDPKKFQHQGYGSLLMEEAERIAREEHGSDKIAVISGVGTREYYRKLGYELDGPYMSKML 542          
BLAST of Elongator complex protein 3 vs. Ensembl Fly
Match: Elp3 (gene:FBgn0031604 transcript:FBtr0077439)

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 421/549 (76.68%), Postives = 487/549 (88.71%), Query Frame = 3
Query:   81 QDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML*RN 1727
            Q+  +  I EII+EL+KA+   + V+LN++K+ ++SK GL   PRLVDII  VPQ+ KKIL+P+L+AKP+R+ASGI VVAVMCKPHRCPHI+MTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIR+RYDPFLQTRHR+EQL QLGHSVDKVEFIVMGGTFM L  EYRDYFIRNLHDALSGH S NV EAV+YSE+S TKC+GITIETRPDYCLK+H+SDML YGCTRLEIGVQSVYEDVARDTNRGHTV+AVCESF   KDAG+K+V HMMPDLPNV ++RD  QF E+FENPAFR+DGLKIYPTLVIRGTGLYELWKT +Y SYPP++L+DL+A+ILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG  CRDVRTREVG+QEI++K+RPY+IEL+RRDYVANGGWETFLSYEDP+QDILVGL RLR+CS + FRPEL         G+   CSI+RELHVYG+ VP+NA+DPTKFQHQGFG LL+EE+ERIAR+EHGS K+A+ISGVGTRNYYRKMGY+L+GPYM K +  N
Sbjct:   14 QERQVLVIGEIIQELLKAHEAKKDVNLNRMKSLVASKYGLDSSPRLVDIIAAVPQDAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRSRYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLPEEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHISDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVTHMMPDLPNVDFERDIEQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTTCRDVRTREVGIQEIHNKVRPYEIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSPDTFRPEL--------KGE---CSIVRELHVYGSVVPVNARDPTKFQHQGFGMLLMEEAERIAREEHGSTKLAVISGVGTRNYYRKMGYQLDGPYMSKSIEEN 551          
BLAST of Elongator complex protein 3 vs. Ensembl Zebrafish
Match: elp3 (elongator acetyltransferase complex subunit 3 [Source:NCBI gene;Acc:541509])

HSP 1 Score: 926.776 bits (2394), Expect = 0.000e+0
Identity = 430/543 (79.19%), Postives = 488/543 (89.87%), Query Frame = 3
Query:   90 MMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MM TI+++I++L++A+ E + ++LNK+KTK S+K GL  QPRLVDII  VP  Y++ LVP+LKAKP+R+ASGI VVAVMCKPHRCPHIS TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  EYRDYFIRNLHDALSGH S NV EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTV+AVCESFH +KDAGFKVVAHMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM ++G +CRDVRTREVG+QEI+HK+RPYQ+EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL             G SI+RELHVYG+ VP++++DP+KFQHQGFG +L+EE+ERIARDEHGS K+A+ISGVGTRNYYRKMGYELEGPYMVK L
Sbjct:    1 MMMTIADVIKQLVEAHEEGKDINLNKVKTKTSAKYGLSAQPRLVDIIAAVPPHYRRALVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNVTEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLGYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHLAKDAGFKVVAHMMPDLPNVGMERDVEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYSPSALVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDMGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRRCSPQSFRPEL-----------KGGVSIVRELHVYGSVVPVSSRDPSKFQHQGFGMMLMEEAERIARDEHGSSKLAVISGVGTRNYYRKMGYELEGPYMVKNL 532          
BLAST of Elongator complex protein 3 vs. Ensembl Zebrafish
Match: elp3 (elongator acetyltransferase complex subunit 3 [Source:NCBI gene;Acc:541509])

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 384/465 (82.58%), Postives = 424/465 (91.18%), Query Frame = 3
Query:  324 MCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MCKPHRCPHIS TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  EYRDYFIRNLHDALSGH S NV EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTV+AVCESFH +KDAGFKVVAHMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM ++G +CRDVRTREVG+QEI+HK+RPYQ+EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL             G SI+RELHVYG+ VP++++DP+KFQHQGFG +L+EE+ERIARDEHGS K+A+ISGVGTRNYYRKMGYELEGPYMVK L
Sbjct:    1 MCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNVTEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLGYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHLAKDAGFKVVAHMMPDLPNVGMERDVEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYSPSALVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDMGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRRCSPQSFRPEL-----------KGGVSIVRELHVYGSVVPVSSRDPSKFQHQGFGMMLMEEAERIARDEHGSSKLAVISGVGTRNYYRKMGYELEGPYMVKNL 454          
BLAST of Elongator complex protein 3 vs. Ensembl Xenopus
Match: gucd1 (guanylyl cyclase domain containing 1 [Source:Xenbase;Acc:XB-GENE-941300])

HSP 1 Score: 908.672 bits (2347), Expect = 0.000e+0
Identity = 429/543 (79.01%), Postives = 490/543 (90.24%), Query Frame = 3
Query:   90 MMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MM T++++I++L++A+ + + V+LNKLKTK S+K GL  QPRLVDII  VP +Y+KILVP+LKAKP+R+ASGI VVAVMCKPHRCPHI+ TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  +YRD+FIRNLHDALSGH S +V EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH +KDAGFKVV+HMMPDLPNVG +RD  QF EFFENPAFR DG+K+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG +CRDVRTREVG+QEI+HK+RPYQ+EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL             G SI+RELHVYG+ VPI+++DP+KFQHQGFG LL+EE+ERIAR+EHGS KIA+ISGVGTRNYYRK+GYELEGPYMVK L
Sbjct:   26 MMMTVADVIKQLVEAHEQGKDVNLNKLKTKTSAKYGLSAQPRLVDIIAAVPPQYRKILVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALSEDYRDFFIRNLHDALSGHTSNSVSEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHMAKDAGFKVVSHMMPDLPNVGLERDTEQFIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYRSYSPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEQSFRPEL-----------KGGVSIVRELHVYGSVVPISSRDPSKFQHQGFGMLLMEEAERIAREEHGSWKIAVISGVGTRNYYRKLGYELEGPYMVKKL 557          
BLAST of Elongator complex protein 3 vs. Ensembl Xenopus
Match: gucd1 (guanylyl cyclase domain containing 1 [Source:Xenbase;Acc:XB-GENE-941300])

HSP 1 Score: 907.516 bits (2344), Expect = 0.000e+0
Identity = 429/543 (79.01%), Postives = 490/543 (90.24%), Query Frame = 3
Query:   90 MMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MM T++++I++L++A+ + + V+LNKLKTK S+K GL  QPRLVDII  VP +Y+KILVP+LKAKP+R+ASGI VVAVMCKPHRCPHI+ TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  +YRD+FIRNLHDALSGH S +V EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH +KDAGFKVV+HMMPDLPNVG +RD  QF EFFENPAFR DG+K+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG +CRDVRTREVG+QEI+HK+RPYQ+EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL             G SI+RELHVYG+ VPI+++DP+KFQHQGFG LL+EE+ERIAR+EHGS KIA+ISGVGTRNYYRK+GYELEGPYMVK L
Sbjct:   10 MMMTVADVIKQLVEAHEQGKDVNLNKLKTKTSAKYGLSAQPRLVDIIAAVPPQYRKILVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALSEDYRDFFIRNLHDALSGHTSNSVSEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHMAKDAGFKVVSHMMPDLPNVGLERDTEQFIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYRSYSPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEQSFRPEL-----------KGGVSIVRELHVYGSVVPISSRDPSKFQHQGFGMLLMEEAERIAREEHGSWKIAVISGVGTRNYYRKLGYELEGPYMVKKL 541          
BLAST of Elongator complex protein 3 vs. Ensembl Xenopus
Match: gucd1 (guanylyl cyclase domain containing 1 [Source:Xenbase;Acc:XB-GENE-941300])

HSP 1 Score: 907.516 bits (2344), Expect = 0.000e+0
Identity = 429/543 (79.01%), Postives = 490/543 (90.24%), Query Frame = 3
Query:   90 MMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MM T++++I++L++A+ + + V+LNKLKTK S+K GL  QPRLVDII  VP +Y+KILVP+LKAKP+R+ASGI VVAVMCKPHRCPHI+ TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  +YRD+FIRNLHDALSGH S +V EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH +KDAGFKVV+HMMPDLPNVG +RD  QF EFFENPAFR DG+K+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG +CRDVRTREVG+QEI+HK+RPYQ+EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL             G SI+RELHVYG+ VPI+++DP+KFQHQGFG LL+EE+ERIAR+EHGS KIA+ISGVGTRNYYRK+GYELEGPYMVK L
Sbjct:   17 MMMTVADVIKQLVEAHEQGKDVNLNKLKTKTSAKYGLSAQPRLVDIIAAVPPQYRKILVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALSEDYRDFFIRNLHDALSGHTSNSVSEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHMAKDAGFKVVSHMMPDLPNVGLERDTEQFIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYRSYSPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEQSFRPEL-----------KGGVSIVRELHVYGSVVPISSRDPSKFQHQGFGMLLMEEAERIAREEHGSWKIAVISGVGTRNYYRKLGYELEGPYMVKKL 548          
BLAST of Elongator complex protein 3 vs. Ensembl Xenopus
Match: gucd1 (guanylyl cyclase domain containing 1 [Source:Xenbase;Acc:XB-GENE-941300])

HSP 1 Score: 907.516 bits (2344), Expect = 0.000e+0
Identity = 429/543 (79.01%), Postives = 490/543 (90.24%), Query Frame = 3
Query:   90 MMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MM T++++I++L++A+ + + V+LNKLKTK S+K GL  QPRLVDII  VP +Y+KILVP+LKAKP+R+ASGI VVAVMCKPHRCPHI+ TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  +YRD+FIRNLHDALSGH S +V EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH +KDAGFKVV+HMMPDLPNVG +RD  QF EFFENPAFR DG+K+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG +CRDVRTREVG+QEI+HK+RPYQ+EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL             G SI+RELHVYG+ VPI+++DP+KFQHQGFG LL+EE+ERIAR+EHGS KIA+ISGVGTRNYYRK+GYELEGPYMVK L
Sbjct:   88 MMMTVADVIKQLVEAHEQGKDVNLNKLKTKTSAKYGLSAQPRLVDIIAAVPPQYRKILVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALSEDYRDFFIRNLHDALSGHTSNSVSEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHMAKDAGFKVVSHMMPDLPNVGLERDTEQFIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYRSYSPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEQSFRPEL-----------KGGVSIVRELHVYGSVVPISSRDPSKFQHQGFGMLLMEEAERIAREEHGSWKIAVISGVGTRNYYRKLGYELEGPYMVKKL 619          
BLAST of Elongator complex protein 3 vs. Ensembl Xenopus
Match: gucd1 (guanylyl cyclase domain containing 1 [Source:Xenbase;Acc:XB-GENE-941300])

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 429/543 (79.01%), Postives = 490/543 (90.24%), Query Frame = 3
Query:   90 MMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MM T++++I++L++A+ + + V+LNKLKTK S+K GL  QPRLVDII  VP +Y+KILVP+LKAKP+R+ASGI VVAVMCKPHRCPHI+ TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  +YRD+FIRNLHDALSGH S +V EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH +KDAGFKVV+HMMPDLPNVG +RD  QF EFFENPAFR DG+K+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG +CRDVRTREVG+QEI+HK+RPYQ+EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL             G SI+RELHVYG+ VPI+++DP+KFQHQGFG LL+EE+ERIAR+EHGS KIA+ISGVGTRNYYRK+GYELEGPYMVK L
Sbjct:   18 MMMTVADVIKQLVEAHEQGKDVNLNKLKTKTSAKYGLSAQPRLVDIIAAVPPQYRKILVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALSEDYRDFFIRNLHDALSGHTSNSVSEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHMAKDAGFKVVSHMMPDLPNVGLERDTEQFIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYRSYSPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEQSFRPEL-----------KGGVSIVRELHVYGSVVPISSRDPSKFQHQGFGMLLMEEAERIAREEHGSWKIAVISGVGTRNYYRKLGYELEGPYMVKKL 549          
BLAST of Elongator complex protein 3 vs. Ensembl Mouse
Match: Elp3 (elongator acetyltransferase complex subunit 3 [Source:MGI Symbol;Acc:MGI:1921445])

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 426/543 (78.45%), Postives = 485/543 (89.32%), Query Frame = 3
Query:   90 MMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MM TI ++I++L++A+ + + VDLNK+KTK ++K GL  QPRLVDII  VP  Y+KIL+P+LKAKPVR+ASGI VVAVMCKPHRCPHIS TGNIC+YCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  EYRDYFIR+LHDALSGH S N+ EA+KYSERS TKCVGITIETRPDYC+K+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKA CESFH +KD+GFKVV HMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWK+ +Y SY P+ LI+L+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LA ARM +LG++CRDVRTREVG+QEI+H++RPYQ+ELVRRDYVANGGWETFLSYEDPDQDIL+GL RLR+CS E FR EL         G   G SI+RELHVYG+ VP++++DPTKFQHQGFG LL+EE+ERIAR+EHGS K+A+ISGVGTRNYYRK+GY L+GPYMVKML
Sbjct:   34 MMLTIGDVIKQLVEAHEQGKDVDLNKMKTKTAAKYGLASQPRLVDIIAAVPPHYRKILIPKLKAKPVRTASGIAVVAVMCKPHRCPHISFTGNICIYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRSLHDALSGHTSNNIHEAIKYSERSFTKCVGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAACESFHLAKDSGFKVVTHMMPDLPNVGLERDIEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYRSYSPSDLIELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHRVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFEL--------GG---GVSIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKMAVISGVGTRNYYRKIGYRLQGPYMVKML 565          
BLAST of Elongator complex protein 3 vs. Ensembl Mouse
Match: Elp3 (elongator acetyltransferase complex subunit 3 [Source:MGI Symbol;Acc:MGI:1921445])

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 430/557 (77.20%), Postives = 492/557 (88.33%), Query Frame = 3
Query:   51 MGKAKKVDKS-QDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            M + +K D S  + MM TI ++I++L++A+ + + VDLNK+KTK ++K GL  QPRLVDII  VP  Y+KIL+P+LKAKPVR+ASGI VVAVMCKPHRCPHIS TGNIC+YCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  EYRDYFIR+LHDALSGH S N+ EA+KYSERS TKCVGITIETRPDYC+K+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKA CESFH +KD+GFKVV HMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWK+ +Y SY P+ LI+L+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LA ARM +LG++CRDVRTREVG+QEI+H++RPYQ+ELVRRDYVANGGWETFLSYEDPDQDIL+GL RLR+CS E FR EL         G   G SI+RELHVYG+ VP++++DPTKFQHQGFG LL+EE+ERIAR+EHGS K+A+ISGVGTRNYYRK+GY L+GPYMVKML
Sbjct:    1 MRQKRKGDLSPAELMMLTIGDVIKQLVEAHEQGKDVDLNKMKTKTAAKYGLASQPRLVDIIAAVPPHYRKILIPKLKAKPVRTASGIAVVAVMCKPHRCPHISFTGNICIYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRSLHDALSGHTSNNIHEAIKYSERSFTKCVGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAACESFHLAKDSGFKVVTHMMPDLPNVGLERDIEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYRSYSPSDLIELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHRVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFEL--------GG---GVSIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKMAVISGVGTRNYYRKIGYRLQGPYMVKML 546          
BLAST of Elongator complex protein 3 vs. Ensembl Mouse
Match: Elp3 (elongator acetyltransferase complex subunit 3 [Source:MGI Symbol;Acc:MGI:1921445])

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 410/534 (76.78%), Postives = 470/534 (88.01%), Query Frame = 3
Query:   51 MGKAKKVDKS-QDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISG 1649
            M + +K D S  + MM TI ++I++L++A+ + + VDLNK+KTK ++K GL  QPRLVDII  VP  Y+KIL+P+LKAKPVR+ASGI VVAVMCKPHRCPHIS TGNIC+YCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  EYRDYFIR+LHDALSGH S N+ EA+KYSERS TKCVGITIETRPDYC+K+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKA CESFH +KD+GFKVV HMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWK+ +Y SY P+ LI+L+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LA ARM +LG++CRDVRTREVG+QEI+H++RPYQ+ELVRRDYVANGGWETFLSYEDPDQDIL+GL RLR+CS E FR EL         G   G SI+RELHVYG+ VP++++DPTKFQHQGFG LL+EE+ERIAR+EHGS K+A+ISG
Sbjct:    1 MRQKRKGDLSPAELMMLTIGDVIKQLVEAHEQGKDVDLNKMKTKTAAKYGLASQPRLVDIIAAVPPHYRKILIPKLKAKPVRTASGIAVVAVMCKPHRCPHISFTGNICIYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRSLHDALSGHTSNNIHEAIKYSERSFTKCVGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAACESFHLAKDSGFKVVTHMMPDLPNVGLERDIEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYRSYSPSDLIELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHRVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFEL--------GG---GVSIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKMAVISG 523          
BLAST of Elongator complex protein 3 vs. UniProt/SwissProt
Match: sp|Q5ZHS1|ELP3_CHICK (Elongator complex protein 3 OS=Gallus gallus OX=9031 GN=ELP3 PE=2 SV=1)

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 437/556 (78.60%), Postives = 495/556 (89.03%), Query Frame = 3
Query:   51 MGKAKKVDKSQDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MG+ +K     + MM TI++II++LI+A+ + + V+LNKLKTK S+K GL  QPRLVDII  VP +++K LVP+LKAKP+R+ASGI VVAVMCKPHRCPHI+ TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  +YRDYFIRNLHDALSGH S NV EAVKYSERS TKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH +KDAGFKVVAHMMPDLPN+G +RD  QF EFFENPAFR DG+K+YPTLVIRGTGLYELWKT +Y SYPP+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG +CRDVRTREVG+QEI+HK+RPYQIEL+RRDYVANGGWETFLSYEDP+QDILVGL RLR+CS E FRPEL             G SI+RELHVYG+ VP++++DP+KFQHQGFG LL+EE+ERIA++EHGS KIA+ISGVGTRNYYRK+GYELEGPYMVK L
Sbjct:    1 MGQKRKDLSHAELMMMTIADIIKQLIEAHEQGKDVNLNKLKTKTSAKYGLSAQPRLVDIIAAVPPQHRKALVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALPEDYRDYFIRNLHDALSGHTSNNVAEAVKYSERSLTKCVGITIETRPDYCLKRHLSDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDLPNMGLERDTDQFVEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYKSYPPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTQCRDVRTREVGIQEIHHKVRPYQIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSEESFRPEL-----------KGGVSIVRELHVYGSVVPVSSRDPSKFQHQGFGMLLMEEAERIAKEEHGSWKIAVISGVGTRNYYRKIGYELEGPYMVKRL 545          
BLAST of Elongator complex protein 3 vs. UniProt/SwissProt
Match: sp|Q5RIC0|ELP3_DANRE (Elongator complex protein 3 OS=Danio rerio OX=7955 GN=elp3 PE=2 SV=3)

HSP 1 Score: 931.013 bits (2405), Expect = 0.000e+0
Identity = 437/558 (78.32%), Postives = 497/558 (89.07%), Query Frame = 3
Query:   51 MGK-AKKVDKSQ-DGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MGK  KK D S+ + MM TI+++I++L++A+ E + ++LNK+KTK S+K GL  QPRLVDII  VP  Y++ LVP+LKAKP+R+ASGI VVAVMCKPHRCPHIS TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  EYRDYFIRNLHDALSGH S NV EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTV+AVCESFH +KDAGFKVVAHMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM ++G +CRDVRTREVG+QEI+HK+RPYQ+EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL             G SI+RELHVYG+ VP++++DP+KFQHQGFG +L+EE+ERIARDEHGS K+A+ISGVGTRNYYRKMGYELEGPYMVK L
Sbjct:    1 MGKPKKKSDLSRAELMMMTIADVIKQLVEAHEEGKDINLNKVKTKTSAKYGLSAQPRLVDIIAAVPPHYRRALVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNVTEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLGYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHLAKDAGFKVVAHMMPDLPNVGMERDVEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYSPSALVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDMGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRRCSPQSFRPEL-----------KGGVSIVRELHVYGSVVPVSSRDPSKFQHQGFGMMLMEEAERIARDEHGSSKLAVISGVGTRNYYRKMGYELEGPYMVKNL 547          
BLAST of Elongator complex protein 3 vs. UniProt/SwissProt
Match: sp|Q5HZM6|ELP3_XENLA (Elongator complex protein 3 OS=Xenopus laevis OX=8355 GN=elp3 PE=2 SV=1)

HSP 1 Score: 924.08 bits (2387), Expect = 0.000e+0
Identity = 430/543 (79.19%), Postives = 490/543 (90.24%), Query Frame = 3
Query:   90 MMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MM T++++I++L++A+ + + V+LNKLKTK S+K GL  QPRLVDII  VP +Y+KILVP+LKAKP+R+ASGI VVAVMCKPHRCPHI+ TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGH+VDKVEFIVMGGTFMAL  +YRD+FIRNLHDALSGH S +V EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH SKDAGFKVV+HMMPDLPN+G +RD  QF EFFENPAFR DG+K+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG +CRDVRTREVG+QEI+HK+RPYQ+EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS E FRPEL             G SI+RELHVYG+ VPI+++DP+KFQHQGFG LL+EE+ERIARDEHGS KIA+ISGVGTRNYYRK+GYELEGPYMVK L
Sbjct:   17 MMMTVADVIKQLVEAHEQGKDVNLNKLKTKTSAKYGLSAQPRLVDIIAAVPPQYRKILVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHNVDKVEFIVMGGTFMALPEDYRDFFIRNLHDALSGHTSNSVSEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLCYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLSKDAGFKVVSHMMPDLPNMGLERDIEQFIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYRSYSPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEESFRPEL-----------KGGVSIVRELHVYGSVVPISSRDPSKFQHQGFGMLLMEEAERIARDEHGSWKIAVISGVGTRNYYRKIGYELEGPYMVKRL 548          
BLAST of Elongator complex protein 3 vs. UniProt/SwissProt
Match: sp|Q6NVL5|ELP3_XENTR (Elongator complex protein 3 OS=Xenopus tropicalis OX=8364 GN=elp3 PE=2 SV=1)

HSP 1 Score: 908.286 bits (2346), Expect = 0.000e+0
Identity = 429/543 (79.01%), Postives = 490/543 (90.24%), Query Frame = 3
Query:   90 MMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MM T++++I++L++A+ + + V+LNKLKTK S+K GL  QPRLVDII  VP +Y+KILVP+LKAKP+R+ASGI VVAVMCKPHRCPHI+ TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  +YRD+FIRNLHDALSGH S +V EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH +KDAGFKVV+HMMPDLPNVG +RD  QF EFFENPAFR DG+K+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG +CRDVRTREVG+QEI+HK+RPYQ+EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL             G SI+RELHVYG+ VPI+++DP+KFQHQGFG LL+EE+ERIAR+EHGS KIA+ISGVGTRNYYRK+GYELEGPYMVK L
Sbjct:   17 MMMTVADVIKQLVEAHEQGKDVNLNKLKTKTSAKYGLSAQPRLVDIIAAVPPQYRKILVPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALSEDYRDFFIRNLHDALSGHTSNSVSEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLSYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHMAKDAGFKVVSHMMPDLPNVGLERDTEQFIEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYRSYSPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEQSFRPEL-----------KGGVSIVRELHVYGSVVPISSRDPSKFQHQGFGMLLMEEAERIAREEHGSCKIAVISGVGTRNYYRKLGYELEGPYMVKKL 548          
BLAST of Elongator complex protein 3 vs. UniProt/SwissProt
Match: sp|Q9H9T3|ELP3_HUMAN (Elongator complex protein 3 OS=Homo sapiens OX=9606 GN=ELP3 PE=1 SV=2)

HSP 1 Score: 902.894 bits (2332), Expect = 0.000e+0
Identity = 434/557 (77.92%), Postives = 496/557 (89.05%), Query Frame = 3
Query:   51 MGKAKKVDKS-QDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            M + +K D S  + MM TI ++I++LI+A+ + + +DLNK+KTK ++K GL  QPRLVDII  VP +Y+K+L+P+LKAKP+R+ASGI VVAVMCKPHRCPHIS TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  EYRDYFIRNLHDALSGH S N+ EAVKYSERS TKC+GITIETRPDYC+K+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH +KD+GFKVVAHMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWK+ +Y SY P+ L++L+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG++CRDVRTREVG+QEI+HK+RPYQ+ELVRRDYVANGGWETFLSYEDPDQDIL+GL RLR+CS E FR EL         G   G SI+RELHVYG+ VP++++DPTKFQHQGFG LL+EE+ERIAR+EHGS KIA+ISGVGTRNYYRK+GY L+GPYMVKML
Sbjct:    1 MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRKVLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFEL--------GG---GVSIVRELHVYGSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGPYMVKML 546          
BLAST of Elongator complex protein 3 vs. TrEMBL
Match: V3ZBA0 (Elongator complex protein 3 OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_193581 PE=3 SV=1)

HSP 1 Score: 949.503 bits (2453), Expect = 0.000e+0
Identity = 443/559 (79.25%), Postives = 499/559 (89.27%), Query Frame = 3
Query:   51 MGKAKK---VDKSQDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            M KAKK       ++ MM T+SEI+ ELIKA  E + V+LNK+KT+ISSK GLP QPRLVDII  VPQ+YKK LVP+LKAKPVR+ASGI VVAVMCKPHRCPHI+MTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARY+P+LQTRHR+EQL QLGHSVDKVEFIVMGGTFM+L  +YRDYFIRNLHDALSGH S NV EAVK+SE+S TKC+GITIETRPDYCLKKHLSDML YGCTRLEIGVQSVYED+ARDTNRGHTVKA CESF  SKDAGFKVV+HMMPDLPN+GW+RD  QF EFFENPAFRADGLKIYPTLVIRGTGLYELWKT +Y SYPP+VLIDL+ARILALVPPWTR+YR+QRDIPMPLVTSGV+HGNLR+LALARM +LG +CRDVRTREVG+QEI+HK++PY+ EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS E FRPEL           + GCS++RELHVYG+ VP++A+DPTKFQHQGFG LL+EE+ERIA++EHGS KI +ISGVGTRNYYRK+GYELEGPYM K+L
Sbjct:    1 MVKAKKKVPTASKEELMMMTVSEIVNELIKADQEGKDVNLNKVKTRISSKYGLPSQPRLVDIIAAVPQQYKKALVPKLKAKPVRTASGIAVVAVMCKPHRCPHIAMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYLQTRHRVEQLQQLGHSVDKVEFIVMGGTFMSLPEDYRDYFIRNLHDALSGHTSCNVNEAVKFSEKSTTKCIGITIETRPDYCLKKHLSDMLNYGCTRLEIGVQSVYEDIARDTNRGHTVKATCESFQMSKDAGFKVVSHMMPDLPNIGWERDIEQFIEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGRYKSYPPSVLIDLVARILALVPPWTRIYRVQRDIPMPLVTSGVEHGNLRELALARMKDLGTQCRDVRTREVGIQEIHHKVKPYEAELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEETFRPEL-----------VGGCSVVRELHVYGSVVPVHARDPTKFQHQGFGMLLMEEAERIAKEEHGSWKIGVISGVGTRNYYRKIGYELEGPYMTKIL 548          
BLAST of Elongator complex protein 3 vs. TrEMBL
Match: A0A4Z2CNV8 (Elongator complex protein 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_008783 PE=3 SV=1)

HSP 1 Score: 947.577 bits (2448), Expect = 0.000e+0
Identity = 442/559 (79.07%), Postives = 499/559 (89.27%), Query Frame = 3
Query:   51 MGKAKKVDKS--QDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDI-AGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            M KA+K+  +  ++ M+ T+SEII  L+KA  E R VDLNKLK+ I+SK GL  QPRLVD+I  VP E+K +L+P LKAKPVRSASGIVV+AVMCKPHRCPHI+MTGN+CVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARY+PF+QTRHR+EQL QLGH+ DKVEFIVMGGTFM L  +YRDYFIRNLHDALSGH SQNV+EAV YSERS TKCVGITIETRPDYCLKKHL +ML+YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH SKDAGFKVV+HMMPDLPNVGW+RD AQFAE+FENPAFR+DGLKIYPTLVIRGTGLYELW+T +Y SYPP +LIDLIARILALVPPWTR+YRIQRDIPMPLVTSGV+HGNLR+L LARM ELG  CRDVRTREVG+QEI+ +++PYQ+EL+RRDYVANGGWETFL+YEDP QDIL+GL RLR+CS + FRPELL T   D      P CSI+RELHVYG+AVP+ A+DPTKFQHQGFG LL+EE+ERIA+ EHGS+KIA+ISGVGTRNYYRK+GYELEGPYM+K L
Sbjct:    1 MAKARKIPNATKEELMVLTVSEIIAHLLKAIEEKRDVDLNKLKSAIASKYGLASQPRLVDLIAAVPTEHKHVLLPHLKAKPVRSASGIVVIAVMCKPHRCPHIAMTGNVCVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPFIQTRHRIEQLQQLGHTCDKVEFIVMGGTFMCLSEDYRDYFIRNLHDALSGHTSQNVDEAVSYSERSRTKCVGITIETRPDYCLKKHLGEMLRYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLSKDAGFKVVSHMMPDLPNVGWERDLAQFAEYFENPAFRSDGLKIYPTLVIRGTGLYELWRTGRYKSYPPGMLIDLIARILALVPPWTRIYRIQRDIPMPLVTSGVEHGNLRELVLARMEELGASCRDVRTREVGIQEIHSRVKPYQVELIRRDYVANGGWETFLAYEDPYQDILIGLLRLRKCSPQTFRPELLATCIKDCQVNKDPRCSIVRELHVYGSAVPVAARDPTKFQHQGFGTLLMEEAERIAKYEHGSLKIAVISGVGTRNYYRKLGYELEGPYMIKFL 559          
BLAST of Elongator complex protein 3 vs. TrEMBL
Match: A0A5K3F7V9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 944.495 bits (2440), Expect = 0.000e+0
Identity = 445/548 (81.20%), Postives = 494/548 (90.15%), Query Frame = 3
Query:   75 KSQDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            K ++ M+ TISEII EL+KA  ++R ++LNKLKT IS K GL  QPRLVDII  VP +++ +L+P+LKAKPVRSASGIVVVAVMCKPHRCPHI+MTGN+CVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARY P++QTRHR+EQL QLGHS DKVEFIVMGGTFM L  EYRDYFIRNLHDALSGH S+NV EAV YSE+S TKC+GITIETRPDYCLKKHL +ML YGCTRLEIGVQSVYEDVARDTNRGHTV AVCESFH SKDAGFKV+AHMMPDLPNVGW+RD AQFAE+FENPAFR+DGLKIYPTLVIRGTGLYELW+T +Y+SYPPN+LIDLIARILALVPPWTRVYRIQRDIPMPLVTSGV+HGNLR+LALARM ELG KCRDVRTREVG+QEI+  ++P QIEL+RRDYVANGGWETFL+YEDP QDILVGL RLR+CS E FRPEL    +     D P CSI+RELHVYG+AVP++AKDPTKFQHQGFG LL+EE+ERIARDEHGSVKIA+ISGVGTRNYYRK+GYELEGPYMVK L
Sbjct:   12 KKEELMIMTISEIISELLKAVKDHRDINLNKLKTSISRKYGLSSQPRLVDIISAVPPQHRYVLLPKLKAKPVRSASGIVVVAVMCKPHRCPHIAMTGNVCVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYHPYVQTRHRIEQLQQLGHSCDKVEFIVMGGTFMCLPEEYRDYFIRNLHDALSGHTSKNVAEAVYYSEKSKTKCIGITIETRPDYCLKKHLGEMLNYGCTRLEIGVQSVYEDVARDTNRGHTVNAVCESFHLSKDAGFKVIAHMMPDLPNVGWERDLAQFAEYFENPAFRSDGLKIYPTLVIRGTGLYELWRTGRYSSYPPNMLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVEHGNLRELALARMAELGAKCRDVRTREVGIQEIHKNVQPSQIELIRRDYVANGGWETFLAYEDPHQDILVGLLRLRKCSPETFRPELRCRGEIGDDDDDPLCSIVRELHVYGSAVPVSAKDPTKFQHQGFGTLLMEEAERIARDEHGSVKIAVISGVGTRNYYRKLGYELEGPYMVKSL 559          
BLAST of Elongator complex protein 3 vs. TrEMBL
Match: G4M0F5 (Elongator complex protein 3 OS=Schistosoma mansoni OX=6183 GN=Smp_085500 PE=3 SV=1)

HSP 1 Score: 944.11 bits (2439), Expect = 0.000e+0
Identity = 441/563 (78.33%), Postives = 503/563 (89.34%), Query Frame = 3
Query:   51 MGKAKKVDKS--QDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELL----PTDKSDIAGDL-PGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            M KA+K+  +  ++ M+ T+SEII  L+KA  E R VDLNKLK+ ISSK GL  QPRLVD+I  VP E++ +L+P LKAKPVRSASGIVV+AVMCKPHRCPHI++TGN+CVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARY+PF+QTRHR+EQL QLGH+ DKVEFIVMGGTFM L  +YRDYFIR+LHDALSGH SQNV+EAV YSERS TKCVGITIETRPDYCLKKHLS+ML+YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH SKDAGFKVV+HMMPDLPNVGW+RD AQFAE+FENPAFR+DGLKIYPTLVIRGTGLYELW+T +Y SYPP +LIDLIARILALVPPWTR+YRIQRDIPMPLVTSGV+HGNLR+L LARM ELG  CRDVRTREVG+QEI+ +++PYQ+ELVRRDYVANGGWETFL+YEDP QDIL+GL RLR+CS + FRPEL+      D  D+ G+  P CSI+RELHVYG+AVP+ A+DPTKFQHQGFG LL+EE+ERIA+ EHGS+KIA+ISGVGTRNYYRK+GY+LEGPYM+K L
Sbjct:    1 MAKARKIPNATKEELMVLTVSEIISHLLKAIEEKRDVDLNKLKSVISSKYGLASQPRLVDLIAAVPTEHRHVLLPHLKAKPVRSASGIVVIAVMCKPHRCPHIAVTGNVCVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPFIQTRHRIEQLQQLGHTCDKVEFIVMGGTFMCLSEDYRDYFIRSLHDALSGHTSQNVDEAVSYSERSKTKCVGITIETRPDYCLKKHLSEMLRYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLSKDAGFKVVSHMMPDLPNVGWERDLAQFAEYFENPAFRSDGLKIYPTLVIRGTGLYELWRTGRYKSYPPGMLIDLIARILALVPPWTRIYRIQRDIPMPLVTSGVEHGNLRELVLARMEELGASCRDVRTREVGIQEIHSRVKPYQVELVRRDYVANGGWETFLAYEDPYQDILIGLLRLRKCSLQTFRPELIVKTHNNDDDDVQGNKDPRCSIVRELHVYGSAVPVAARDPTKFQHQGFGTLLMEEAERIAKYEHGSLKIAVISGVGTRNYYRKLGYKLEGPYMIKFL 563          
BLAST of Elongator complex protein 3 vs. TrEMBL
Match: A0A3S1BA26 (Elongator complex protein 3 OS=Elysia chlorotica OX=188477 GN=EGW08_012919 PE=3 SV=1)

HSP 1 Score: 940.258 bits (2429), Expect = 0.000e+0
Identity = 444/560 (79.29%), Postives = 499/560 (89.11%), Query Frame = 3
Query:   51 MGKAKKV---DKSQDGMM-RTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MGK KK    D S++ +M   ++EI+ EL+KA  EN+ VDLNKLKTKI+S+  +  QPRLVDII  VPQEYKK+L+P+LKAKPVR+ASGI VVAVMCKPHRCPHI+MTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARY+P+LQTRHR+EQL QLGHSVDKVEFIVMGGTFM+L  +YRDYFIRNLHDALSGH S NV+EAVKYSERS TKC+GITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESF  SKDAGFKVV+HMMPDLPNVGW+RD  QF EFFENPAFRADGLKIYPTLVIRGTGLYELWKT +Y SYPP+ L+DLIARILALVPPWTRVYR+QRDIPMPLVTSGV+HGNLR+LALARM +LG +CRDVRTREVG+QEI+HK++P Q EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS++ FR EL             GCSI+RELHVYG+ VP++A+DP KFQHQGFG LL+EE+ RIA++EHG+ KIA+ISGVGTRNYYRK+GYELEGPYMVK L
Sbjct:    1 MGKNKKKVVNDLSKEEIMVMAVAEIVSELVKAVRENKDVDLNKLKTKIASRYNMSSQPRLVDIIAAVPQEYKKMLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYLQTRHRVEQLQQLGHSVDKVEFIVMGGTFMSLPDDYRDYFIRNLHDALSGHTSSNVQEAVKYSERSTTKCIGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFQMSKDAGFKVVSHMMPDLPNVGWERDIEQFIEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGRYKSYPPSQLVDLIARILALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALARMADLGTQCRDVRTREVGIQEIHHKVKPDQAELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSADTFRAEL-----------RGGCSIVRELHVYGSVVPVHARDPRKFQHQGFGILLMEEAARIAKEEHGAKKIAVISGVGTRNYYRKLGYELEGPYMVKGL 549          
BLAST of Elongator complex protein 3 vs. Ensembl Cavefish
Match: elp3 (elongator acetyltransferase complex subunit 3 [Source:NCBI gene;Acc:103039785])

HSP 1 Score: 931.784 bits (2407), Expect = 0.000e+0
Identity = 434/558 (77.78%), Postives = 495/558 (88.71%), Query Frame = 3
Query:   51 MGKAKKVDK--SQDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MGK K+  +    + MM TI+++I++L++A+ + + +DLNKLKTK S+K GL  QPRLVDII  VP  Y++ LVP+LKAKP+R+ASGI VVAVMCKPHRCPHIS TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  +YRDYFIRNLHDALSGH S NV EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTV+AVCESFH +KDAGFKVVAHMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM ++G +CRDVRTREVG+QEI+HK+RPYQ+EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL             G SI+RELHVYG+ VP++++DP+KFQHQGFG +L+EE+ERIARDEHGS K+A+ISGVGTRNYYRKMGYELEGPYMVK L
Sbjct:    1 MGKPKRKSELSRAELMMMTIADVIKQLVEAHEQGKDIDLNKLKTKTSAKYGLSAQPRLVDIIAAVPPHYRRALVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALAEDYRDYFIRNLHDALSGHTSNNVAEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLAYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHLAKDAGFKVVAHMMPDLPNVGIERDVEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYSPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDMGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRRCSPQSFRPEL-----------KAGVSIVRELHVYGSVVPVSSRDPSKFQHQGFGMMLMEEAERIARDEHGSGKLAVISGVGTRNYYRKMGYELEGPYMVKRL 547          
BLAST of Elongator complex protein 3 vs. Ensembl Cavefish
Match: elp3 (elongator acetyltransferase complex subunit 3 [Source:NCBI gene;Acc:103039785])

HSP 1 Score: 929.858 bits (2402), Expect = 0.000e+0
Identity = 430/543 (79.19%), Postives = 488/543 (89.87%), Query Frame = 3
Query:   90 MMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MM TI+++I++L++A+ + + +DLNKLKTK S+K GL  QPRLVDII  VP  Y++ LVP+LKAKP+R+ASGI VVAVMCKPHRCPHIS TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  +YRDYFIRNLHDALSGH S NV EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTV+AVCESFH +KDAGFKVVAHMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM ++G +CRDVRTREVG+QEI+HK+RPYQ+EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL             G SI+RELHVYG+ VP++++DP+KFQHQGFG +L+EE+ERIARDEHGS K+A+ISGVGTRNYYRKMGYELEGPYMVK L
Sbjct:   14 MMMTIADVIKQLVEAHEQGKDIDLNKLKTKTSAKYGLSAQPRLVDIIAAVPPHYRRALVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALAEDYRDYFIRNLHDALSGHTSNNVAEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLAYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHLAKDAGFKVVAHMMPDLPNVGIERDVEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYSPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDMGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRRCSPQSFRPEL-----------KAGVSIVRELHVYGSVVPVSSRDPSKFQHQGFGMMLMEEAERIARDEHGSGKLAVISGVGTRNYYRKMGYELEGPYMVKRL 545          
BLAST of Elongator complex protein 3 vs. Ensembl Cavefish
Match: elp3 (elongator acetyltransferase complex subunit 3 [Source:NCBI gene;Acc:103039785])

HSP 1 Score: 889.412 bits (2297), Expect = 0.000e+0
Identity = 412/536 (76.87%), Postives = 474/536 (88.43%), Query Frame = 3
Query:   51 MGKAKKVDK--SQDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGV 1652
            MGK K+  +    + MM TI+++I++L++A+ + + +DLNKLKTK S+K GL  QPRLVDII  VP  Y++ LVP+LKAKP+R+ASGI VVAVMCKPHRCPHIS TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  +YRDYFIRNLHDALSGH S NV EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTV+AVCESFH +KDAGFKVVAHMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM ++G +CRDVRTREVG+QEI+HK+RPYQ+EL+RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL             G SI+RELHVYG+ VP++++DP+KFQHQGFG +L+EE+ERIARDEHGS K+A+ISG+
Sbjct:    1 MGKPKRKSELSRAELMMMTIADVIKQLVEAHEQGKDIDLNKLKTKTSAKYGLSAQPRLVDIIAAVPPHYRRALVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALAEDYRDYFIRNLHDALSGHTSNNVAEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLAYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHLAKDAGFKVVAHMMPDLPNVGIERDVEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYSPSTLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDMGTECRDVRTREVGIQEIHHKVRPYQVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRRCSPQSFRPEL-----------KAGVSIVRELHVYGSVVPVSSRDPSKFQHQGFGMMLMEEAERIARDEHGSGKLAVISGI 525          
BLAST of Elongator complex protein 3 vs. Ensembl Sea Lamprey
Match: elp3 (elongator acetyltransferase complex subunit 3 [Source:NCBI gene;Acc:541509])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 262/355 (73.80%), Postives = 302/355 (85.07%), Query Frame = 3
Query:  663 KYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQ---GFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            +YSERS TKC+GITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFH SKDAGFKVV+HMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG +CRDVRTREVG+QEI+HK++PY++EL+RRDYVANGGWETFL+YEDP QD+LVGL RLR+CS + FRPEL             G SI+RELHVYG+ VP++A+DPTKFQHQ    FG     E+  I     G + +A+ +G+GTR+YYRK+GYELEGPYMVK L
Sbjct:    1 RYSERSKTKCIGITIETRPDYCLKRHLSDMLGYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHMSKDAGFKVVSHMMPDLPNVGMERDLEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYTPSGLVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTECRDVRTREVGIQEIHHKVKPYEVELIRRDYVANGGWETFLAYEDPRQDVLVGLLRLRRCSPDSFRPEL-----------KGGVSIVRELHVYGSVVPVSARDPTKFQHQRAMSFGNYTCTEASFIHCLNQGIILLAVCAGIGTRDYYRKIGYELEGPYMVKKL 344          
BLAST of Elongator complex protein 3 vs. Ensembl Yeast
Match: ELP3 (Subunit of Elongator complex; Elongator is required for modification of wobble nucleosides in tRNA; exhibits histone acetyltransferase activity that is directed to histones H3 and H4; disruption confers resistance to K. lactis zymotoxin; human homolog ELP3 can partially complement yeast elp3 null mutant [Source:SGD;Acc:S000006007])

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 380/555 (68.47%), Postives = 455/555 (81.98%), Query Frame = 3
Query:   63 KKVDKSQDGMMRTISEIIEELIKAYHE--NRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSE-IFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            KK+   ++  ++  ++I  EL  +      R ++LN L TK S K  L  QPRL DII  +P +YKK L+P+LKAKPVR+ASGI VVAVMCKPHRCPHI+ TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+ Q R R+EQL QLGHS+DKVE+++MGGTFM+L  EYR+ FI  LH+ALSG    +++EA+ YS++S TKCVGITIETRPDYC + HL DMLKYGCTRLEIGVQS+YEDVARDTNRGHTV++VCE+F  SKDAG+KVV+HMMPDLPNVG +RD  QF E+FENP FR DGLKIYPTLVIRGTGLYELWKT +Y SY  N L+DL+ARILALVPPWTR+YR+QRDIPMPLVTSGVD+GNLR+LALARM +LG  CRDVRTREVG+QE++HK++P Q+EL+RRDY ANGGWETFLSYEDP +DIL+GL RLR+ S +  +R E                SI+RELHVYG+ VP++++DP KFQHQGFG LL+EE+ERIA++EHGS KI++ISGVG RNYY K+GYEL+GPYM K +
Sbjct:   13 KKLAPEKERFIQCCADITLELTDSLTSGTTREINLNGLITKYSKKYKLKQQPRLTDIINSIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLKQLGHSIDKVEYVLMGGTFMSLPKEYREDFIVKLHNALSGFNGNDIDEAILYSQQSLTKCVGITIETRPDYCTQTHLDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVRSVCETFAVSKDAGYKVVSHMMPDLPNVGMERDIEQFKEYFENPDFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYSANALVDLVARILALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDLGTTCRDVRTREVGIQEVHHKVQPDQVELIRRDYYANGGWETFLSYEDPKKDILIGLLRLRKASKKYTYRKEFTSQR----------TSIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIAKEEHGSEKISVISGVGVRNYYGKLGYELDGPYMSKRI 557          
BLAST of Elongator complex protein 3 vs. Ensembl Nematostella
Match: EDO39414 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA82])

HSP 1 Score: 907.131 bits (2343), Expect = 0.000e+0
Identity = 434/559 (77.64%), Postives = 494/559 (88.37%), Query Frame = 3
Query:   51 MGKAKK---VDKSQDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MGK  K   V    + M+ T+S+I+ +LI A+ +   ++LNK+K K +SK GL  QPRLVDII  +P  ++K+L+P+LKAKPVR+ASGI VVAVMCKPHRCPHI+MTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARY+P+LQT+HR+EQL QLGHSVDKVEFIVMGGTFM LD  YRD+FIRNLHDALSGH S NVEEAVKYSERS TKC+GITIETRPDYCLKKHLS ML YGCTRLEIGVQSVYEDVARDTNRGHTV+AVCESFH SKDAGFKVV+HMMPDLPNVG +RD  QF EFFENPAFRADGLKIYPTLVIRGTGLYELWKT +Y SYPPN L+DLIARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG +CRDVRTREVG+QEI+HK+RP++IE +RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL   D+         CSI+RELHVYG+ VP++A+DP+KFQHQGFG LL+EE+ERIAR+EHGS+KIA+ISGVGTRNYYRK+GYELEGPYMVK L
Sbjct:    1 MGKKNKKEPVASRAELMVMTVSDIVNQLITAHEKGENINLNKVKGKAASKYGLASQPRLVDIIAAIPHSHRKVLLPKLKAKPVRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYLQTKHRVEQLKQLGHSVDKVEFIVMGGTFMCLDEGYRDFFIRNLHDALSGHTSNNVEEAVKYSERSKTKCIGITIETRPDYCLKKHLSSMLAYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHQSKDAGFKVVSHMMPDLPNVGLERDIDQFIEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGRYKSYPPNTLVDLIARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTQCRDVRTREVGIQEIHHKVRPFEIEQIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSDQSFRPEL--KDR---------CSIVRELHVYGSVVPVSARDPSKFQHQGFGMLLMEEAERIAREEHGSIKIAVISGVGTRNYYRKLGYELEGPYMVKSL 548          
BLAST of Elongator complex protein 3 vs. Ensembl Nematostella
Match: EDO42840 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S098])

HSP 1 Score: 827.009 bits (2135), Expect = 0.000e+0
Identity = 402/543 (74.03%), Postives = 468/543 (86.19%), Query Frame = 3
Query:   90 MMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            M+ T+S+I+ +LI A+ +   V+LNK+K K +SK GL  QPRLVDII  +P  ++K+L+P+LKAKPVR+ASGI VVAVMCKPHRCPHI+MTGNICV       + F +  + +  ++PTSMRAIRARY+P+LQT+HR+EQL QLGHSVDKVEFIVMGGTFM LD  YRD+FIRNLHDALSGH S NVEEAVKYSERS TKC+GITIETRPDYCLKKHLS ML YGCTRLEIGVQSVYEDVARDTNRGHTV+AVCESFH SKDAGFKVV+HMMPDLPNVG +RD  QF EFFENPAFRADGLKIYPTLVIRGTGLYELWKT +Y SYPPN L+DLIARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM +LG +CRDVRTREVG+QEI+HK+RP++IE +RRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL   D+         CSI+RELHVYG+ VP++A+DP+KFQHQGFG LL+EE+ERIAR+EHGS+KIA+ISG     + +K+GYELEGPYMVK L
Sbjct:    1 MVMTVSDIVNQLITAHEKGENVNLNKVKGKAASKYGLASQPRLVDIIAAIPHSHRKVLLPKLKAKPVRTASGIAVVAVMCKPHRCPHINMTGNICVLFHDVALNVFLF--EFHLLWQPTSMRAIRARYNPYLQTKHRVEQLKQLGHSVDKVEFIVMGGTFMCLDEGYRDFFIRNLHDALSGHTSNNVEEAVKYSERSKTKCIGITIETRPDYCLKKHLSSMLAYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHQSKDAGFKVVSHMMPDLPNVGLERDIDQFIEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGRYKSYPPNTLVDLIARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTQCRDVRTREVGIQEIHHKVRPFEIEQIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSDQSFRPEL--KDR---------CSIVRELHVYGSVVPVSARDPSKFQHQGFGMLLMEEAERIAREEHGSIKIAVISG----EWNQKLGYELEGPYMVKSL 526          
BLAST of Elongator complex protein 3 vs. Ensembl Medaka
Match: elp3 (elongator acetyltransferase complex subunit 3 [Source:NCBI gene;Acc:101166352])

HSP 1 Score: 931.398 bits (2406), Expect = 0.000e+0
Identity = 436/558 (78.14%), Postives = 500/558 (89.61%), Query Frame = 3
Query:   51 MGKAK-KVDKSQ-DGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MGK K K D+S+ + MM TI+++I++L++A+ E + ++LNK+KTK S+K GL  QPRLVDII  VP +Y+++LVP+LKAKP+R+ASGI VVAVMCKPHRCPHIS TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDP+LQTRHR+EQL QLGHSVDKVEFIVMGGTFMAL  +YRDYFIRNLHDALSGH S +V EAV+YSERSNTKCVGITIETRPDYCLK+HLSDML YGCTRLEIGVQSVYEDVARDTNRGHTV+AVCESFH +KDAGFKVVAHMMPDLPNVG +RD  QF EFFENPAFR DGLK+YPTLVIRGTGLYELWKT +Y SY P+ L+DL+ARILALVPPWTRVYR+QRDIPMPLV+SGV+HGNLR+LALARM ++G +CRDVRTREVG+QEI+HK+RPYQ+ELVRRDYVANGGWETFLSYEDP+QDIL+GL RLR+CS + FRPEL             G SI+RELHVYG+ VP++++DP+KFQHQGFG +L+EE+ERIARDEHGS K+A+ISGVGTRNYYRKMGYELEGPYMVK L
Sbjct:    1 MGKPKRKSDQSRAELMMMTIADVIKQLVEAHEEGKDINLNKVKTKTSAKYGLEAQPRLVDIIAAVPPQYRRVLVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALPEDYRDYFIRNLHDALSGHTSNSVAEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLNYGCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHLAKDAGFKVVAHMMPDLPNVGMERDVEQFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYTPSALVDLVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDMGTQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWETFLSYEDPEQDILIGLLRLRRCSPQSFRPEL-----------KGGVSIVRELHVYGSVVPVSSRDPSKFQHQGFGMMLMEEAERIARDEHGSGKLAVISGVGTRNYYRKMGYELEGPYMVKDL 547          
BLAST of Elongator complex protein 3 vs. Planmine SMEST
Match: SMESG000011834.1 (SMESG000011834.1)

HSP 1 Score: 1154.04 bits (2984), Expect = 0.000e+0
Identity = 554/556 (99.64%), Postives = 554/556 (99.64%), Query Frame = 3
Query:   51 MGKAKKVDKSQDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MGKAKKVDKSQDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSE FRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVK L
Sbjct:    1 MGKAKKVDKSQDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSETFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKTL 556          
BLAST of Elongator complex protein 3 vs. Planmine SMEST
Match: SMESG000011834.1 (SMESG000011834.1)

HSP 1 Score: 1150.19 bits (2974), Expect = 0.000e+0
Identity = 554/557 (99.46%), Postives = 554/557 (99.46%), Query Frame = 3
Query:   51 MGKAKKV-DKSQDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKML 1718
            MGKAKKV DKSQDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSE FRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVK L
Sbjct:    1 MGKAKKVVDKSQDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGLPYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRLEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNVEEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQFAEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIARILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDVRTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLCRLRQCSSETFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPTKFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGPYMVKTL 557          
The following BLAST results are available for this feature:
BLAST of Elongator complex protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ELP30.000e+077.92elongator acetyltransferase complex subunit 3 [Sou... [more]
ELP30.000e+079.19elongator acetyltransferase complex subunit 3 [Sou... [more]
ELP30.000e+082.27elongator acetyltransferase complex subunit 3 [Sou... [more]
ELP30.000e+082.58elongator acetyltransferase complex subunit 3 [Sou... [more]
ELP30.000e+081.22elongator acetyltransferase complex subunit 3 [Sou... [more]
back to top
BLAST of Elongator complex protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
elpc-30.000e+073.48Probable elongator complex protein 3 [Source:UniP... [more]
back to top
BLAST of Elongator complex protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Elp30.000e+076.68gene:FBgn0031604 transcript:FBtr0077439[more]
back to top
BLAST of Elongator complex protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
elp30.000e+079.19elongator acetyltransferase complex subunit 3 [Sou... [more]
elp30.000e+082.58elongator acetyltransferase complex subunit 3 [Sou... [more]
back to top
BLAST of Elongator complex protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucd10.000e+079.01guanylyl cyclase domain containing 1 [Source:Xenba... [more]
gucd10.000e+079.01guanylyl cyclase domain containing 1 [Source:Xenba... [more]
gucd10.000e+079.01guanylyl cyclase domain containing 1 [Source:Xenba... [more]
gucd10.000e+079.01guanylyl cyclase domain containing 1 [Source:Xenba... [more]
gucd10.000e+079.01guanylyl cyclase domain containing 1 [Source:Xenba... [more]
back to top
BLAST of Elongator complex protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Elp30.000e+078.45elongator acetyltransferase complex subunit 3 [Sou... [more]
Elp30.000e+077.20elongator acetyltransferase complex subunit 3 [Sou... [more]
Elp30.000e+076.78elongator acetyltransferase complex subunit 3 [Sou... [more]
back to top
BLAST of Elongator complex protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZHS1|ELP3_CHICK0.000e+078.60Elongator complex protein 3 OS=Gallus gallus OX=90... [more]
sp|Q5RIC0|ELP3_DANRE0.000e+078.32Elongator complex protein 3 OS=Danio rerio OX=7955... [more]
sp|Q5HZM6|ELP3_XENLA0.000e+079.19Elongator complex protein 3 OS=Xenopus laevis OX=8... [more]
sp|Q6NVL5|ELP3_XENTR0.000e+079.01Elongator complex protein 3 OS=Xenopus tropicalis ... [more]
sp|Q9H9T3|ELP3_HUMAN0.000e+077.92Elongator complex protein 3 OS=Homo sapiens OX=960... [more]
back to top
BLAST of Elongator complex protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZBA00.000e+079.25Elongator complex protein 3 OS=Lottia gigantea OX=... [more]
A0A4Z2CNV80.000e+079.07Elongator complex protein 3 OS=Schistosoma japonic... [more]
A0A5K3F7V90.000e+081.20Uncharacterized protein OS=Mesocestoides corti OX=... [more]
G4M0F50.000e+078.33Elongator complex protein 3 OS=Schistosoma mansoni... [more]
A0A3S1BA260.000e+079.29Elongator complex protein 3 OS=Elysia chlorotica O... [more]
back to top
BLAST of Elongator complex protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
elp30.000e+077.78elongator acetyltransferase complex subunit 3 [Sou... [more]
elp30.000e+079.19elongator acetyltransferase complex subunit 3 [Sou... [more]
elp30.000e+076.87elongator acetyltransferase complex subunit 3 [Sou... [more]
back to top
BLAST of Elongator complex protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
elp30.000e+073.80elongator acetyltransferase complex subunit 3 [Sou... [more]
back to top
BLAST of Elongator complex protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ELP30.000e+068.47Subunit of Elongator complex; Elongator is require... [more]
back to top
BLAST of Elongator complex protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO394140.000e+077.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428400.000e+074.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Elongator complex protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
elp30.000e+078.14elongator acetyltransferase complex subunit 3 [Sou... [more]
back to top
BLAST of Elongator complex protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000011834.10.000e+099.64SMESG000011834.1[more]
SMESG000011834.10.000e+099.46SMESG000011834.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012263 ID=SMED30012263|Name=Elongator complex protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1809bp
GAAATTTTGTTTTAATATTGCTTTCCAAATAATTGATTTGTTAATAATTG
ATGGGTAAAGCTAAAAAAGTCGACAAAAGCCAAGATGGCATGATGAGAAC
AATCTCTGAAATAATTGAAGAATTAATTAAAGCATACCATGAAAATCGAA
CTGTTGATTTAAATAAATTGAAAACTAAAATTTCTTCAAAGAATGGTTTG
CCATATCAACCCAGACTTGTTGATATAATCGGCGGTGTACCCCAAGAATA
TAAAAAAATTTTAGTTCCCAGATTGAAAGCAAAACCTGTTCGGTCAGCCA
GTGGAATTGTTGTTGTCGCTGTCATGTGCAAGCCTCATAGATGTCCCCAT
ATTAGCATGACAGGAAATATCTGCGTATATTGTCCAGGGGGTCCGGATTC
CGATTTTGAATATTCCACGCAGTCTTATACTGGTTATGAGCCGACATCAA
TGAGAGCAATTAGAGCTCGATATGATCCATTTTTACAAACTCGACATCGT
CTCGAACAGTTGGCTCAGTTGGGTCACAGTGTTGATAAGGTTGAATTCAT
TGTGATGGGGGGAACATTTATGGCTCTCGATACTGAATATCGGGATTATT
TCATTCGAAATCTCCATGATGCATTGTCTGGCCACCGGAGTCAGAATGTT
GAGGAAGCGGTAAAATACTCGGAGCGCAGTAATACAAAGTGTGTCGGCAT
AACCATTGAAACTCGACCGGATTATTGCTTGAAGAAGCATTTGAGTGACA
TGTTGAAATATGGTTGCACCAGGCTAGAAATTGGAGTTCAGAGTGTCTAT
GAAGACGTTGCTAGGGACACTAATAGAGGTCACACCGTAAAGGCTGTTTG
CGAGTCGTTTCATTTCAGTAAAGATGCCGGATTTAAAGTAGTTGCTCACA
TGATGCCTGACTTGCCAAATGTTGGATGGGATAGAGATCAAGCCCAATTT
GCTGAATTTTTTGAAAATCCAGCATTTCGGGCTGACGGCTTGAAAATCTA
CCCGACACTGGTTATCAGGGGCACAGGCTTATATGAGTTATGGAAAACGA
AAAAGTACAATAGTTACCCGCCTAATGTTTTGATTGATTTGATTGCTCGC
ATTCTTGCATTGGTTCCACCGTGGACTCGGGTTTATCGTATCCAGCGCGA
TATCCCGATGCCTCTTGTTACAAGTGGTGTCGATCACGGAAATCTGCGCC
AGCTGGCGTTAGCAAGAATGAACGAACTCGGTGTGAAGTGTCGAGACGTT
AGAACGAGAGAAGTCGGAATGCAGGAGATTAATCACAAAATTCGACCTTA
TCAAATTGAACTCGTTAGGAGGGATTATGTTGCTAACGGCGGATGGGAAA
CTTTTCTCTCTTATGAAGATCCCGATCAGGATATTCTTGTTGGTTTGTGT
CGATTGCGACAGTGTTCATCGGAAATCTTTCGACCGGAGTTGTTGCCCAC
TGATAAATCTGACATCGCCGGAGATTTACCCGGCTGTTCAATCATCAGGG
AGTTGCACGTGTACGGTACAGCTGTGCCGATCAATGCAAAGGATCCAACA
AAGTTTCAGCATCAAGGATTCGGGAAACTGTTAATCGAAGAATCAGAAAG
GATAGCTCGAGATGAACATGGCTCTGTGAAAATTGCGATTATATCTGGAG
TGGGAACGAGAAATTATTACCGTAAAATGGGCTATGAACTCGAGGGACCT
TATATGGTGAAAATGTTATAAAGGAATAAAAATTGACTTTTTTTTGTGTT
TGGCTGAACTCGTAAATAAAACCGGAAATTTGTGAACATATAAAACTAAA
TTAAAAAAA
back to top

protein sequence of SMED30012263-orf-1

>SMED30012263-orf-1 ID=SMED30012263-orf-1|Name=SMED30012263-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=557bp
MGKAKKVDKSQDGMMRTISEIIEELIKAYHENRTVDLNKLKTKISSKNGL
PYQPRLVDIIGGVPQEYKKILVPRLKAKPVRSASGIVVVAVMCKPHRCPH
ISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHR
LEQLAQLGHSVDKVEFIVMGGTFMALDTEYRDYFIRNLHDALSGHRSQNV
EEAVKYSERSNTKCVGITIETRPDYCLKKHLSDMLKYGCTRLEIGVQSVY
EDVARDTNRGHTVKAVCESFHFSKDAGFKVVAHMMPDLPNVGWDRDQAQF
AEFFENPAFRADGLKIYPTLVIRGTGLYELWKTKKYNSYPPNVLIDLIAR
ILALVPPWTRVYRIQRDIPMPLVTSGVDHGNLRQLALARMNELGVKCRDV
RTREVGMQEINHKIRPYQIELVRRDYVANGGWETFLSYEDPDQDILVGLC
RLRQCSSEIFRPELLPTDKSDIAGDLPGCSIIRELHVYGTAVPINAKDPT
KFQHQGFGKLLIEESERIARDEHGSVKIAIISGVGTRNYYRKMGYELEGP
YMVKML*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000049tRNA binding
GO:0003723RNA binding
GO:00515394 iron, 4 sulfur cluster binding
GO:0003824catalytic activity
GO:0051536iron-sulfur cluster binding
GO:0008080N-acetyltransferase activity
GO:0004402histone acetyltransferase activity
GO:0008607phosphorylase kinase regulator activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0008033tRNA processing
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0016573histone acetylation
GO:0045859regulation of protein kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR034687ELP3-like
IPR039661ELP3
IPR006638Elp3/MiaB/NifB
IPR032432Radical_SAM_C
IPR016181Acyl_CoA_acyltransferase
IPR007197rSAM
IPR005910Hist_AcTrfase_ELP3
IPR000182GNAT_dom
IPR023404rSAM_horseshoe
IPR004039Rubredoxin-type_fold
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0008023transcription elongation factor complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006638Elp3/MiaB/NifBSMARTSM00729MiaBcoord: 88..350
e-value: 2.8E-32
score: 123.2
IPR034687Elongator complex protein 3-likeTIGRFAMTIGR01211TIGR01211coord: 22..556
e-value: 2.1E-218
score: 724.0
IPR034687Elongator complex protein 3-likePIRSFPIRSF005669HAT_Elp3coord: 1..556
e-value: 6.9E-246
score: 814.5
IPR034687Elongator complex protein 3-likeSFLDSFLDF00344ELP3-likecoord: 36..556
e-value: 0.0
score: 644.2
IPR034687Elongator complex protein 3-likePANTHERPTHR11135:SF0ELONGATOR COMPLEX PROTEIN 3coord: 7..556
NoneNo IPR availableGENE3DG3DSA:3.40.630.30coord: 400..556
e-value: 3.4E-6
score: 29.4
NoneNo IPR availableCDDcd01335Radical_SAMcoord: 95..341
e-value: 5.63391E-12
score: 63.1213
NoneNo IPR availableSUPERFAMILYSSF102114Radical SAM enzymescoord: 118..357
IPR032432Radical SAM, C-terminal extensionPFAMPF16199Radical_SAM_Ccoord: 312..391
e-value: 3.5E-31
score: 107.1
IPR023404Radical SAM, alpha/beta horseshoeGENE3DG3DSA:3.80.30.20coord: 100..353
e-value: 8.1E-12
score: 46.6
IPR000182GNAT domainPFAMPF00583Acetyltransf_1coord: 397..545
e-value: 5.8E-7
score: 29.7
IPR000182GNAT domainPROSITEPS51186GNATcoord: 395..556
score: 9.757
IPR007197Radical SAMPFAMPF04055Radical_SAMcoord: 106..294
e-value: 3.6E-19
score: 69.7
IPR007197Radical SAMSFLDSFLDS00029Radical_SAMcoord: 36..556
e-value: 0.0
score: 644.2
IPR039661ELP3/YhcCPANTHERPTHR11135HISTONE ACETYLTRANSFERASE-RELATEDcoord: 7..556
IPR016181Acyl-CoA N-acyltransferaseSUPERFAMILYSSF55729Acyl-CoA N-acyltransferases (Nat)coord: 354..552