Dual specificity tyrosine-phosphorylation-regulated kinase 1A

Overview
NameDual specificity tyrosine-phosphorylation-regulated kinase 1A
Smed IDSMED30012260
Length (bp)3845
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 1A (SMED30012260) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 1A (SMED30012260) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 1A (SMED30012260) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 1A (SMED30012260) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012260

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30012260SMESG000001908.1 SMESG000001895.1 SMESG000054185.1 SMESG000003953.1 Contig32uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30012260SMESG000001908.1 SMESG000001895.1 SMESG000054185.1 SMESG000003953.1 Contig32uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30012260SMESG000001908.1 SMESG000001895.1 SMESG000054185.1 SMESG000003953.1 Contig32newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30012260SMESG000001908.1 SMESG000001895.1 SMESG000054185.1 SMESG000003953.1 Contig32newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30012260SMESG000003941.1 Contig32uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30012260SMESG000003941.1 Contig32uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30012260SMESG000003941.1 Contig32newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30012260SMESG000003941.1 Contig32newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30012260 dd_Smed_v4_16782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1A (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:HGNC Symbol;Acc:HGNC:3091])

HSP 1 Score: 398.667 bits (1023), Expect = 3.389e-125
Identity = 200/371 (53.91%), Postives = 261/371 (70.35%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTS 2575
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F     +    G  N       + + +DGKR  ++  G RKL +I+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF       T +S +  TS
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFF-----EKLPDGTWN-------LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTS 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1A (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:HGNC Symbol;Acc:HGNC:3091])

HSP 1 Score: 398.667 bits (1023), Expect = 3.640e-125
Identity = 200/371 (53.91%), Postives = 261/371 (70.35%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTS 2575
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F     +    G  N       + + +DGKR  ++  G RKL +I+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF       T +S +  TS
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFF-----EKLPDGTWN-------LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTS 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1A (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:HGNC Symbol;Acc:HGNC:3091])

HSP 1 Score: 399.438 bits (1025), Expect = 1.699e-124
Identity = 200/371 (53.91%), Postives = 261/371 (70.35%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTS 2575
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F     +    G  N       + + +DGKR  ++  G RKL +I+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF       T +S +  TS
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFF-----EKLPDGTWN-------LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTS 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1A (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:HGNC Symbol;Acc:HGNC:3091])

HSP 1 Score: 398.667 bits (1023), Expect = 1.734e-124
Identity = 200/371 (53.91%), Postives = 261/371 (70.35%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTS 2575
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F     +    G  N       + + +DGKR  ++  G RKL +I+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF       T +S +  TS
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFF-----EKLPDGTWN-------LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTS 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1A (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:HGNC Symbol;Acc:HGNC:3091])

HSP 1 Score: 400.593 bits (1028), Expect = 2.419e-123
Identity = 200/371 (53.91%), Postives = 261/371 (70.35%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTS 2575
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F     +    G  N       + + +DGKR  ++  G RKL +I+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF       T +S +  TS
Sbjct:  110 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFF-----EKLPDGTWN-------LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTS 458          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-1 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8WQL7])

HSP 1 Score: 378.252 bits (970), Expect = 8.289e-114
Identity = 189/358 (52.79%), Postives = 244/358 (68.16%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSM--DLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y++K GE++  RY +  D  +G GSFGQV +A D +  E VAIKII+N+++F  QA+ EI LL +   + +D             IV LK HF++R HLCLVFELL+Y+LY+LLKNTSF GVSLNL +KF  QL   L FLS P L IIHCDLKPENVLLV+ KRS I+V+DFGSSC+   R+Y YIQSRFYR+PEVLL + Y+  IDMWSLGCILVE+HTG+PLF G  E +Q+++I+EV GMPP  M+    + +KYF ++E         + I +  K    RDG R  ++  GARKL  I+G  +GGP GRR  EPGHS +DY+ F DLI RML  DP +RI+P   ++HPF 
Sbjct:  313 DYILKNGEIFDKRYVILSDTPVGKGSFGQVTKAYDTLNKEEVAIKIIKNKKTFFDQAQIEIHLLELTNAHDKDNKY---------NIVTLKGHFVHRAHLCLVFELLSYNLYDLLKNTSFRGVSLNLARKFAQQLGKTLLFLSSPELSIIHCDLKPENVLLVNAKRSQIRVIDFGSSCQTGHRIYQYIQSRFYRSPEVLLGIAYDTKIDMWSLGCILVEMHTGEPLFAGSSEVDQMMKIVEVLGMPPKEMLDIGPKTHKYFDKTE---------DGIYYCKKT---RDGYRHTYKAPGARKLHEILGVTSGGPGGRRLGEPGHSVEDYSKFKDLIKRMLQFDPKQRISPYYVVRHPFL 649          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 243.047 bits (619), Expect = 7.664e-70
Identity = 146/344 (42.44%), Postives = 192/344 (55.81%), Query Frame = 2
Query: 1493 RYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            RY +  +IG GSFGQV++A D    + VA+K++RN + F +QA+ EIR+L  L +   D         G + I+ +  +F +R H C+ FELL+ +LYEL+K   F G SL L +KF   +   L  L +  L  IHCDLKPENVLL    RS IKV+DFGSSC  ++R+Y YIQSRFYRAPEV+L   Y M IDMWSLGCIL EL TG PL  G+ E++Q+  IIE+ GMPP   +  +KRA + FI S+        A  +     V      KR    G  A +  S      G       DE          F+D + R L  DP  R+TP +ALKH + 
Sbjct:  133 RYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSD---------GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRL--IHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRA-RTFITSK-GYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMG-------DE---------LFVDFLKRCLDWDPETRMTPAQALKHKWL 447          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 243.047 bits (619), Expect = 7.664e-70
Identity = 146/344 (42.44%), Postives = 192/344 (55.81%), Query Frame = 2
Query: 1493 RYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            RY +  +IG GSFGQV++A D    + VA+K++RN + F +QA+ EIR+L  L +   D         G + I+ +  +F +R H C+ FELL+ +LYEL+K   F G SL L +KF   +   L  L +  L  IHCDLKPENVLL    RS IKV+DFGSSC  ++R+Y YIQSRFYRAPEV+L   Y M IDMWSLGCIL EL TG PL  G+ E++Q+  IIE+ GMPP   +  +KRA + FI S+        A  +     V      KR    G  A +  S      G       DE          F+D + R L  DP  R+TP +ALKH + 
Sbjct:  133 RYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSD---------GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRL--IHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRA-RTFITSK-GYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMG-------DE---------LFVDFLKRCLDWDPETRMTPAQALKHKWL 447          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 243.047 bits (619), Expect = 7.664e-70
Identity = 146/344 (42.44%), Postives = 192/344 (55.81%), Query Frame = 2
Query: 1493 RYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            RY +  +IG GSFGQV++A D    + VA+K++RN + F +QA+ EIR+L  L +   D         G + I+ +  +F +R H C+ FELL+ +LYEL+K   F G SL L +KF   +   L  L +  L  IHCDLKPENVLL    RS IKV+DFGSSC  ++R+Y YIQSRFYRAPEV+L   Y M IDMWSLGCIL EL TG PL  G+ E++Q+  IIE+ GMPP   +  +KRA + FI S+        A  +     V      KR    G  A +  S      G       DE          F+D + R L  DP  R+TP +ALKH + 
Sbjct:  133 RYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSD---------GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRL--IHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRA-RTFITSK-GYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMG-------DE---------LFVDFLKRCLDWDPETRMTPAQALKHKWL 447          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 243.047 bits (619), Expect = 1.108e-69
Identity = 146/344 (42.44%), Postives = 192/344 (55.81%), Query Frame = 2
Query: 1493 RYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            RY +  +IG GSFGQV++A D    + VA+K++RN + F +QA+ EIR+L  L +   D         G + I+ +  +F +R H C+ FELL+ +LYEL+K   F G SL L +KF   +   L  L +  L  IHCDLKPENVLL    RS IKV+DFGSSC  ++R+Y YIQSRFYRAPEV+L   Y M IDMWSLGCIL EL TG PL  G+ E++Q+  IIE+ GMPP   +  +KRA + FI S+        A  +     V      KR    G  A +  S      G       DE          F+D + R L  DP  R+TP +ALKH + 
Sbjct:  133 RYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSD---------GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRL--IHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRA-RTFITSK-GYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMG-------DE---------LFVDFLKRCLDWDPETRMTPAQALKHKWL 447          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0299619)

HSP 1 Score: 385.956 bits (990), Expect = 1.105e-119
Identity = 192/356 (53.93%), Postives = 258/356 (72.47%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y++K GE +++RY +D LIG GSFGQVV+A D      VAIKII+N++ F+ QA+ E++LL M+ +   +             IV+LK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FLS P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL + Y++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV GMPP +++  + +  K+F +         + +++     + +N++G++  ++  G+RKL  I+G ETGGP GRR DEPGHS  DY  F DLI RML  DP  R+TP  AL+H FF
Sbjct:  151 DYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYY---------IVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKI------VADGSYV-----LKKNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFF 484          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0300509)

HSP 1 Score: 385.956 bits (990), Expect = 1.122e-119
Identity = 192/356 (53.93%), Postives = 258/356 (72.47%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y++K GE +++RY +D LIG GSFGQVV+A D      VAIKII+N++ F+ QA+ E++LL M+ +   +             IV+LK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FLS P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL + Y++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV GMPP +++  + +  K+F +         + +++     + +N++G++  ++  G+RKL  I+G ETGGP GRR DEPGHS  DY  F DLI RML  DP  R+TP  AL+H FF
Sbjct:  151 DYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYY---------IVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKI------VADGSYV-----LKKNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFF 484          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0342786)

HSP 1 Score: 385.571 bits (989), Expect = 6.982e-118
Identity = 192/356 (53.93%), Postives = 258/356 (72.47%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y++K GE +++RY +D LIG GSFGQVV+A D      VAIKII+N++ F+ QA+ E++LL M+ +   +             IV+LK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FLS P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL + Y++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV GMPP +++  + +  K+F +         + +++     + +N++G++  ++  G+RKL  I+G ETGGP GRR DEPGHS  DY  F DLI RML  DP  R+TP  AL+H FF
Sbjct:  290 DYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYY---------IVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKI------VADGSYV-----LKKNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFF 623          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0300508)

HSP 1 Score: 385.956 bits (990), Expect = 2.799e-116
Identity = 192/356 (53.93%), Postives = 258/356 (72.47%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y++K GE +++RY +D LIG GSFGQVV+A D      VAIKII+N++ F+ QA+ E++LL M+ +   +             IV+LK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FLS P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL + Y++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV GMPP +++  + +  K+F +         + +++     + +N++G++  ++  G+RKL  I+G ETGGP GRR DEPGHS  DY  F DLI RML  DP  R+TP  AL+H FF
Sbjct:  151 DYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYY---------IVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKI------VADGSYV-----LKKNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFF 484          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0300510)

HSP 1 Score: 385.185 bits (988), Expect = 8.955e-115
Identity = 192/356 (53.93%), Postives = 258/356 (72.47%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y++K GE +++RY +D LIG GSFGQVV+A D      VAIKII+N++ F+ QA+ E++LL M+ +   +             IV+LK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FLS P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL + Y++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV GMPP +++  + +  K+F +         + +++     + +N++G++  ++  G+RKL  I+G ETGGP GRR DEPGHS  DY  F DLI RML  DP  R+TP  AL+H FF
Sbjct:  290 DYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYY---------IVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKI------VADGSYV-----LKKNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFF 623          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B [Source:ZFIN;Acc:ZDB-GENE-060503-499])

HSP 1 Score: 394.045 bits (1011), Expect = 1.228e-121
Identity = 197/360 (54.72%), Postives = 254/360 (70.56%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGV------GARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +VK GE W++RY +D LIG GSFGQVV+A D    E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP+HM+  + +A KYF +    +              V +N+D K++ +           R+L  I+G ETGGP GRR  E GH+P DY  F DLI RML  DP  RITP  AL+H FF
Sbjct:  100 IVKNGEKWLDRYEIDSLIGKGSFGQVVKAYDHHEQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGVPPNHMLDQAPKARKYFDKLSDGLW------------TVKKNKDIKKVLYPSASEYKPPATRRLHEILGVETGGPGGRRAGEQGHAPCDYLKFKDLILRMLDYDPKTRITPFYALQHNFF 438          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1ab (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, b [Source:ZFIN;Acc:ZDB-GENE-030131-5677])

HSP 1 Score: 395.201 bits (1014), Expect = 1.367e-121
Identity = 195/356 (54.78%), Postives = 256/356 (71.91%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y+VK GE WM+RY +D LIG GSFGQVV+A D    E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP+H++  + +A K+F     +    G  +       + + +DGKR  ++   +RKL +I+G E GGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF
Sbjct:  108 DYVVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFF-----EKLSDGTWS-------IKKTKDGKR--YKPPASRKLHAILGVECGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFF 440          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1ab (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, b [Source:ZFIN;Acc:ZDB-GENE-030131-5677])

HSP 1 Score: 395.201 bits (1014), Expect = 1.615e-121
Identity = 195/356 (54.78%), Postives = 256/356 (71.91%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y+VK GE WM+RY +D LIG GSFGQVV+A D    E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP+H++  + +A K+F     +    G  +       + + +DGKR  ++   +RKL +I+G E GGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF
Sbjct:  116 DYVVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFF-----EKLSDGTWS-------IKKTKDGKR--YKPPASRKLHAILGVECGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFF 448          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B [Source:ZFIN;Acc:ZDB-GENE-060503-499])

HSP 1 Score: 394.045 bits (1011), Expect = 7.303e-121
Identity = 197/354 (55.65%), Postives = 254/354 (71.75%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +VK GE W++RY +D LIG GSFGQVV+A D    E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP+HM+  + +A KYF +    +              V +N+D K+  ++    R+L  I+G ETGGP GRR  E GH+P DY  F DLI RML  DP  RITP  AL+H FF
Sbjct:  100 IVKNGEKWLDRYEIDSLIGKGSFGQVVKAYDHHEQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGVPPNHMLDQAPKARKYFDKLSDGLW------------TVKKNKDIKK-EYKPPATRRLHEILGVETGGPGGRRAGEQGHAPCDYLKFKDLILRMLDYDPKTRITPFYALQHNFF 431          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 382.104 bits (980), Expect = 1.127e-116
Identity = 197/356 (55.34%), Postives = 256/356 (71.91%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y+VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F +    M  +             + +DGKR  ++  G+RKL SI+G E GGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF
Sbjct:  147 DYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGVPPSHILEQAPKARKFFEKMPDSMWCAK------------KTKDGKR--YKPAGSRKLHSILGVEAGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFF 479          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: gdf7 (growth differentiation factor 7 [Source:Xenbase;Acc:XB-GENE-484925])

HSP 1 Score: 398.667 bits (1023), Expect = 6.976e-125
Identity = 201/356 (56.46%), Postives = 257/356 (72.19%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y+VK GE WM+RY +D LIG GSFGQVV+A D    E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G PP+HM+  + +A KYF     ++ E            V +N+D K+  ++  G R+L  ++G ETGGP GRR  E GHSP DY  F DLI RML  DP  RITP  AL+H FF
Sbjct:   73 DYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHHDQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGTPPNHMLDQAPKARKYF----DKLPEGTWT--------VKKNKDLKK-DYKVPGTRRLHEVLGVETGGPGGRRAGEQGHSPSDYLKFKDLILRMLDYDPKTRITPFYALQHNFF 406          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: gdf7 (growth differentiation factor 7 [Source:Xenbase;Acc:XB-GENE-484925])

HSP 1 Score: 401.749 bits (1031), Expect = 1.444e-124
Identity = 201/356 (56.46%), Postives = 257/356 (72.19%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y+VK GE WM+RY +D LIG GSFGQVV+A D    E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G PP+HM+  + +A KYF     ++ E            V +N+D K+  ++  G R+L  ++G ETGGP GRR  E GHSP DY  F DLI RML  DP  RITP  AL+H FF
Sbjct:   98 DYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHHDQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGTPPNHMLDQAPKARKYF----DKLPEGTWT--------VKKNKDLKK-DYKVPGTRRLHEVLGVETGGPGGRRAGEQGHSPSDYLKFKDLILRMLDYDPKTRITPFYALQHNFF 431          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: gdf7 (growth differentiation factor 7 [Source:Xenbase;Acc:XB-GENE-484925])

HSP 1 Score: 400.979 bits (1029), Expect = 2.456e-124
Identity = 201/356 (56.46%), Postives = 257/356 (72.19%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y+VK GE WM+RY +D LIG GSFGQVV+A D    E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G PP+HM+  + +A KYF     ++ E            V +N+D K+  ++  G R+L  ++G ETGGP GRR  E GHSP DY  F DLI RML  DP  RITP  AL+H FF
Sbjct:   87 DYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHHDQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGTPPNHMLDQAPKARKYF----DKLPEGTWT--------VKKNKDLKK-DYKVPGTRRLHEVLGVETGGPGGRRAGEQGHSPSDYLKFKDLILRMLDYDPKTRITPFYALQHNFF 420          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: gdf7 (growth differentiation factor 7 [Source:Xenbase;Acc:XB-GENE-484925])

HSP 1 Score: 400.979 bits (1029), Expect = 2.430e-123
Identity = 201/356 (56.46%), Postives = 257/356 (72.19%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y+VK GE WM+RY +D LIG GSFGQVV+A D    E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G PP+HM+  + +A KYF     ++ E            V +N+D K+  ++  G R+L  ++G ETGGP GRR  E GHSP DY  F DLI RML  DP  RITP  AL+H FF
Sbjct:  172 DYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHHDQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGTPPNHMLDQAPKARKYF----DKLPEGTWT--------VKKNKDLKK-DYKVPGTRRLHEVLGVETGGPGGRRAGEQGHSPSDYLKFKDLILRMLDYDPKTRITPFYALQHNFF 505          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: osbpl8 (oxysterol binding protein like 8 [Source:Xenbase;Acc:XB-GENE-5961068])

HSP 1 Score: 375.17 bits (962), Expect = 1.098e-115
Identity = 197/371 (53.10%), Postives = 259/371 (69.81%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTS 2575
            +VK GE WM+RY +D LIG GSFGQVV+A D    E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F     +    G  N       + + +DGK+  ++  G RKL +++G ETGGP GRR  E GH+  DY  F DLI RML  D   RI P  AL+H FF       T +S +  TS
Sbjct:  147 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMSKIVEVLGIPPAHILDQAPKARKFF-----EKMPEGTWN-------LKKTKDGKK-EYKPPGTRKLHNLLGVETGGPGGRRGGESGHTVADYLKFKDLILRMLDYDAKTRIQPYYALQHSFFKKTADEGTNTSNSVSTS 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1a (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a [Source:MGI Symbol;Acc:MGI:1330299])

HSP 1 Score: 398.282 bits (1022), Expect = 1.038e-122
Identity = 199/371 (53.64%), Postives = 261/371 (70.35%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTS 2575
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F     +    G  +       + + +DGKR  ++  G RKL +I+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF       T +S +  TS
Sbjct:  110 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFF-----EKLPDGTWS-------LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTS 458          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 394.43 bits (1012), Expect = 1.996e-122
Identity = 198/379 (52.24%), Postives = 257/379 (67.81%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTSIRNSPS 2593
            +Y+V+ GE W+ RY +D LIG GSFGQVV+A D  T E VAIKII+N+++F+ QA+ E+RLL ++ ++  +             IV LK HFM+R HLCLVFELL+Y+LY+LL+NT F GVSLNLT+K   QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL  PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ RI+EV G+PP  M+  + +A KYF               +       R     R  ++G G R+L  ++G +TGGP GRR  EPGHSP DY  F DL+ RML  +P  RI+P  AL+H FF      +T +  A  +S   SP+
Sbjct:   98 DYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYY---------IVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYF-------------ERLPGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAG-SSASTSPA 453          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1a (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a [Source:MGI Symbol;Acc:MGI:1330299])

HSP 1 Score: 398.282 bits (1022), Expect = 3.205e-122
Identity = 199/371 (53.64%), Postives = 261/371 (70.35%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTS 2575
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F     +    G  +       + + +DGKR  ++  G RKL +I+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF       T +S +  TS
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFF-----EKLPDGTWS-------LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTS 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1a (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a [Source:MGI Symbol;Acc:MGI:1330299])

HSP 1 Score: 398.282 bits (1022), Expect = 3.205e-122
Identity = 199/371 (53.64%), Postives = 261/371 (70.35%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTS 2575
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F     +    G  +       + + +DGKR  ++  G RKL +I+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF       T +S +  TS
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFF-----EKLPDGTWS-------LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTS 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 394.43 bits (1012), Expect = 1.282e-121
Identity = 198/379 (52.24%), Postives = 257/379 (67.81%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTSIRNSPS 2593
            +Y+V+ GE W+ RY +D LIG GSFGQVV+A D  T E VAIKII+N+++F+ QA+ E+RLL ++ ++  +             IV LK HFM+R HLCLVFELL+Y+LY+LL+NT F GVSLNLT+K   QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL  PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ RI+EV G+PP  M+  + +A KYF               +       R     R  ++G G R+L  ++G +TGGP GRR  EPGHSP DY  F DL+ RML  +P  RI+P  AL+H FF      +T +  A  +S   SP+
Sbjct:  158 DYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYY---------IVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYF-------------ERLPGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAG-SSASTSPA 513          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q13627|DYR1A_HUMAN (Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2)

HSP 1 Score: 400.593 bits (1028), Expect = 2.784e-122
Identity = 200/371 (53.91%), Postives = 261/371 (70.35%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTS 2575
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F     +    G  N       + + +DGKR  ++  G RKL +I+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF       T +S +  TS
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFF-----EKLPDGTWN-------LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTS 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q9Z188|DYR1B_MOUSE (Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Mus musculus OX=10090 GN=Dyrk1b PE=1 SV=3)

HSP 1 Score: 394.43 bits (1012), Expect = 1.396e-121
Identity = 198/379 (52.24%), Postives = 257/379 (67.81%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTSIRNSPS 2593
            +Y+V+ GE W+ RY +D LIG GSFGQVV+A D  T E VAIKII+N+++F+ QA+ E+RLL ++ ++  +             IV LK HFM+R HLCLVFELL+Y+LY+LL+NT F GVSLNLT+K   QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL  PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ RI+EV G+PP  M+  + +A KYF               +       R     R  ++G G R+L  ++G +TGGP GRR  EPGHSP DY  F DL+ RML  +P  RI+P  AL+H FF      +T +  A  +S   SP+
Sbjct:   98 DYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYY---------IVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYF-------------ERLPGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAG-SSASTSPA 453          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q63470|DYR1A_RAT (Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Rattus norvegicus OX=10116 GN=Dyrk1a PE=1 SV=2)

HSP 1 Score: 398.282 bits (1022), Expect = 1.982e-121
Identity = 199/371 (53.64%), Postives = 261/371 (70.35%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTS 2575
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F     +    G  +       + + +DGKR  ++  G RKL +I+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF       T +S +  TS
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFF-----EKLPDGTWS-------LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTS 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q61214|DYR1A_MOUSE (Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Mus musculus OX=10090 GN=Dyrk1a PE=1 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 2.242e-121
Identity = 199/371 (53.64%), Postives = 261/371 (70.35%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTS 2575
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F     +    G  +       + + +DGKR  ++  G RKL +I+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF       T +S +  TS
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFF-----EKLPDGTWS-------LKKTKDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTS 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q9Y463|DYR1B_HUMAN (Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Homo sapiens OX=9606 GN=DYRK1B PE=1 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 2.731e-121
Identity = 198/379 (52.24%), Postives = 257/379 (67.81%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTSIRNSPS 2593
            +Y+V+ GE W+ RY +D LIG GSFGQVV+A D  T E VAIKII+N+++F+ QA+ E+RLL ++ ++  +             IV LK HFM+R HLCLVFELL+Y+LY+LL+NT F GVSLNLT+K   QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL  PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ RI+EV G+PP  M+  + +A KYF               +       R     R  ++G G R+L  ++G +TGGP GRR  EPGHSP DY  F DL+ RML  +P  RI+P  AL+H FF      +T +  A  +S   SP+
Sbjct:   98 DYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYY---------IVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYF-------------ERLPGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAG-SSASTSPA 453          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A068WAP0 (Dual specificity OS=Echinococcus granulosus OX=6210 GN=EgrG_000987500 PE=4 SV=1)

HSP 1 Score: 450.669 bits (1158), Expect = 1.939e-134
Identity = 222/380 (58.42%), Postives = 279/380 (73.42%), Query Frame = 2
Query: 1427 HCNTNSSTAK-EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTA 2563
            H + N + A  +Y+V+PGEVWMNRY MD LIG GSFGQV++A D +  E VAIKII+N+R+F  QA  EIRLL  + + Q+     +  + GAN +VRL +HF++RGHLCLVFELL+++LY+LL+NT+F GVSLNLT+KF  QLCSAL FLS+P LQIIHCDLKPEN+LL++PKRSAIK+VDFGSSC +NE++Y YIQSRFYR+P+VLL L Y MAIDMWSLGCILVELHTG+PLF GQ+E +Q+L+IIEV GM P ++I  S+R   +F E E       N N + +       +D  +I ++  GARKLS I+G  +GGP GRR  EPGHSPQDYA F+DL+  ML  DP KRI P EAL H FFC      T  + A
Sbjct:  634 HVDPNHTDANCDYIVRPGEVWMNRYYMDSLIGKGSFGQVMKARDFVANEDVAIKIIKNKRAFTNQAREEIRLLTQMNRLQDSNTDASNSNHGANYVVRLLTHFVFRGHLCLVFELLSHNLYDLLRNTNFRGVSLNLTRKFTQQLCSALEFLSRPDLQIIHCDLKPENILLINPKRSAIKLVDFGSSCHVNEKVYQYIQSRFYRSPDVLLGLDYTMAIDMWSLGCILVELHTGEPLFAGQHELDQMLKIIEVLGMLPSYLIEKSRRWPMFF-EREP------NGNFVPNYQASM--KDNVKINYKPPGARKLSDILGVNSGGPMGRRLQEPGHSPQDYAIFMDLVLHMLIYDPDKRIRPSEALAHRFFCRTAPQPTSRAIA 1004          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A564YX26 (Protein kinase domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS10358 PE=4 SV=1)

HSP 1 Score: 448.358 bits (1152), Expect = 8.666e-134
Identity = 227/397 (57.18%), Postives = 283/397 (71.28%), Query Frame = 2
Query: 1403 ACCVPKCSHCNTNSSTAK-EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQE-DQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTSIRNS 2587
            A    +  H + N + A  +Y+V+PGEVWMNRY MD LIG GSFGQV++A D +  E VAIKII+N+R+F  QA  EIRLL  +   Q+ +    +  + GAN +VRL +HFM+RGHLCLVFELL+++LY+LL+NT+F GVSLNLT+KF  QLCSAL FLS+P LQIIHCDLKPEN+LL++PKRSAIK+VDFGSSC +NE++Y YIQSRFYR+P+VLL L Y MAIDMWSLGCILVELHTG+PLF GQ+E +Q+L+IIEV GM P ++I  S+R    F E E   N   N             +D   I ++  G RKL+ I+G  +GGP GRR  EPGHSPQDYA F+DL+ +MLT DP KRI P EAL H FFC   R +T   T   T +R S
Sbjct:  633 AAATDQQHHVDPNYTDANYDYIVRPGEVWMNRYYMDSLIGKGSFGQVMKARDFVANEDVAIKIIKNKRAFTNQAREEIRLLTKMNHLQDLNAADGSNSNQGANYVVRLLTHFMFRGHLCLVFELLSHNLYDLLRNTNFRGVSLNLTRKFTQQLCSALEFLSRPDLQIIHCDLKPENILLINPKRSAIKLVDFGSSCHVNEKVYQYIQSRFYRSPDVLLGLDYTMAIDMWSLGCILVELHTGEPLFAGQHELDQMLKIIEVLGMLPSYLIEKSRRW-PLFFEREPGGNFVPNYKA--------SMKDNIPISYKAPGTRKLNDILGVNSGGPMGRRLQEPGHSPQDYAIFMDLVLQMLTYDPEKRIRPSEALAHRFFC---RTNTAVPTHPQTVLRQS 1017          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A068YFR1 (Dual specificity OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000987500 PE=4 SV=1)

HSP 1 Score: 447.973 bits (1151), Expect = 1.295e-133
Identity = 221/380 (58.16%), Postives = 279/380 (73.42%), Query Frame = 2
Query: 1427 HCNTNSSTAK-EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTA 2563
            H + N + A  +Y+V+PGEVWMNRY MD LIG GSFGQV++A D +  E VAIKII+N+R+F  QA  EIRLL  + + Q+     +  + GAN +VRL +HF++RGHLCLVFELL+++LY+LL+NT+F GVSLNLT+KF  QLCSAL FLS+P LQIIHCDLKPEN+LL++PKRSAIK+VDFGSSC +NE++Y YIQSRFYR+P+VLL L Y MAIDMWSLGCILVELHTG+PLF GQ+E +Q+L+IIEV GM P ++I  S+R   +F   E + N     N+ +        +D  +I ++  GARKLS I+G  +GGP GRR  EPGHSPQDYA F+DL+  ML  DP KRI P EAL H FFC      T  + A
Sbjct:  622 HVDPNHTDANCDYIVRPGEVWMNRYYMDSLIGKGSFGQVMKARDFVANEDVAIKIIKNKRAFTNQAREEIRLLTQMNRLQDSNTDASNCNHGANYVVRLLTHFVFRGHLCLVFELLSHNLYDLLRNTNFRGVSLNLTRKFTQQLCSALEFLSRPDLQIIHCDLKPENILLINPKRSAIKLVDFGSSCHVNEKVYQYIQSRFYRSPDVLLGLDYTMAIDMWSLGCILVELHTGEPLFAGQHELDQMLKIIEVLGMLPSYLIEKSRRWPMFF---EREPNGDFVPNYQASM------KDNVKINYKPPGARKLSDILGVNSGGPMGRRLQEPGHSPQDYAIFMDLVLHMLIYDPDKRIRPSEALAHRFFCRTAPQPTSRAIA 992          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A3P7VDD6 (Protein kinase domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7758 PE=4 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 1.188e-129
Identity = 226/431 (52.44%), Postives = 280/431 (64.97%), Query Frame = 2
Query: 1427 HCNTNSSTAK-EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQE---------DQDVVTV------PH----------------------------WGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTSIRNS 2587
            H + N + A  +Y+V+ GEVWMNRY MD LIG GSFGQV++A D +    VAIKII+N+R+F  QA  EIRLL  +   QE         +Q    V      PH                            +   C+VRL +HFM+RGHLCLVFELL+++LY+LL+NT+F GVSLNLT+KF  QLCSAL FLS+P LQIIHCDLKPEN+LL++PKRSAIK+VDFGSSC +NE++Y YIQSRFYR+P+VLL L Y MAIDMWSLGCILVELHTG+PLF GQ+E +Q+L+IIEV GM P ++I  S+R   +F E E   N   N             +D   I ++  G RKL+ I+G  +GGP GRR  EPGHSP DYA F+DL+ +MLT DP KRI P EAL H FFC   R +T   T   T +R S
Sbjct:  144 HVDPNYTDANYDYIVRSGEVWMNRYYMDSLIGKGSFGQVMKARDFVANADVAIKIIKNKRAFTNQAREEIRLLTKMNHLQEFNAADGSNSNQGANYVVMCALCPHIPIVAVARSFLPISVSYNAASTYSFSLIFSLPCVVRLLTHFMFRGHLCLVFELLSHNLYDLLRNTNFRGVSLNLTRKFTQQLCSALEFLSRPDLQIIHCDLKPENILLINPKRSAIKLVDFGSSCHVNEKVYQYIQSRFYRSPDVLLGLDYTMAIDMWSLGCILVELHTGEPLFAGQHELDQMLKIIEVLGMLPSYLIEKSRRWPLFF-EREPGGNFVPNYKS--------SMKDNIPISYKAPGTRKLNDILGVNSGGPMGRRLQEPGHSPHDYAIFMDLVLQMLTYDPEKRIRPSEALAHRFFC---RTTTAVPTHPQTVLRQS 562          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A158QHP4 (Protein kinase domain-containing protein OS=Rodentolepis nana OX=102285 PE=4 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 1.201e-129
Identity = 226/431 (52.44%), Postives = 280/431 (64.97%), Query Frame = 2
Query: 1427 HCNTNSSTAK-EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQE---------DQDVVTV------PH----------------------------WGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTSIRNS 2587
            H + N + A  +Y+V+ GEVWMNRY MD LIG GSFGQV++A D +    VAIKII+N+R+F  QA  EIRLL  +   QE         +Q    V      PH                            +   C+VRL +HFM+RGHLCLVFELL+++LY+LL+NT+F GVSLNLT+KF  QLCSAL FLS+P LQIIHCDLKPEN+LL++PKRSAIK+VDFGSSC +NE++Y YIQSRFYR+P+VLL L Y MAIDMWSLGCILVELHTG+PLF GQ+E +Q+L+IIEV GM P ++I  S+R   +F E E   N   N             +D   I ++  G RKL+ I+G  +GGP GRR  EPGHSP DYA F+DL+ +MLT DP KRI P EAL H FFC   R +T   T   T +R S
Sbjct:  144 HVDPNYTDANYDYIVRSGEVWMNRYYMDSLIGKGSFGQVMKARDFVANADVAIKIIKNKRAFTNQAREEIRLLTKMNHLQEFNAADGSNSNQGANYVVMCALCPHIPIVAVARSFLPISVSYNAASTYSFSLIFSLPCVVRLLTHFMFRGHLCLVFELLSHNLYDLLRNTNFRGVSLNLTRKFTQQLCSALEFLSRPDLQIIHCDLKPENILLINPKRSAIKLVDFGSSCHVNEKVYQYIQSRFYRSPDVLLGLDYTMAIDMWSLGCILVELHTGEPLFAGQHELDQMLKIIEVLGMLPSYLIEKSRRWPLFF-EREPGGNFVPNYKS--------SMKDNIPISYKAPGTRKLNDILGVNSGGPMGRRLQEPGHSPHDYAIFMDLVLQMLTYDPEKRIRPSEALAHRFFC---RTTTAVPTHPQTVLRQS 562          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 377.867 bits (969), Expect = 4.933e-115
Identity = 197/356 (55.34%), Postives = 256/356 (71.91%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y+VK GE WM+RY +D LIG GSFGQVV+A D    E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP H++  + +A K+F   E   + +  A          + +DGKR  ++  G+RKL +I+G E GGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF
Sbjct:  129 DYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRHEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGVPPSHILDQAPKARKFF---EKMSDSTWCAK---------KTKDGKR--YKPAGSRKLHNILGVEAGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFF 461          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk1ab (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, b [Source:ZFIN;Acc:ZDB-GENE-030131-5677])

HSP 1 Score: 378.252 bits (970), Expect = 5.062e-115
Identity = 195/356 (54.78%), Postives = 257/356 (72.19%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +Y+VK GE WM+RY +D LIG GSFGQVV+A D    E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP+H++  + +A K+F     +    G+ +       V + +DGKR  ++   +RKL +I+G E GGP GRR  E GH+  DY  F DL+ RML  DP  RI P  AL+H FF
Sbjct:  142 DYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFF-----EKLSDGSWS-------VKKTKDGKR--YKPPASRKLHAILGVEAGGPGGRRAGESGHAVADYLKFKDLVLRMLDYDPKTRIQPYYALQHSFF 474          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 261.536 bits (667), Expect = 1.940e-74
Identity = 149/353 (42.21%), Postives = 210/353 (59.49%), Query Frame = 2
Query: 1493 RYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTL 2551
            RY +  +IG GSFGQV++  D  T E VAIKIIRN++ F QQA  E+++L  + +   D           + ++ +K +F +R HLC+ FELL  +LYEL+K  +F G SL L ++F   L   L  L +   +IIHCDLKPEN+LL    +  IKVVDFGSSC   +R+Y YIQSRFYR+PEV+L  PY+MAIDMWSLGCIL EL+TG PLF G+ E EQI  I+EV GMPP+  ++ + R   +F       +  GN  ++++      ++  KR P     +++L+S++ T          ++P         FLD I R L  DP KR+TP+E ++H +    GR + L
Sbjct:  206 RYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRD---------SCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHRE--KIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFF-------DSKGNPRNVTN------SKGKKRRP----NSKELASVLKT----------NDP--------LFLDFIRRCLVWDPTKRMTPDEGMQHEWI-TEGRLTRL 511          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 261.536 bits (667), Expect = 2.008e-74
Identity = 149/353 (42.21%), Postives = 210/353 (59.49%), Query Frame = 2
Query: 1493 RYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTL 2551
            RY +  +IG GSFGQV++  D  T E VAIKIIRN++ F QQA  E+++L  + +   D           + ++ +K +F +R HLC+ FELL  +LYEL+K  +F G SL L ++F   L   L  L +   +IIHCDLKPEN+LL    +  IKVVDFGSSC   +R+Y YIQSRFYR+PEV+L  PY+MAIDMWSLGCIL EL+TG PLF G+ E EQI  I+EV GMPP+  ++ + R   +F       +  GN  ++++      ++  KR P     +++L+S++ T          ++P         FLD I R L  DP KR+TP+E ++H +    GR + L
Sbjct:  198 RYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRD---------SCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHRE--KIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFF-------DSKGNPRNVTN------SKGKKRRP----NSKELASVLKT----------NDP--------LFLDFIRRCLVWDPTKRMTPDEGMQHEWI-TEGRLTRL 503          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 261.151 bits (666), Expect = 2.277e-74
Identity = 149/353 (42.21%), Postives = 210/353 (59.49%), Query Frame = 2
Query: 1493 RYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTL 2551
            RY +  +IG GSFGQV++  D  T E VAIKIIRN++ F QQA  E+++L  + +   D           + ++ +K +F +R HLC+ FELL  +LYEL+K  +F G SL L ++F   L   L  L +   +IIHCDLKPEN+LL    +  IKVVDFGSSC   +R+Y YIQSRFYR+PEV+L  PY+MAIDMWSLGCIL EL+TG PLF G+ E EQI  I+EV GMPP+  ++ + R   +F       +  GN  ++++      ++  KR P     +++L+S++ T          ++P         FLD I R L  DP KR+TP+E ++H +    GR + L
Sbjct:  195 RYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRD---------SCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHRE--KIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFF-------DSKGNPRNVTN------SKGKKRRP----NSKELASVLKT----------NDP--------LFLDFIRRCLVWDPTKRMTPDEGMQHEWI-TEGRLTRL 500          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 403.675 bits (1036), Expect = 9.223e-125
Identity = 205/377 (54.38%), Postives = 263/377 (69.76%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTSIRNSPS 2593
            +VK GE WM+RY +D LIG GSFGQVV+A D    E VAIKII+N+++F+ QA+ E+RLL ++ K+  D             IV LK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP HM+  + +A KYF     +    G+         V + +D KR  ++  G+RKL  IIG E+GGP GRR  E GH+  DY  F DLI RML  DP  RITP  AL+H FF    + +T   T    S+  SP+
Sbjct:  151 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHQEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTDMKYY---------IVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGLPPTHMLEQAPKARKYF-----ERLSDGSWT-------VKKTKDSKR-EYKTAGSRKLHDIIGVESGGPGGRRMGEAGHTVADYLKFKDLILRMLDYDPKTRITPFYALQHNFF----KKTTDEGTNTSNSVSTSPA 501          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 243.047 bits (619), Expect = 2.111e-69
Identity = 145/349 (41.55%), Postives = 198/349 (56.73%), Query Frame = 2
Query: 1493 RYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEP------KVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPF 2521
            RY +  +IG GSFGQVV+A D  T   VA+K++RN + F +QA  EIR+L  L K   +  +          I+ L   F +RGH+C+ FELL+ +LYEL+K   F G SL L +KF   +   L  L +   +IIHCDLKPEN+LL  P RS IKV+DFGSSC  ++R+Y YIQSRFYRAPEV+L   Y   IDMWSLGCIL EL TG PL  G+ E +Q+   +E+ GMPP  ++   KR+ + F+ S       G    ++  P         R+R GK  P    G+R+L + +         R  D+P          LD +   L  +P +R+TP +AL+HP+
Sbjct:  161 RYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDRENSM---------NIIHLLESFTFRGHVCMTFELLSMNLYELIKKNKFQGFSLALVRKFAHSILQCLDTLHRN--RIIHCDLKPENILLKQPGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVVLGARYGPPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELLGMPPQRLLAQGKRS-RNFVSSRGHPRYCG----VTEAPDGAVVLNAGRSRRGK--PRGPPGSRELPAAL---------RGCDDP--------LLLDFLRGCLEWEPSERLTPAQALRHPW 474          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 224.557 bits (571), Expect = 3.926e-63
Identity = 141/359 (39.28%), Postives = 194/359 (54.04%), Query Frame = 2
Query: 1460 YLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVV-DFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVF---RNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            Y+  P +    RY +  +IG GSFGQVV+A D  T + VA+K++RN + F +QA  EIR+L  L K Q+ ++ + V H        +   F +R H+C+ FELL+ +LYEL+K   F G SL + +KF   +   L+ L +   +IIHCDLKPEN+LL    RS IK++ DFGSSC  ++R+Y YIQSRFYRAP       Y + IDMWSLGCIL EL TG PL  G+ E +Q+   +E+ G PP  ++  SKRA ++F  S +          +   P V    R R GK                     GP   R         D   F+D + + L  DP  R+TP +ALKHP+ 
Sbjct:  160 YIHVPHDHVAYRYEVLRVIGKGSFGQVVKAYDHRTHQYVALKMVRNEKRFHRQAAEEIRILEHLKK-QDKENTMNVIH--------MLESFNFRNHICMTFELLSMNLYELIKKNKFQGFSLQVVRKFAHSILLCLNALHKN--RIIHCDLKPENILLRQQGRSGIKIIIDFGSSCYEHQRVYTYIQSRFYRAPGGR----YGLPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELTGSPPARLLEQSKRARQFF--SSLGHPRYCTVTTLPGGPVVLNGGRTRRGK-------------------LRGPPSSRDWTTALKGCDDHLFIDFLKKCLDWDPATRLTPSQALKHPWL 482          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: hipk2 (homeodomain interacting protein kinase 2 [Source:ZFIN;Acc:ZDB-GENE-031125-4])

HSP 1 Score: 204.912 bits (520), Expect = 7.018e-54
Identity = 126/359 (35.10%), Postives = 193/359 (53.76%), Query Frame = 2
Query: 1490 NRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSA--IKVVDFGSSCRLNERL-YVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHI-------SHEPKV-FRNRDGKRIPF---EGVG-ARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPF 2521
            N Y +   +G G+FGQVV+     T E VAIKI++N  S+ +Q + E+ +L  L+    D              VR    F ++ H CLVFE+L  +LY+ LK  +FS + L   +    Q+ SAL  L   SL +IH DLKPEN++LV P R    +KV+DFGS+  +++ +   Y+QSR+YRAPE++L LP+  AIDMWSLGC++ EL  G PL+ G  E++QI  I    G+PP+ ++    +  ++F        E+G    +        HE +   ++++ ++  F   E +G     S + G++       R+            F++L+ RMLT+D  KRI+P E L HPF
Sbjct:  190 NSYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYARQGQVEVGILARLSSESADD----------YNFVRAHECFQHKSHTCLVFEMLEQNLYDFLKQNNFSPLPLKYIRPVLQQVASALMKLK--SLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISATQGLPPEQLLSAGTKTGRFF------QRETGAGYPLWRIKSPEEHEAETGIKSKEARKYMFNCLEDMGQVNPASDLEGSDVLAEKADRRQ-----------FIELLRRMLTMDADKRISPLETLAHPF 519          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007952.1 (pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007952.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 3.530e-47
Identity = 120/352 (34.09%), Postives = 171/352 (48.58%), Query Frame = 2
Query: 1478 EVW----MNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPF 2521
            +VW    + RY +  ++G GSFG+V++  D  + E VAIK++   R        EI +L+ L   +E           ++ I+R+  HF +RG  C+VFELL  +L   LK T   G  L + + F + L  +L  L   +  +IH DLKP N+ +   +   +K+ DFG SC  +E  +  IQ+R YRAPEV+L L Y+   DMWSLGC L ELH+GQ LF G    +Q+  I+EV G+PP  MI  S+    +F   +   N             V  NR   R+P    G+R L   +         R  DE          F D I   L  DP  R+TP  A+ H +
Sbjct:    1 KVWHEHLLYRYEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVLNRARFNESVHRREIEILKRLQTARE-----------SSKIIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDAN--VIHGDLKPGNIGICSYEAGEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFFACKDFSSN-------------VRLNRGLVRVP----GSRALPLAL---------RTTDEH---------FTDFIRSCLQWDPEWRLTPHGAMDHEW 304          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: YAK1 (Serine-threonine protein kinase; component of a glucose-sensing system that inhibits growth in response to glucose availability; upon nutrient deprivation Yak1p phosphorylates Pop2p to regulate mRNA deadenylation, the co-repressor Crf1p to inhibit transcription of ribosomal genes, and the stress-responsive transcription factors Hsf1p and Msn2p; nuclear localization negatively regulated by the Ras/PKA signaling pathway in the presence of glucose [Source:SGD;Acc:S000003677])

HSP 1 Score: 234.572 bits (597), Expect = 8.161e-65
Identity = 129/340 (37.94%), Postives = 197/340 (57.94%), Query Frame = 2
Query: 1511 LIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVF-RNRDGKRIPFEG-VGARKLSSIIGTETGGPDGRRKDE-PGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPF 2521
            ++G G+FGQVV+  +L+T E +A+K++++R  ++ Q+ TE ++L +L    +  D     H+     +R+   F+++ HLCLVFELL+ +LYELLK   F G+S+ L + F  Q+  +L  L +  L  IHCDLKPEN+LL  P +  +K++DFGSSC     +Y YIQSRFYRAPE++L +PY+ +IDMWSLGCI+ EL  G P+F G  E+ Q+ RII+  G PP  MI   K + K+  +   + + S    H     + F R  +    P +     RKL  II         +   E      Q+  C +  +  +L ++P +R TP++A+ HPF
Sbjct:  374 ILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELL---NQKIDPTNKHHF-----LRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLKESKL--IHCDLKPENILLCAPDKPELKIIDFGSSCEEARTVYTYIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMIDMGKNSGKFMKKLAPEESSSSTQKHRMKTIEEFCREYNIVEKPSKQYFKWRKLPDIIRNYRYPKSIQNSQELIDQEMQNRECLIHFLGGVLNLNPLERWTPQQAMLHPF 703          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 124.02 bits (310), Expect = 7.623e-31
Identity = 114/364 (31.32%), Postives = 177/364 (48.63%), Query Frame = 2
Query: 1490 NRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIR--NRRSFVQQAETEIRLLRMLAKYQEDQDVVTV-PHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELL--KNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFG------SSCRLNERLY----VYIQSRFYRAPEVLL-YLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPP--DHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFC 2527
            ++Y +  LIG G++G V  A    +G  VAIK I+  +++ FV +   EI+LLR    + E ++++++        I +L + +       LV EL+   L +++  +N+ FS +S +  + F  Q+  AL   S  S Q+IH D+KP N+LL       +KV DFG      SS    E L      Y+ +R+YRAPE++L +  Y  A+D+WS GCIL E+ +G+PLF G+  H Q+  I+EV G P   D     SKRA +Y             AN     P          +P+E V ++            PD                 +DL+++ML  +P KRI+  EAL+HP+  
Sbjct:   11 SQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRY---FHEHENIISILDKVRPVSIDKLNAVY-------LVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALK--SIHSAQVIHRDIKPSNLLL--NSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYI------------ANLPMRPP----------LPWETVWSKT--------DLNPD----------------MIDLLDKMLQFNPDKRISAAEALRHPYLA 314          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 114.39 bits (285), Expect = 3.774e-27
Identity = 100/352 (28.41%), Postives = 156/352 (44.32%), Query Frame = 2
Query: 1490 NRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQED-----QDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLL-YLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIR--CSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPF 2521
            NRY+    +G G+FG V  A D +T +PVAIK I    S    A+   R L++L   + +     QD+   P                   +  V EL    L+ LL+            + F  Q+   L ++   S  +IH DLKP N+L+   +   +K+ DFG +   + ++  Y+ +R+YRAPE++L +  Y++ +D+WS GCI  E+  G+PLF G+    Q   I ++ G PP  +I   CS+   K F+ S                     +RD   IPF    + +  ++       PD                 +DL+ +ML  DP KRIT  +AL HP+
Sbjct:   21 NRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIFLSP----------------LEDIYFVTELQGTDLHRLLQTRPLEK---QFVQYFLYQILRGLKYVH--SAGVIHRDLKPSNILI--NENCDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLK-FVTS-------------------LPHRD--PIPF----SERFKTV------EPDA----------------VDLLEKMLVFDPKKRITAADALAHPY 301          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 107.842 bits (268), Expect = 7.283e-26
Identity = 95/354 (26.84%), Postives = 158/354 (44.63%), Query Frame = 2
Query: 1514 IGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFS----GVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVY---IQSRFYRAPEVLL-YLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGP-DGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHST 2548
            +G G++  V +  +  TG  VA+K ++   S      T IR + ++ + + +             IVRL         L LVFE +   L + + + +      G+ LNL K F  QL   L F  +   +I+H DLKP+N+L+   KR  +K+ DFG +      +  +   + + +YRAP+VL+    Y+ +ID+WS GCIL E+ TG+PLF G  + EQ+  I ++ G P + +     +  KY            N N I   P                  R L  ++   T  P DG                +D ++ +L ++P  R++ ++AL HP+F     H++
Sbjct:   13 LGNGTYATVYKGLNKTTGVYVALKEVK-LDSEEGTPSTAIREISLMKELKHEN------------IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHEN--KILHRDLKPQNLLI--NKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKY------------NPN-IQQRP-----------------PRDLRQVLQPHTKEPLDGN--------------LMDFLHGLLQLNPDMRLSAKQALHHPWFAEYYHHAS 305          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: SLT2 (Serine/threonine MAP kinase; coordinates expression of all 19S regulatory particle assembly-chaperones (RACs) to control proteasome abundance; involved in regulating maintenance of cell wall integrity, cell cycle progression, nuclear mRNA retention in heat shock, septum assembly; required for mitophagy, pexophagy; affects recruitment of mitochondria to phagophore assembly site; plays role in adaptive response of cells to cold; regulated by the PKC1-mediated signaling pathway [Source:SGD;Acc:S000001072])

HSP 1 Score: 106.686 bits (265), Expect = 1.846e-24
Identity = 104/366 (28.42%), Postives = 161/366 (43.99%), Query Frame = 2
Query: 1493 RYSMDLLIGTGSFGQVVRANDLITGE--PVAIKIIRNRRS---FVQQAETEIRLLRMLAKYQE-----DQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLT--KKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNER-------LYVYIQSRFYRAPEVLL-YLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIR--CSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            R+ +   IG G++G V  A      E   VAIK + N  S     +++  E++LLR    ++      D D+V  P    N +      ++Y        EL+   +++++K    SG  L     + F  Q+   L ++   S  ++H DLKP N+L+       +K+ DFG +   +E        L  Y+ +R+YRAPE++L Y  Y  AID+WS GCIL E   G+P+F G+    Q+ +I++V G PPD  +R   SK    Y              + +   PKV         PF  +                           P   +  LDL+ +ML  DP KRIT +EAL+HP+ 
Sbjct:   22 RFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGL------YLYE-------ELMECDMHQIIK----SGQPLTDAHYQSFTYQILCGLKYIH--SADVLHRDLKPGNLLV--NADCQLKICDFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYI-------------HQLGFIPKV---------PFVNL--------------------------YPNANSQALDLLEQMLAFDPQKRITVDEALEHPYL 318          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO45187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC8])

HSP 1 Score: 382.104 bits (980), Expect = 7.858e-121
Identity = 196/379 (51.72%), Postives = 259/379 (68.34%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTSIRNSPS 2593
            +Y+VK GE W +RY ++ LIG GSFGQV +A D    E +A+KII+N++ F+ QA+ E++LL ++ K   D         G   IVRLK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  Q+C+AL FL  P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC++ +R+Y YIQSRFYR+PEVLL +PYN+AIDMWSLGCILVE+HTG+PLF G  E +Q+++I+EV GMPP  ++  + +A K+F       +   + ++     +  + +DG +  +   G+RKL  I+G ETGGP GRR  E GH+ QDY  F DLI RML  D   RI P  AL H FF    + +    T    S  NSP+
Sbjct:   66 DYIVKAGEKWFDRYEIESLIGKGSFGQVCKAYDHQEKEHIAVKIIKNKKPFLNQAQIEVKLLELMNKNDPD---------GKYYIVRLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLCSPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQIGQRIYQYIQSRFYRSPEVLLGIPYNLAIDMWSLGCILVEMHTGEPLFSGANEFDQMMKIVEVLGMPPKDILDNAPKARKFF-------DRLPDGSY-----QCLKVKDGVK-EYLSPGSRKLHDILGCETGGPGGRRLGEAGHTLQDYLKFKDLILRMLDYDRKTRIVPYAALHHCFF----KKTAEEGTNTTHSATNSPA 418          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO46144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP1])

HSP 1 Score: 248.44 bits (633), Expect = 3.396e-71
Identity = 150/360 (41.67%), Postives = 203/360 (56.39%), Query Frame = 2
Query: 1460 YLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFG---LQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANH--ISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            Y+  P +    RY +  +IG GSFGQVV+A D  T   VA+K++RN + F +QA+ EIR+L  L K  +D           + I+ +  HF +R H+C+ FELL+ +LYEL+K   F G SL L +KF    LQ   ALH       +IIHCDLKPEN+LL    RS IKV+DFGSSC  ++R+Y YIQSRFYRAPEV+L   Y M IDMWS GCIL EL TG PLF G+ E +Q+   +E+ G  P+ +   SKRA  +       +N  G   +  I+  P      DG  +   G  +R+     G   G P+ +   +      D A F+D + R L  DP  R+TP +AL+HP+ 
Sbjct:  155 YIHVPKDHIAYRYEVLKIIGKGSFGQVVKALDHKTNTHVALKMVRNEKRFHRQAQEEIRILEHLKKQDKDN---------THNIIHMLEHFTFRNHVCMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALH-----KNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGARYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACNMELLGYIPEKLRETSKRAKNF-------INSKGYPRYCTITTLP------DGS-VAVSGGRSRR-----GKTRGAPNSKTFVQALKGCDD-AMFIDFLKRCLEWDPSARMTPSQALRHPWL 480          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO36294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ45])

HSP 1 Score: 240.35 bits (612), Expect = 6.652e-71
Identity = 125/274 (45.62%), Postives = 172/274 (62.77%), Query Frame = 2
Query: 1412 VPKCSHCNTNSSTAKEYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYF 2233
            VP     N        YL    +    RY +  ++G GSFGQVV+A D  TG+ VA+KIIRN++ F QQA  E+++L  L K  +D           + ++ +  HF +R HLC+ FEL+  +LYEL+K  +F G SL L ++F   L   L  + +   +IIHCDLKPEN+LL    +++IKV+DFGSSC  ++R+Y YIQSRFYR+PEV+L LPY+MAIDMWS GCIL EL+TG PLF G+ E EQ+  I+EV G+P   +I  + R   +F
Sbjct:   32 VPGAPQNNNYDDDNGSYLKALHDHLAYRYEVLEVLGKGSFGQVVKALDHKTGQHVAVKIIRNKKRFHQQALVEVKILDNLRKKDKDN---------THNLIHMIEHFYFRNHLCITFELMGMNLYELIKKNNFQGFSLALIRRFAFALLHCLKVIHKE--KIIHCDLKPENILLRQRGQTSIKVIDFGSSCYEHQRVYTYIQSRFYRSPEVILGLPYSMAIDMWSFGCILAELYTGYPLFPGENEVEQLACIMEVLGLPSPKLIESASRRRLFF 294          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO49238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV4])

HSP 1 Score: 202.216 bits (513), Expect = 2.600e-57
Identity = 128/366 (34.97%), Postives = 200/366 (54.64%), Query Frame = 2
Query: 1511 LIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSA--IKVVDFGSSCRLNERL-YVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYF-----IESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTSIRN 2584
             +G G+FGQVV+     T E VAIKI+++  S+ +Q + EI +L  L+    +          A   VR    F ++ H CLVFE+L  +LY+ LK + F+ + L   +    Q+  AL  L   +L +IH DLKPEN++LV P +    +KV+DFGS+  +++ +   Y+QSR+YRAPEV+L LP+  +IDMWSLGC++ EL  G PL+ G  E +QI  II+  G+P DH++  + + +++F       + +   +  NAN    E K+  +++ ++  F  +      ++  + TG       +E      D   F+ L+ RMLTID  KRITPEEAL H F   +       S    +S++N
Sbjct:    4 FLGRGTFGQVVKCWKKGTNELVAIKILKDHPSYARQGQIEISILAKLSAENSE----------AYNFVRAIECFQHKNHTCLVFEMLQQNLYDYLKQSKFNPLPLKHIRPIVQQVLVALSKLR--TLGLIHADLKPENIMLVDPDKQPFRVKVIDFGSATHVSKVVCSTYLQSRYYRAPEVILGLPFCESIDMWSLGCVIAELFLGWPLYPGSSEFDQIRYIIQTQGLPYDHLLNNATKTSRFFKKAINTHTGVLEWKLKNANEHERETKI-PSKEARKYIFNSLDDIAQVNLSSSLTG-------NERIAEKIDRYEFVSLLKRMLTIDQEKRITPEEALSHQFVTLSHLVDFAHSNVFKSSVKN 349          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO33758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR83])

HSP 1 Score: 170.244 bits (430), Expect = 2.459e-45
Identity = 106/379 (27.97%), Postives = 187/379 (49.34%), Query Frame = 2
Query: 1475 GEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHP-----------------KRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFC-----CAGRHS 2545
            G+   +RY +  L+G G+FG+V+   D  TG+ VA+K+I+N   + + A+ EI++L  + +            +G +  +++   F + GH+CLVFE +  S+++ +K+ ++    L+  +    QL  A+ FL +  +++ H DLKPEN+L V+                  K S ++++DFGS+   +E     + +R YRAPEV+L L ++   D+WS+GCI+ EL+TG  LF      E +  +  + G  P    + S R  KYF + +++ +E  ++     E                   + L   + +++ G               +  F +L++ +L  DP KRIT +EA++HPFF      C  RHS
Sbjct:  118 GDQLHSRYEVHCLLGEGTFGKVLECYDKKTGDVVAVKVIKNIEKYREAAKLEIKVLEKINQKNR---------YGKSLCIKMLDWFNHHGHMCLVFEKMGLSVFDFMKDNNYEPYPLDQVRHISYQLIVAVKFLHE--MKLTHTDLKPENMLFVNSDCDVFYNKDTKQDQRYVKSSHMRLIDFGSATFEHEHHSTTVSTRHYRAPEVILELGWSYPCDIWSIGCIMFELYTGFTLFQTHENREHLAMMERIIGPIPSDFAKKS-RKTKYFYKGKLEWDEKSSSGKYVRE-----------------NCKPLKKYMLSDSEG---------------HQLFFNLLDYLLEYDPEKRITAKEAMQHPFFNSMYYDCEMRHS 452          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1ab (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:NCBI gene;Acc:101169628])

HSP 1 Score: 398.282 bits (1022), Expect = 1.472e-122
Identity = 197/354 (55.65%), Postives = 256/354 (72.32%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP+H++  + +A K+F     +    G  +       V + +DGKR  ++   +RKL SI+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF
Sbjct:  136 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFF-----EKLSDGTWS-------VKKTKDGKR--YKPPASRKLHSILGVETGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFF 466          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1ab (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:NCBI gene;Acc:101169628])

HSP 1 Score: 397.127 bits (1019), Expect = 1.597e-122
Identity = 197/354 (55.65%), Postives = 256/354 (72.32%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP+H++  + +A K+F     +    G  +       V + +DGKR  ++   +RKL SI+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF
Sbjct:  110 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFF-----EKLSDGTWS-------VKKTKDGKR--YKPPASRKLHSILGVETGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFF 440          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1ab (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:NCBI gene;Acc:101169628])

HSP 1 Score: 397.512 bits (1020), Expect = 2.897e-122
Identity = 197/354 (55.65%), Postives = 256/354 (72.32%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP+H++  + +A K+F     +    G  +       V + +DGKR  ++   +RKL SI+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF
Sbjct:  139 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFF-----EKLSDGTWS-------VKKTKDGKR--YKPPASRKLHSILGVETGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFF 469          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1ab (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:NCBI gene;Acc:101169628])

HSP 1 Score: 397.512 bits (1020), Expect = 2.897e-122
Identity = 197/354 (55.65%), Postives = 256/354 (72.32%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            +VK GE WM+RY +D LIG GSFGQVV+A D +  E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFE+L+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP+H++  + +A K+F     +    G  +       V + +DGKR  ++   +RKL SI+G ETGGP GRR  E GH+  DY  F DLI RML  DP  RI P  AL+H FF
Sbjct:  139 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFF-----EKLSDGTWS-------VKKTKDGKR--YKPPASRKLHSILGVETGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFF 469          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1b (dual specificity tyrosine-phosphorylation-regulated kinase 1B [Source:NCBI gene;Acc:101167568])

HSP 1 Score: 327.791 bits (839), Expect = 5.859e-99
Identity = 154/254 (60.63%), Postives = 199/254 (78.35%), Query Frame = 2
Query: 1463 LVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRAN 2224
            +VK GE W++RY +D LIG GSFGQVV+A D    E VAIKII+N+++F+ QA+ E+RLL ++ K+  +             IV LK HFM+R HLCLVFELL+Y+LY+LL+NT+F GVSLNLT+KF  QLC+AL FL+ P L IIHCDLKPEN+LL +PKRSAIK+VDFGSSC+L +R+Y YIQSRFYR+PEVLL +PY++AIDMWSLGCILVE+HTG+PLF G  E +Q+ +I+EV G+PP HM+  + + N
Sbjct:   81 IVKNGEKWLDRYEIDSLIGKGSFGQVVKAYDHHEQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDTEMKYY---------IVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGVPPSHMLDAAPKKN 325          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000003953.1 (SMESG000003953.1)

HSP 1 Score: 1599.72 bits (4141), Expect = 0.000e+0
Identity = 826/826 (100.00%), Postives = 826/826 (100.00%), Query Frame = 2
Query:  116 MFSTLNLKPTFPFKISKFTGFEKPRHLLSMDKDIPQYDDIRINDFPEHLFEHVDNSSPLDSETQXXXXXXXXALDKESLKKPMPVYGHIMTADQPQNVSLFCSKLTPSLSDGHISKADVLMDKWNDGISKFNFTDSSTSENRIVSADRRFFSEHSNYYDCCNIECNILSHKYSVESLETQNYDTISQESKSAFPMEDPTHFRXXXXXXXXXXXXIASQKLYELVSASNDNYRPESISASSDAQSYHSFGNESLFHHDVVGKQQPPIQKGTSLVFSTDKATAIRSVTTPVVFLCRPQESRILLRMTVSLIKTYQIINEMYYSKKRRRTTEHISSDDSFHRDTKRFLNTCNCSNNEVVQCHNDVDWCSKKRYXXXXXXXXXXXXXLQKPNDIQGNIDMXXXXXXXXXXXXXXXXXXXXNDSKIEKKHLPHDACCVPKCSHCNTNSSTAKEYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTSIRNSPS 2593
            MFSTLNLKPTFPFKISKFTGFEKPRHLLSMDKDIPQYDDIRINDFPEHLFEHVDNSSPLDSETQSISSSFSIALDKESLKKPMPVYGHIMTADQPQNVSLFCSKLTPSLSDGHISKADVLMDKWNDGISKFNFTDSSTSENRIVSADRRFFSEHSNYYDCCNIECNILSHKYSVESLETQNYDTISQESKSAFPMEDPTHFRNTSQNSTTNLLTIASQKLYELVSASNDNYRPESISASSDAQSYHSFGNESLFHHDVVGKQQPPIQKGTSLVFSTDKATAIRSVTTPVVFLCRPQESRILLRMTVSLIKTYQIINEMYYSKKRRRTTEHISSDDSFHRDTKRFLNTCNCSNNEVVQCHNDVDWCSKKRYHHHHHRHNHHHHHLQKPNDIQGNIDMPPKRRHHKHLHPHHHHHKHLNDSKIEKKHLPHDACCVPKCSHCNTNSSTAKEYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTSIRNSPS
Sbjct:    1 MFSTLNLKPTFPFKISKFTGFEKPRHLLSMDKDIPQYDDIRINDFPEHLFEHVDNSSPLDSETQSISSSFSIALDKESLKKPMPVYGHIMTADQPQNVSLFCSKLTPSLSDGHISKADVLMDKWNDGISKFNFTDSSTSENRIVSADRRFFSEHSNYYDCCNIECNILSHKYSVESLETQNYDTISQESKSAFPMEDPTHFRNTSQNSTTNLLTIASQKLYELVSASNDNYRPESISASSDAQSYHSFGNESLFHHDVVGKQQPPIQKGTSLVFSTDKATAIRSVTTPVVFLCRPQESRILLRMTVSLIKTYQIINEMYYSKKRRRTTEHISSDDSFHRDTKRFLNTCNCSNNEVVQCHNDVDWCSKKRYHHHHHRHNHHHHHLQKPNDIQGNIDMPPKRRHHKHLHPHHHHHKHLNDSKIEKKHLPHDACCVPKCSHCNTNSSTAKEYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFFCCAGRHSTLSSTADLTSIRNSPS 826          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000041146.1 (SMESG000041146.1)

HSP 1 Score: 490.345 bits (1261), Expect = 8.552e-158
Identity = 227/356 (63.76%), Postives = 283/356 (79.49%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            EY +KPGE+W +RY ++ LIGTGSFGQVV+A D++T E VAIKII+N+++FV+QA+TEI LL  +AKYQ   ++     WG+N IV+LK+ F + GHLCLVFELLTY+LY+LLKNT+F GVSLNLT+KFG Q+C AL FLS+P LQIIHCDLKPEN+LL+HP+RSAIKVVDFGSSCR++ER+Y YIQSRFYR+PE++L + Y+ AID+WSLGCILVELHTGQPLF+GQ+EHEQILRI+E+ GMPP HM+   K+  KYF E  I     G    IS++PK++R+RD K+I F GV +R L  I+G  TGGP GRR  E GHS  DY  FLDL+ +ML +DP  RI PE ALKHPFF
Sbjct:  264 EYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAIKIIKNKKNFVEQAQTEIALLMEMAKYQITDEMAQ--EWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYF-EQVI-----GTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 611          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000041146.1 (SMESG000041146.1)

HSP 1 Score: 489.574 bits (1259), Expect = 9.981e-158
Identity = 227/356 (63.76%), Postives = 283/356 (79.49%), Query Frame = 2
Query: 1457 EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            EY +KPGE+W +RY ++ LIGTGSFGQVV+A D++T E VAIKII+N+++FV+QA+TEI LL  +AKYQ   ++     WG+N IV+LK+ F + GHLCLVFELLTY+LY+LLKNT+F GVSLNLT+KFG Q+C AL FLS+P LQIIHCDLKPEN+LL+HP+RSAIKVVDFGSSCR++ER+Y YIQSRFYR+PE++L + Y+ AID+WSLGCILVELHTGQPLF+GQ+EHEQILRI+E+ GMPP HM+   K+  KYF E  I     G    IS++PK++R+RD K+I F GV +R L  I+G  TGGP GRR  E GHS  DY  FLDL+ +ML +DP  RI PE ALKHPFF
Sbjct:  255 EYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAIKIIKNKKNFVEQAQTEIALLMEMAKYQITDEMAQ--EWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYF-EQVI-----GTDGAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFF 602          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000080906.1 (SMESG000080906.1)

HSP 1 Score: 490.73 bits (1262), Expect = 7.096e-157
Identity = 264/510 (51.76%), Postives = 343/510 (67.25%), Query Frame = 2
Query: 1013 ILLRMTVSLIKTYQIINEMYYSKKRRRTTEHISSDDSFHRDTKRFLNTCNCSNNEVVQCHNDVDWCSKKRYXXXXXXXXXXXXXLQKPNDIQGNIDMXXXXXXXXXXXXXXXXXXXXNDSKIEKKHLPHDACCVPKCSHCNTNSSTAK------EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            IL++++V LIKTY+ INE+YY KKRR   +  + D+   +D KR  N+ +  N ++   +  V  C                    K +D    I+                     +D ++    +P +        H N N+S +       EYL+KPGE+W ++YS++ LIGTGSFGQVVRA DL +GE VAIKII+N+R+FV+QA  EI LL+ + K+QE+ ++     WGAN IV+LKS F +RGHLCLVFELLTY+LYELLKNT+F GVSLNLT+KF  Q+C AL FLS+P +QIIHCDLKPEN+LL+HP+RSAIKVVDFGSSC  N R+Y YIQSRFYR+PE++L L Y+ AIDMWSLGCI+ ELHTGQPLF+GQ+EHEQILRIIEV GMPP+ MI   K++ +YF     +   +      ++ PK+ R +DGK+I F+G+ +RKLS IIG  TGGP GRR +EPGHS  DY  FLDL+ +M+ IDP KRI P+EALKHPFF
Sbjct:  204 ILIKLSVDLIKTYKNINEIYYRKKRR--LKEPTDDNFLKKDRKR--NSGHEDNTDLKSSNQKVLSCDGAPQT--------------KNSDPSNEIN-----------KKFGCATLLHSDQRVP---IPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQ--EWGANYIVKLKSFFNHRGHLCLVFELLTYTLYELLKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPNTMIDSGKKSLRYF----DRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFF 675          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000080906.1 (SMESG000080906.1)

HSP 1 Score: 491.115 bits (1263), Expect = 7.746e-157
Identity = 264/510 (51.76%), Postives = 343/510 (67.25%), Query Frame = 2
Query: 1013 ILLRMTVSLIKTYQIINEMYYSKKRRRTTEHISSDDSFHRDTKRFLNTCNCSNNEVVQCHNDVDWCSKKRYXXXXXXXXXXXXXLQKPNDIQGNIDMXXXXXXXXXXXXXXXXXXXXNDSKIEKKHLPHDACCVPKCSHCNTNSSTAK------EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 2524
            IL++++V LIKTY+ INE+YY KKRR   +  + D+   +D KR  N+ +  N ++   +  V  C                    K +D    I+                     +D ++    +P +        H N N+S +       EYL+KPGE+W ++YS++ LIGTGSFGQVVRA DL +GE VAIKII+N+R+FV+QA  EI LL+ + K+QE+ ++     WGAN IV+LKS F +RGHLCLVFELLTY+LYELLKNT+F GVSLNLT+KF  Q+C AL FLS+P +QIIHCDLKPEN+LL+HP+RSAIKVVDFGSSC  N R+Y YIQSRFYR+PE++L L Y+ AIDMWSLGCI+ ELHTGQPLF+GQ+EHEQILRIIEV GMPP+ MI   K++ +YF     +   +      ++ PK+ R +DGK+I F+G+ +RKLS IIG  TGGP GRR +EPGHS  DY  FLDL+ +M+ IDP KRI P+EALKHPFF
Sbjct:  216 ILIKLSVDLIKTYKNINEIYYRKKRR--LKEPTDDNFLKKDRKR--NSGHEDNTDLKSSNQKVLSCDGAPQT--------------KNSDPSNEIN-----------KKFGCATLLHSDQRVP---IPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQ--EWGANYIVKLKSFFNHRGHLCLVFELLTYTLYELLKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPNTMIDSGKKSLRYF----DRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFF 687          
The following BLAST results are available for this feature:
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYRK1A3.389e-12553.91dual specificity tyrosine phosphorylation regulate... [more]
DYRK1A3.640e-12553.91dual specificity tyrosine phosphorylation regulate... [more]
DYRK1A1.699e-12453.91dual specificity tyrosine phosphorylation regulate... [more]
DYRK1A1.734e-12453.91dual specificity tyrosine phosphorylation regulate... [more]
DYRK1A2.419e-12353.91dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbk-18.289e-11452.79Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-27.664e-7042.44Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-27.664e-7042.44Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-27.664e-7042.44Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-21.108e-6942.44Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mnb1.105e-11953.93gene:FBgn0259168 transcript:FBtr0299619[more]
mnb1.122e-11953.93gene:FBgn0259168 transcript:FBtr0300509[more]
mnb6.982e-11853.93gene:FBgn0259168 transcript:FBtr0342786[more]
mnb2.799e-11653.93gene:FBgn0259168 transcript:FBtr0300508[more]
mnb8.955e-11553.93gene:FBgn0259168 transcript:FBtr0300510[more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk1b1.228e-12154.72dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1ab1.367e-12154.78dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1ab1.615e-12154.78dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1b7.303e-12155.65dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1aa1.127e-11655.34dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdf76.976e-12556.46growth differentiation factor 7 [Source:Xenbase;Ac... [more]
gdf71.444e-12456.46growth differentiation factor 7 [Source:Xenbase;Ac... [more]
gdf72.456e-12456.46growth differentiation factor 7 [Source:Xenbase;Ac... [more]
gdf72.430e-12356.46growth differentiation factor 7 [Source:Xenbase;Ac... [more]
osbpl81.098e-11553.10oxysterol binding protein like 8 [Source:Xenbase;A... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyrk1a1.038e-12253.64dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b1.996e-12252.24dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1a3.205e-12253.64dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1a3.205e-12253.64dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b1.282e-12152.24dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13627|DYR1A_HUMAN2.784e-12253.91Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q9Z188|DYR1B_MOUSE1.396e-12152.24Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q63470|DYR1A_RAT1.982e-12153.64Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q61214|DYR1A_MOUSE2.242e-12153.64Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q9Y463|DYR1B_HUMAN2.731e-12152.24Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WAP01.939e-13458.42Dual specificity OS=Echinococcus granulosus OX=621... [more]
A0A564YX268.666e-13457.18Protein kinase domain-containing protein OS=Hymeno... [more]
A0A068YFR11.295e-13358.16Dual specificity OS=Echinococcus multilocularis OX... [more]
A0A3P7VDD61.188e-12952.44Protein kinase domain-containing protein OS=Rodent... [more]
A0A158QHP41.201e-12952.44Protein kinase domain-containing protein OS=Rodent... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk1aa4.933e-11555.34dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1ab5.062e-11554.78dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk41.940e-7442.21dual specificity tyrosine phosphorylation regulate... [more]
dyrk42.008e-7442.21dual specificity tyrosine phosphorylation regulate... [more]
dyrk42.277e-7442.21dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk1aa9.223e-12554.38dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk22.111e-6941.55dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk23.926e-6339.28dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
hipk27.018e-5435.10homeodomain interacting protein kinase 2 [Source:Z... [more]
ENSPMAT00000007952.13.530e-4734.09pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YAK18.161e-6537.94Serine-threonine protein kinase; component of a gl... [more]
KSS17.623e-3131.32Mitogen-activated protein kinase (MAPK); involved ... [more]
HOG13.774e-2728.41Mitogen-activated protein kinase involved in osmor... [more]
PHO857.283e-2626.84Cyclin-dependent kinase; has ten cyclin partners; ... [more]
SLT21.846e-2428.42Serine/threonine MAP kinase; coordinates expressio... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451877.858e-12151.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461443.396e-7141.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362946.652e-7145.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492382.600e-5734.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337582.459e-4527.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk1ab1.472e-12255.65dual specificity tyrosine phosphorylation regulate... [more]
dyrk1ab1.597e-12255.65dual specificity tyrosine phosphorylation regulate... [more]
dyrk1ab2.897e-12255.65dual specificity tyrosine phosphorylation regulate... [more]
dyrk1ab2.897e-12255.65dual specificity tyrosine phosphorylation regulate... [more]
dyrk1b5.859e-9960.63dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003953.10.000e+0100.00SMESG000003953.1[more]
SMESG000041146.18.552e-15863.76SMESG000041146.1[more]
SMESG000041146.19.981e-15863.76SMESG000041146.1[more]
SMESG000080906.17.096e-15751.76SMESG000080906.1[more]
SMESG000080906.17.746e-15751.76SMESG000080906.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012260 ID=SMED30012260|Name=Dual specificity tyrosine-phosphorylation-regulated kinase 1A|organism=Schmidtea mediterranea sexual|type=transcript|length=3845bp
ATCAGTTCTTTTTATGACTAAAAAATATTTCTACTTGTTTAATTTTAAAT
TCAATTTCGTTGTGAGAAATTTTTAAAGGCGAAATTTTTAATGTGATATG
GAGAATCAAACTAATATGTTTTCAACGTTGAATTTAAAACCGACATTTCC
ATTCAAAATCTCTAAATTTACAGGTTTTGAAAAACCCAGGCATTTACTAT
CAATGGATAAAGATATTCCACAATATGACGACATTCGCATCAACGATTTT
CCAGAACACTTATTTGAGCATGTTGATAATTCATCGCCTTTAGACAGTGA
AACACAATCTATATCATCTAGTTTTTCAATCGCCCTTGATAAAGAGTCTC
TAAAAAAACCTATGCCAGTTTACGGTCACATAATGACTGCTGATCAACCT
CAAAATGTTTCACTGTTTTGCAGTAAGTTGACCCCTAGCCTATCAGATGG
TCACATTTCAAAGGCAGATGTACTAATGGATAAATGGAATGATGGGATAT
CTAAATTTAATTTTACTGATTCATCTACCTCAGAGAATCGTATTGTCAGT
GCTGATAGGAGGTTCTTCTCGGAACATTCCAATTATTATGATTGTTGCAA
TATTGAATGTAATATTTTATCTCACAAATATTCTGTCGAATCTCTGGAAA
CGCAAAACTACGACACAATCTCTCAGGAATCGAAATCTGCATTCCCTATG
GAAGATCCTACTCATTTTAGAAACACTTCTCAAAATTCCACAACGAATCT
GCTCACAATTGCATCACAAAAGCTGTACGAACTCGTTTCGGCTTCTAATG
ATAACTATCGCCCAGAGTCTATCAGTGCCTCCTCTGACGCCCAGTCATAT
CATTCGTTTGGCAACGAATCATTGTTTCATCACGATGTTGTTGGCAAACA
GCAGCCGCCTATTCAGAAAGGCACATCATTAGTATTCTCAACCGATAAAG
CAACTGCCATTAGATCGGTTACCACGCCAGTAGTTTTCTTATGTCGACCA
CAAGAGTCTAGGATTTTACTGCGAATGACTGTCAGTTTGATAAAGACCTA
TCAAATAATAAACGAGATGTATTACAGCAAAAAGCGTCGACGAACTACTG
AACATATTTCATCAGATGATAGTTTCCATCGAGATACTAAGCGGTTTTTA
AATACTTGCAATTGTTCAAATAACGAAGTCGTTCAATGTCACAACGATGT
TGACTGGTGCTCCAAGAAGCGCTACCATCACCATCACCATCGGCACAATC
ACCATCACCACCATCTACAGAAACCCAATGATATCCAAGGTAACATTGAT
ATGCCTCCTAAAAGACGCCACCATAAACATCTCCATCCTCATCATCATCA
TCATAAACATTTAAATGATTCTAAAATAGAAAAGAAACATTTGCCACATG
ATGCCTGTTGCGTACCGAAGTGCTCTCATTGTAATACGAATTCCAGTACG
GCCAAAGAATATTTAGTAAAACCTGGTGAAGTTTGGATGAATCGCTACAG
CATGGATTTACTGATAGGCACAGGCTCATTTGGACAAGTCGTTCGAGCAA
ATGACTTGATTACCGGTGAACCGGTCGCTATTAAAATTATACGTAATCGA
AGGAGTTTTGTTCAACAAGCCGAAACAGAGATCAGATTATTGAGAATGCT
TGCTAAATATCAGGAAGATCAAGATGTAGTGACAGTGCCTCATTGGGGTG
CCAATTGTATTGTCCGCCTAAAGAGTCACTTCATGTATCGTGGTCATTTG
TGTCTTGTGTTTGAATTGCTCACGTATAGTCTGTATGAATTGTTGAAAAA
CACTAGTTTCAGCGGTGTTTCTCTAAATCTAACGAAGAAATTCGGTTTGC
AGCTTTGTTCGGCACTCCATTTTCTCAGTCAACCGTCATTGCAAATTATT
CATTGTGATTTAAAACCAGAAAACGTACTTTTAGTGCATCCCAAACGATC
AGCTATTAAAGTCGTCGATTTTGGCAGCTCATGTAGATTGAATGAGCGAT
TATACGTTTACATTCAGTCTCGCTTTTATCGTGCTCCAGAAGTACTTCTA
TATCTTCCATATAATATGGCTATTGACATGTGGTCATTGGGCTGCATTTT
AGTTGAGTTACACACGGGCCAGCCGTTATTCGTTGGTCAGTATGAACACG
AACAAATCCTTCGGATCATTGAAGTATGTGGCATGCCTCCAGATCATATG
ATCAGATGCAGTAAAAGAGCTAATAAATACTTCATCGAGTCCGAAATACA
AATGAATGAATCTGGAAATGCTAATCATATTTCTCATGAACCAAAAGTCT
TTCGTAACAGAGATGGAAAAAGAATACCATTTGAAGGAGTTGGAGCTCGT
AAACTGTCTTCTATAATTGGTACAGAGACCGGTGGACCAGATGGCCGTAG
AAAAGATGAGCCAGGTCATTCTCCTCAAGATTATGCATGTTTTCTTGATC
TTATTAACCGTATGCTTACTATTGATCCATTCAAAAGAATAACTCCAGAA
GAAGCGTTAAAACATCCATTTTTTTGCTGTGCTGGTCGGCATTCTACATT
ATCTTCAACAGCAGATTTGACAAGCATTCGAAACTCTCCATCATAACAAT
TCCAATCGATTTAATTGTGTATAAATTTTCTATTATTTTCTAGTTTCCGC
CGTGTGTTACGATGGGGTATTTTAATCTAAAAATCATATCAGTGAAATTT
ACCACTATTAGTTTTGATTTCACTCAAAATCTCTAATTATTTCGAAATAA
TTGACAACTGTAATCAGTGCCAGTCTCCAAAAGATTAACTTACATCATTC
ATTGGGCGGGATAATAATTTTTCAATTTCAATATTTTCCAATTGAAATAC
TGATTGAGAGACAAAAATATTTGCATTTTCTAGAATAAATGTGATATATT
TGTGTATATATATATGCATATATGTATATGTGTATATAATGCGGTCTGAC
TACTCACTAAGTGACAAACTACCTCAATTGAAAATTTGTCGGATATTTTG
CATGTTTCACGGATTGGCAGAAACTGTCAAATTTTTACTGTTCACAAACA
CTTAAAATTGTCGATGTAAACTTTATTTAGGATCAAATTGTATTACGTAT
TTATTGTTGACAGCAGCAAAACCGAAATCATGGAAATAATCGCAATTGAA
ATATTTGCAATAATTGCTATTAATTAATTAATTAATTAATTAAATTTAAA
GTGAGCCCATTAATCAACAAATATCCAGTCGAATGTCATAAAGCGTTGCT
GAAAATTAAATAAATTGGCAATAAATACCCACTGGCTCAGAGATGTTTTC
AATTTTATTAGGAATAATAAATAGGCGATCAACTGCTATAAAAGCAAAAC
GCAAGAAATAACAAACCACTGTTAGTCGAAGTGAAGTTTTAGAATGTATA
AAGTATACAGAGGAGCAAGAAGCGATATTAAAGGAAAGAGTAAAATTACA
TTTTGTTTTTATTTTACTATCAAAGGTAATACCCATCGGGTGTTAACCAA
AACTGTAAAAATAACTCTTAAACTTATGTTTTAGAATGTCAAATTATCCA
AGAATATTGTTAGAATGTAGCTATAAATTAATTATGTAAATAACAATGAC
TATATGTAAGTTTGACTTGTTTATTCTCAGATTCTATTTTAGTGGTCACT
TCCGGTTTCCGCGAATAATCAGTGCTTCTGTAAAAATTATTCATATTATA
CATAGTGATGTACGCACATCTAGATATGTATTTCGAGCTGAAGTTAATAT
CCGGTTAATGACTGTCAATCGTTCTGTCTTGGCCGTTTTACTTATTATTC
CTTTTTTAATATTGATTTTTTAGAATAATAATAATGAAGTCATTG
back to top

protein sequence of SMED30012260-orf-1

>SMED30012260-orf-1 ID=SMED30012260-orf-1|Name=SMED30012260-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=833bp
MENQTNMFSTLNLKPTFPFKISKFTGFEKPRHLLSMDKDIPQYDDIRIND
FPEHLFEHVDNSSPLDSETQSISSSFSIALDKESLKKPMPVYGHIMTADQ
PQNVSLFCSKLTPSLSDGHISKADVLMDKWNDGISKFNFTDSSTSENRIV
SADRRFFSEHSNYYDCCNIECNILSHKYSVESLETQNYDTISQESKSAFP
MEDPTHFRNTSQNSTTNLLTIASQKLYELVSASNDNYRPESISASSDAQS
YHSFGNESLFHHDVVGKQQPPIQKGTSLVFSTDKATAIRSVTTPVVFLCR
PQESRILLRMTVSLIKTYQIINEMYYSKKRRRTTEHISSDDSFHRDTKRF
LNTCNCSNNEVVQCHNDVDWCSKKRYHHHHHRHNHHHHHLQKPNDIQGNI
DMPPKRRHHKHLHPHHHHHKHLNDSKIEKKHLPHDACCVPKCSHCNTNSS
TAKEYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRN
RRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGH
LCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQI
IHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVL
LYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDH
MIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGA
RKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITP
EEALKHPFFCCAGRHSTLSSTADLTSIRNSPS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR028318DYRK1A/B_MNB
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016740transferase activity
GO:0042802identical protein binding
GO:0043621protein self-association
GO:0048156tau protein binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004712protein serine/threonine/tyrosine kinase activity
GO:0004713protein tyrosine kinase activity
GO:0004715non-membrane spanning protein tyrosine kinase activity
GO:0005515protein binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0018107peptidyl-threonine phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
GO:0043518negative regulation of DNA damage response, signal transduction by p53 class mediator
GO:0046777protein autophosphorylation
GO:0048025negative regulation of mRNA splicing, via spliceosome
GO:0090312positive regulation of protein deacetylation
GO:0000381regulation of alternative mRNA splicing, via spliceosome
GO:0007399nervous system development
GO:0007623circadian rhythm
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016607nuclear speck
GO:0030529intracellular ribonucleoprotein complex
GO:0005634nucleus
GO:0005654nucleoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 467..809
e-value: 2.1E-72
score: 256.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 472..809
e-value: 5.2E-45
score: 153.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 467..809
score: 37.884
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 523..809
e-value: 1.2E-119
score: 401.4
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 453..557
e-value: 1.2E-119
score: 401.4
NoneNo IPR availablePANTHERPTHR24058DUAL SPECIFICITY PROTEIN KINASEcoord: 267..810
IPR028318Dual specificity tyrosine-phosphorylation-regulated kinase 1A/BPANTHERPTHR24058:SF12DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-REGULATED KINASE 1Bcoord: 267..810
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 600..612
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 473..496
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 455..810