Gamma-secretase subunit Aph-1

Overview
NameGamma-secretase subunit Aph-1
Smed IDSMED30012256
Length (bp)1241
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gamma-secretase subunit Aph-1 (SMED30012256) t-SNE clustered cells

Violin plots show distribution of expression levels for Gamma-secretase subunit Aph-1 (SMED30012256) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gamma-secretase subunit Aph-1 (SMED30012256) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gamma-secretase subunit Aph-1 (SMED30012256) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012256

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30012256h1SMcG0002383 Contig1074uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012256h1SMcG0002383 Contig1074newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
posterior sideSMED30012256h1SMcG0002093 dd_Smed_v4_2537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30012256h1SMcG0002093 dd_Smed_v4_2537_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012256h1SMcG0002093 Contig1074uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012256h1SMcG0002093 Contig1074newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30012256h1SMcG0002093 dd_Smed_v4_2537_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Human
Match: APH1A (aph-1 homolog A, gamma-secretase subunit [Source:HGNC Symbol;Acc:HGNC:29509])

HSP 1 Score: 89.7373 bits (221), Expect = 9.976e-20
Identity = 85/290 (29.31%), Postives = 120/290 (41.38%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRI 916
            M A  F GC    FG    L L T+   PLR+I L+  A FWLVS L++S++W+ +V + D+         + FG   SV  QE+ R  +   L K D G+  +                                    + DG  P+           ++   AYV GL FG++SG+F+ +N+LA   GPG +G  G S  +    A  T  +IL H  + V+   A   + Y  +  VV  H++ S LT  N    P  E  L            WAF  AGGS   I
Sbjct:    1 MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASL------------------------------------SEDGRSPI-----------SIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLN----PWYEASLLPIYAVTVSMGLWAFITAGGSLRSI 239          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Human
Match: APH1A (aph-1 homolog A, gamma-secretase subunit [Source:HGNC Symbol;Acc:HGNC:29509])

HSP 1 Score: 89.3521 bits (220), Expect = 1.132e-19
Identity = 85/290 (29.31%), Postives = 120/290 (41.38%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRI 916
            M A  F GC    FG    L L T+   PLR+I L+  A FWLVS L++S++W+ +V + D+         + FG   SV  QE+ R  +   L K D G+  +                                    + DG  P+           ++   AYV GL FG++SG+F+ +N+LA   GPG +G  G S  +    A  T  +IL H  + V+   A   + Y  +  VV  H++ S LT  N    P  E  L            WAF  AGGS   I
Sbjct:    1 MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASL------------------------------------SEDGRSPI-----------SIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLN----PWYEASLLPIYAVTVSMGLWAFITAGGSLRSI 239          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Human
Match: APH1B (aph-1 homolog B, gamma-secretase subunit [Source:HGNC Symbol;Acc:HGNC:24080])

HSP 1 Score: 81.6481 bits (200), Expect = 6.714e-17
Identity = 98/310 (31.61%), Postives = 134/310 (43.23%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWY-AVVPLRDK--------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCC----FCALSCCWAFKEAGGSFSRIPWCI---RLNFVRFNR 955
            M A  F GC    FG  + L +FTI T PLRII LI  A FWLVS LISS++W+ A V + +K        + FG   SV+ QE+ R  +   L K   G+K I                                    N     P            ++ + AYV GLGFG+MSG+F+ VN L+   GPGT+G  G S  F    A  TL++IL HV + ++       K +  +  V+L H++ S  T  +           GIN         L   WAF  AGGS   +  C+     NF+ +N+
Sbjct:    1 MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVIIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSI------------------------------------NPGETAP------------SMRLLAYVSGLGFGIMSGVFSFVNTLSDSLGPGTVGIHGDSPQFFLYSAFMTLVIILLHVFWGIVFFDGCEKKKWGILLIVLLTHLLVSAQTFISS--------YYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQ 254          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Human
Match: APH1B (aph-1 homolog B, gamma-secretase subunit [Source:HGNC Symbol;Acc:HGNC:24080])

HSP 1 Score: 70.8626 bits (172), Expect = 1.659e-13
Identity = 54/146 (36.99%), Postives = 71/146 (48.63%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWY-AVVPLRDK--------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIV-IQNRLDDGNNDGN 481
            M A  F GC    FG  + L +FTI T PLRII LI  A FWLVS LISS++W+ A V + +K        + FG   SV+ QE+ R  +   L K   G+K I    ++A S    + +S   F   S +    N L D    G 
Sbjct:    1 MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVIIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPG-ETAPSMRLLAYVSGLGFGIMSGVFSFVNTLSDSLGPGT 145          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Human
Match: APH1B (aph-1 homolog B, gamma-secretase subunit [Source:HGNC Symbol;Acc:HGNC:24080])

HSP 1 Score: 70.4774 bits (171), Expect = 2.375e-13
Identity = 45/104 (43.27%), Postives = 57/104 (54.81%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWY-AVVPLRDK--------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLI 358
            M A  F GC    FG  + L +FTI T PLRII LI  A FWLVS LISS++W+ A V + +K        + FG   SV+ QE+ R  +   L K   G+K I
Sbjct:    1 MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVIIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSI 104          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Fly
Match: aph-1 (gene:FBgn0031458 transcript:FBtr0077716)

HSP 1 Score: 111.309 bits (277), Expect = 4.712e-28
Identity = 88/277 (31.77%), Postives = 129/277 (46.57%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGS 904
            M   EF GC    FG P  L +FTI   P+RII LI +A FWL+S L+ S LWYA++PL++ +AFG+VFSV FQE  R +    L   ++G+  +  D +  ++    + +S   F   S                                 MFA V               N+LA ++GPGT+G  G +  F    A Q L +IL H  ++VI   A+   +Y+ I  VV  H+  S +TL N +    + ++  IN     L+   AF+ AGG+
Sbjct:    1 MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLS-LLISSLWYALIPLKEFLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRVTDNKHILAYVSGLGFGIISG--------------------------------MFALV---------------NVLADMSGPGTMGLKGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVVFSHLFVSLITLLNANELYTTTLL--INYLVTILTGVLAFRVAGGT 227          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Fly
Match: aph-1 (gene:FBgn0031458 transcript:FBtr0335127)

HSP 1 Score: 111.309 bits (277), Expect = 4.712e-28
Identity = 88/277 (31.77%), Postives = 129/277 (46.57%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGS 904
            M   EF GC    FG P  L +FTI   P+RII LI +A FWL+S L+ S LWYA++PL++ +AFG+VFSV FQE  R +    L   ++G+  +  D +  ++    + +S   F   S                                 MFA V               N+LA ++GPGT+G  G +  F    A Q L +IL H  ++VI   A+   +Y+ I  VV  H+  S +TL N +    + ++  IN     L+   AF+ AGG+
Sbjct:    1 MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLS-LLISSLWYALIPLKEFLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRVTDNKHILAYVSGLGFGIISG--------------------------------MFALV---------------NVLADMSGPGTMGLKGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVVFSHLFVSLITLLNANELYTTTLL--INYLVTILTGVLAFRVAGGT 227          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Zebrafish
Match: aph1b (APH1B gamma secretase subunit [Source:NCBI gene;Acc:386808])

HSP 1 Score: 83.5741 bits (205), Expect = 7.368e-18
Identity = 93/294 (31.63%), Postives = 133/294 (45.24%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCI 928
            M    F GC    FG  I L +FTI   PLR+I LI  A FWLVS L+SS++W+  V + +K         + FG+V SV  QE  R  +   L K + G+  +     S E ++                                 IS  +L          AYV GLGFG MSG F+ VN+L+   GPGT+G  G+S ++    A  TL +IL H+ + V+  +A   + +  + AVV  H++ SCLT  N    P  +  L       ++   WA+  AGGS   +  C+
Sbjct:    1 MTVAVFFGCTFIAFGPAIALFMFTIARDPLRVIFLIAGAFFWLVSLLLSSLVWFITVQISNKNSATQQRGLLIFGVVLSVLLQEAFRYGYYRLLKKANEGLLAL-----SQEDTMP--------------------------------ISMRQL----------AYVSGLGFGFMSGAFSVVNILSDSLGPGTVGIHGESQHYFISSAFMTLAIILLHMFWGVVFFEACERQRWWALGAVVASHLVVSCLTFVN----PHYQGSLIPTYIILSVMAVWAYLCAGGSLRNLKLCL 243          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Zebrafish
Match: aph1b (APH1B gamma secretase subunit [Source:NCBI gene;Acc:386808])

HSP 1 Score: 83.5741 bits (205), Expect = 7.368e-18
Identity = 93/294 (31.63%), Postives = 133/294 (45.24%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCI 928
            M    F GC    FG  I L +FTI   PLR+I LI  A FWLVS L+SS++W+  V + +K         + FG+V SV  QE  R  +   L K + G+  +     S E ++                                 IS  +L          AYV GLGFG MSG F+ VN+L+   GPGT+G  G+S ++    A  TL +IL H+ + V+  +A   + +  + AVV  H++ SCLT  N    P  +  L       ++   WA+  AGGS   +  C+
Sbjct:    1 MTVAVFFGCTFIAFGPAIALFMFTIARDPLRVIFLIAGAFFWLVSLLLSSLVWFITVQISNKNSATQQRGLLIFGVVLSVLLQEAFRYGYYRLLKKANEGLLAL-----SQEDTMP--------------------------------ISMRQL----------AYVSGLGFGFMSGAFSVVNILSDSLGPGTVGIHGESQHYFISSAFMTLAIILLHMFWGVVFFEACERQRWWALGAVVASHLVVSCLTFVN----PHYQGSLIPTYIILSVMAVWAYLCAGGSLRNLKLCL 243          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Zebrafish
Match: zgc:114200 (zgc:114200 [Source:ZFIN;Acc:ZDB-GENE-050913-96])

HSP 1 Score: 64.6994 bits (156), Expect = 2.308e-11
Identity = 78/286 (27.27%), Postives = 110/286 (38.46%), Query Frame = 2
Query:   89 FMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPL---------RDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTS-AIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRI 916
            F GC    FG    L +FT+   PLR+I LI  A FWL+S L+SS++W+  V           R  + FG+ FSV  QE+ R  +   L K   G+  I  D  SA S    + ++   F   S A  + N L D    G                                                T+G FG S  +    A  TL + L H  + V+  +     S+  I+ VV +H++ + L+L N    P  E  L    C   L   WAF  +GGS   +
Sbjct:    6 FFGCAFIAFGPAFALFVFTVAKDPLRVIILIAGAFFWLLSLLLSSLVWFIAVKASNSQDPSLPRGLLIFGVFFSVLLQEVFRFAYYRLLRKATEGLAAISDDASSAISVRQMAYVAGLGFGVMSGAFSMINILSDSLGPG------------------------------------------------TVGIFGDSQYYFITAALMTLALTLLHTFWGVLFFEGCEKSSWWVIAVVVSLHLLVAGLSLLN----PLYEGSLPPVYCITLLMGIWAFFSSGGSLQNL 239          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Xenopus
Match: aph1a (regulator of G-protein signaling 9-binding protein B [Source:Xenbase;Acc:XB-GENE-5863396])

HSP 1 Score: 88.9669 bits (219), Expect = 1.285e-19
Identity = 84/298 (28.19%), Postives = 125/298 (41.95%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANE----SPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCI 928
            MA   F GC    FG  + L + TI   PL++I L+  + FWLVS L+SS++W+  V + +K         + FG   SV  QE  R  +   L K D G+  I                                    + DG  P+           ++   AYV G  FG++SG+F+ +N+LA   GPG +G  G S  +    A  T+ ++  H  + ++   A   +  + I  VVL H++ S LT  N     S  P   I LG+          WAF  AGG++  I  C+
Sbjct:    1 MALAVFFGCTFVAFGPALSLFILTIAVDPLKVIILVAGSFFWLVSVLLSSLIWFISVQISNKNDANLQYGLLIFGAAVSVLLQETFRYAYYRLLKKADEGLATI------------------------------------SEDGRSPI-----------SIQQMAYVSGFSFGIISGVFSVINILADAIGPGIVGVHGDSQYYFLTSAFLTMAIVFLHTFWGIVFFAACEKRKPLHIIGVVLSHLVASGLTFLNPMYEASLIPIYIITLGM--------ALWAFVAAGGNYQNIRKCL 243          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Xenopus
Match: aph1a (regulator of G-protein signaling 9-binding protein B [Source:Xenbase;Acc:XB-GENE-5863396])

HSP 1 Score: 88.9669 bits (219), Expect = 1.298e-19
Identity = 84/298 (28.19%), Postives = 125/298 (41.95%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLAN----ESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCI 928
            MA   F GC    FG  + L + TI   PL++I L+  + FWLVS L+SS++W+  V + +K         + FG   SV  QE  R  +   L K D G+  I                                    + DG  P+           ++   AYV G  FG++SG+F+ +N+LA   GPG +G  G S  +    A  T+ ++  H  + ++   A   +  + I  VVL H++ S LT  N     S  P   I LG+          WAF  AGG++  I  C+
Sbjct:    1 MALAVFFGCTFVAFGPALSLFILTIAVDPLKVIILVAGSFFWLVSVLLSSLIWFISVQISNKNDANLQYGLLIFGAAVSVLLQETFRYAYYRLLKKADEGLATI------------------------------------SEDGRSPI-----------SIQQMAYVSGFSFGIISGVFSVINILADAIGPGIVGVHGDSQYYFLTSAFLTMAIVFLHTFWGIVFFAACEKRKPLHIIGVVLSHLVASGLTFLNPMYEASLIPIYIITLGM--------ALWAFVAAGGNYQNIRKCL 243          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Mouse
Match: Aph1a (aph1 homolog A, gamma secretase subunit [Source:MGI Symbol;Acc:MGI:2385110])

HSP 1 Score: 89.3521 bits (220), Expect = 9.634e-20
Identity = 85/290 (29.31%), Postives = 120/290 (41.38%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRI 916
            M A  F GC    FG    L L T+   PLR+I L+  A FWLVS L++S++W+ +V + D+         + FG   SV  QE+ R  +   L K D G+  +                                    + DG  P+           ++   AYV GL FG++SG+F+ +N+LA   GPG +G  G S  +    A  T  +IL H  + V+   A   + Y  +  VV  H++ S LT  N    P  E  L            WAF  AGGS   I
Sbjct:    1 MGAAVFFGCTFVAFGPAFSLFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASL------------------------------------SEDGRSPI-----------SIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLN----PWYEASLLPIYAVTVSMGLWAFITAGGSLRSI 239          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Mouse
Match: Aph1a (aph1 homolog A, gamma secretase subunit [Source:MGI Symbol;Acc:MGI:2385110])

HSP 1 Score: 88.5817 bits (218), Expect = 1.268e-19
Identity = 85/290 (29.31%), Postives = 120/290 (41.38%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRI 916
            M A  F GC    FG    L L T+   PLR+I L+  A FWLVS L++S++W+ +V + D+         + FG   SV  QE+ R  +   L K D G+  +                                    + DG  P+           ++   AYV GL FG++SG+F+ +N+LA   GPG +G  G S  +    A  T  +IL H  + V+   A   + Y  +  VV  H++ S LT  N    P  E  L            WAF  AGGS   I
Sbjct:    1 MGAAVFFGCTFVAFGPAFSLFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASL------------------------------------SEDGRSPI-----------SIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLN----PWYEASLLPIYAVTVSMGLWAFITAGGSLRSI 239          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Mouse
Match: Aph1b (aph1 homolog B, gamma secretase subunit [Source:MGI Symbol;Acc:MGI:3522097])

HSP 1 Score: 85.1149 bits (209), Expect = 2.571e-18
Identity = 94/294 (31.97%), Postives = 128/294 (43.54%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCI 928
            M A  F GC    FG  + L +FTI T PLR+I LI  A FWLVS L+SS+ W+ V  + D          + FG++ SV  QE+ RL +   L K   G+K I                                    N +   P            ++ + AYV GLGFG+MSG+F+ VN L+   GPGT+G  G S  F    A  TL+VI+ HV + V+         +  +  V+L H++ S  T      SP  E+ L        L   WAF  AGGS   +  C+
Sbjct:    1 MTAAVFFGCAFIAFGPALALYVFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVITDNRDGPVQNYLLIFGVLLSVCIQELFRLAYYKLLKKASEGLKSI------------------------------------NPEETAP------------SMRLLAYVSGLGFGIMSGVFSFVNTLSNSLGPGTVGIHGDSPQFFLNSAFMTLVVIMLHVFWGVVFFDGCEKNKWYTLLTVLLTHLVVSTQTFL----SPYYEVNLVTAYIIMVLMGIWAFYVAGGSCRSLKLCL 242          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Mouse
Match: Aph1c (aph1 homolog C, gamma secretase subunit [Source:MGI Symbol;Acc:MGI:1915568])

HSP 1 Score: 82.4185 bits (202), Expect = 2.087e-17
Identity = 96/294 (32.65%), Postives = 128/294 (43.54%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPL---RDK------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCI 928
            M    F GC    FG    L LFTI T PLR+I LI  A FWLVS L+SS+ W+ V  +   RD+      + FG + SV  QE+ RL +   L K   G+K I     + E  I  S+                                           + AYV GLGFG+MSG+F+ VN L+   GPGT+G  G S  F    A  TL+VI+ HV + V+         +  +  V+L H++ S  T      SP  E+ L        L   WAF  AGGS   + +C+
Sbjct:    1 MTLPVFFGCAFIAFGPAFALYLFTIATDPLRVIFLIAGAFFWLVSLLLSSMFWFLVRVITNNRDESVQNYLLIFGALLSVCIQELFRLAYYKLLKKASEGLKSI-----NPEEDIAPSM------------------------------------------RLLAYVSGLGFGIMSGVFSFVNTLSNSLGPGTVGIHGDSPQFFLNSAFMTLVVIMLHVFWGVVFFDGCEKNKWYTLLTVLLTHLVVSTQTFL----SPYYEVNLVTAYIIMVLMGIWAFYVAGGSCRSLKFCL 243          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Mouse
Match: Aph1b (aph1 homolog B, gamma secretase subunit [Source:MGI Symbol;Acc:MGI:3522097])

HSP 1 Score: 72.4034 bits (176), Expect = 2.741e-14
Identity = 53/154 (34.42%), Postives = 74/154 (48.05%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAI-----VIQNRLDDGNN--DGNKP 487
            M A  F GC    FG  + L +FTI T PLR+I LI  A FWLVS L+SS+ W+ V  + D          + FG++ SV  QE+ RL +   L K   G+K I  + ++A S    + +S   F   S +      + N L  G     G+ P
Sbjct:    1 MTAAVFFGCAFIAFGPALALYVFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVITDNRDGPVQNYLLIFGVLLSVCIQELFRLAYYKLLKKASEGLKSINPE-ETAPSMRLLAYVSGLGFGIMSGVFSFVNTLSNSLGPGTVGIHGDSP 153          
BLAST of Gamma-secretase subunit Aph-1 vs. UniProt/SwissProt
Match: sp|Q9VQG2|APH1_DROME (Gamma-secretase subunit Aph-1 OS=Drosophila melanogaster OX=7227 GN=aph-1 PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 4.723e-27
Identity = 88/277 (31.77%), Postives = 129/277 (46.57%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGS 904
            M   EF GC    FG P  L +FTI   P+RII LI +A FWL+S L+ S LWYA++PL++ +AFG+VFSV FQE  R +    L   ++G+  +  D +  ++    + +S   F   S                                 MFA V               N+LA ++GPGT+G  G +  F    A Q L +IL H  ++VI   A+   +Y+ I  VV  H+  S +TL N +    + ++  IN     L+   AF+ AGG+
Sbjct:    1 MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLS-LLISSLWYALIPLKEFLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRVTDNKHILAYVSGLGFGIISG--------------------------------MFALV---------------NVLADMSGPGTMGLKGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVVFSHLFVSLITLLNANELYTTTLL--INYLVTILTGVLAFRVAGGT 227          
BLAST of Gamma-secretase subunit Aph-1 vs. UniProt/SwissProt
Match: sp|Q96BI3|APH1A_HUMAN (Gamma-secretase subunit APH-1A OS=Homo sapiens OX=9606 GN=APH1A PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.791e-19
Identity = 85/290 (29.31%), Postives = 120/290 (41.38%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRI 916
            M A  F GC    FG    L L T+   PLR+I L+  A FWLVS L++S++W+ +V + D+         + FG   SV  QE+ R  +   L K D G+  +                                    + DG  P+           ++   AYV GL FG++SG+F+ +N+LA   GPG +G  G S  +    A  T  +IL H  + V+   A   + Y  +  VV  H++ S LT  N    P  E  L            WAF  AGGS   I
Sbjct:    1 MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASL------------------------------------SEDGRSPI-----------SIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLN----PWYEASLLPIYAVTVSMGLWAFITAGGSLRSI 239          
BLAST of Gamma-secretase subunit Aph-1 vs. UniProt/SwissProt
Match: sp|Q8BVF7|APH1A_MOUSE (Gamma-secretase subunit APH-1A OS=Mus musculus OX=10090 GN=Aph1a PE=1 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 6.739e-19
Identity = 85/290 (29.31%), Postives = 120/290 (41.38%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRI 916
            M A  F GC    FG    L L T+   PLR+I L+  A FWLVS L++S++W+ +V + D+         + FG   SV  QE+ R  +   L K D G+  +                                    + DG  P+           ++   AYV GL FG++SG+F+ +N+LA   GPG +G  G S  +    A  T  +IL H  + V+   A   + Y  +  VV  H++ S LT  N    P  E  L            WAF  AGGS   I
Sbjct:    1 MGAAVFFGCTFVAFGPAFSLFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASL------------------------------------SEDGRSPI-----------SIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLN----PWYEASLLPIYAVTVSMGLWAFITAGGSLRSI 239          
BLAST of Gamma-secretase subunit Aph-1 vs. UniProt/SwissProt
Match: sp|Q8C7N7|APH1B_MOUSE (Gamma-secretase subunit APH-1B OS=Mus musculus OX=10090 GN=Aph1b PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.798e-17
Identity = 94/294 (31.97%), Postives = 128/294 (43.54%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCI 928
            M A  F GC    FG  + L +FTI T PLR+I LI  A FWLVS L+SS+ W+ V  + D          + FG++ SV  QE+ RL +   L K   G+K I                                    N +   P            ++ + AYV GLGFG+MSG+F+ VN L+   GPGT+G  G S  F    A  TL+VI+ HV + V+         +  +  V+L H++ S  T      SP  E+ L        L   WAF  AGGS   +  C+
Sbjct:    1 MTAAVFFGCAFIAFGPALALYVFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVITDNRDGPVQNYLLIFGVLLSVCIQELFRLAYYKLLKKASEGLKSI------------------------------------NPEETAP------------SMRLLAYVSGLGFGIMSGVFSFVNTLSNSLGPGTVGIHGDSPQFFLNSAFMTLVVIMLHVFWGVVFFDGCEKNKWYTLLTVLLTHLVVSTQTFL----SPYYEVNLVTAYIIMVLMGIWAFYVAGGSCRSLKLCL 242          
BLAST of Gamma-secretase subunit Aph-1 vs. UniProt/SwissProt
Match: sp|Q8JHE9|APH1B_DANRE (Gamma-secretase subunit Aph-1b OS=Danio rerio OX=7955 GN=aph1b PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 5.562e-17
Identity = 93/294 (31.63%), Postives = 133/294 (45.24%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCI 928
            M    F GC    FG  I L +FTI   PLR+I LI  A FWLVS L+SS++W+  V + +K         + FG+V SV  QE  R  +   L K + G+  +     S E ++                                 IS  +L          AYV GLGFG MSG F+ VN+L+   GPGT+G  G+S ++    A  TL +IL H+ + V+  +A   + +  + AVV  H++ SCLT  N    P  +  L       ++   WA+  AGGS   +  C+
Sbjct:    1 MTVAVFFGCTFIAFGPAIALFMFTIARDPLRVIFLIAGAFFWLVSLLLSSLVWFITVQISNKNSATQQRGLLIFGVVLSVLLQEAFRYGYYRLLKKANEGLLAL-----SQEDTMP--------------------------------ISMRQL----------AYVSGLGFGFMSGAFSVVNILSDSLGPGTVGIHGESQHYFISSAFMTLAIILLHMFWGVVFFEACERQRWWALGAVVASHLVVSCLTFVN----PHYQGSLIPTYIILSVMAVWAYLCAGGSLRNLKLCL 243          
BLAST of Gamma-secretase subunit Aph-1 vs. TrEMBL
Match: A0A210QT58 (Gamma-secretase subunit Aph-1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18515 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.416e-38
Identity = 111/284 (39.08%), Postives = 150/284 (52.82%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLAN---ESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRI 916
            M   EF GC L  FG P  L LFT++  PLRII LI S  FWL++ L+SSILW+AVVPLR+++AFGLVFSV FQE+ RLLF   L K D G+K++       ++  D  L                          +P         D  N  + AY+ GLG+G++SG F+ VN+LA + GPGT+G  G S  F  + A  TL  +  H  + +I   A+    +  ++ VV+ HM+ SCLTL N   E+ +PA    L        L+   AFK AGGS + I
Sbjct:    1 MTLMEFFGCTLIAFGPPFALFLFTVVRDPLRIIVLIASGFFWLLALLVSSILWFAVVPLREQLAFGLVFSVIFQELFRLLFYKLLRKADEGLKMV------TQTEQDMHL--------------------------EP--------KDFTNKHIMAYISGLGYGIISGAFSIVNVLADMVGPGTVGIQGDSHFFFVVTAFLTLCFVFLHTFWGIIFFHAWDKSKFQYVAIVVVSHMLVSCLTLLNQRSETHTPAYWGSLVPAYVIMFLTGGLAFKIAGGSIANI 244          
BLAST of Gamma-secretase subunit Aph-1 vs. TrEMBL
Match: A0A2C9K6P4 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106053258 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 8.375e-38
Identity = 110/297 (37.04%), Postives = 142/297 (47.81%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANE-SPSPASEIVLG---INCCFCALSCCWAFKEAGGSFSRIPWCIRLNFVRFN 952
            M   EF GC    FG PI L +FTI   P+R+I LI S+ FWL++ LISSILW+AVVPLR+ +AFGLVFSV FQE+ R LF   +   + G+       K ++ S D S I+  DFA T  +   + L  G   G   LI                                 N+LA L GPG++G  G S  F    +  TL  IL H  + VI       K Y  ++ VV  HM+ SCLTL N+ S S  S I LG          +S  +AF  AGGS + I  C+     R+ 
Sbjct:    1 MTLMEFFGCTFIAFGPPIALFIFTIAKDPMRVIVLIASSFFWLIALLISSILWFAVVPLRETLAFGLVFSVLFQELFRFLFYKIMRLANEGL------IKVSQQS-DNSNITPRDFANTHIMAYVSGLGFGLMSGAFSLI---------------------------------NVLADLWGPGSIGIHGDSKYFFWSSSYLTLCFILLHTMWGVIFFAGMDRKCYFYVAYVVATHMLVSCLTLLNQLSSSTDSAIYLGPLIPAYIILVVSGIFAFYTAGGSLANIKNCVTCRKRRYQ 257          
BLAST of Gamma-secretase subunit Aph-1 vs. TrEMBL
Match: A0A433T1H4 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_016791 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.430e-36
Identity = 107/285 (37.54%), Postives = 148/285 (51.93%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLAN-ESPSPASEIVLGI---NCCFCALSCCWAFKEAGGSFSRI 916
            M   EF GC    FG P  L +FTI   P+RII ++ SA FWL S LISSI+W+AVVPLRD++AFG+VFSV  QE+ R LF   L K + G  LI +  +S + +I                                         D  N  + AYV GLGFGL++G F+ VN+LA +NGPGT+G  G S  F    A  +L ++L H A+ +I   A     ++ ++ VV  HM +SC++L N +S S  S + LG    +     +S   AF  AGGS++ +
Sbjct:    1 MTLMEFFGCTFIIFGPPFALFVFTIAKDPMRIIVMMASAFFWLCSLLISSIIWFAVVPLRDQLAFGVVFSVLIQELFRFLFYKVLRKANDG--LIAMSQQSTQQNIT--------------------------------------PKDFINTHIMAYVSGLGFGLIAGTFSIVNILADMNGPGTIGIEGDSKYFFWTSACLSLCILLLHTAWGIIFFSALDKNQWIGVALVVAAHMFFSCISLVNQQSSSDESGVYLGSLVPSYVLLIVSGVAAFHTAGGSYASL 245          
BLAST of Gamma-secretase subunit Aph-1 vs. TrEMBL
Match: R7V908 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_204741 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.296e-35
Identity = 109/287 (37.98%), Postives = 139/287 (48.43%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSP----------ASEIVLGINCCFCALSCCWAFKEAGGS 904
            M   EF GC    FG P  L + TI   PLR+I LI SA FWL+S L+SSI WY V+PLR+++AFGLVFSV FQEI RLLF   L K   G+K                                     G  D N   + N +         + AYV GLG+G++ G F+ VN+LA + GPGT+G +G   NF    A  TL ++L H  + +I    +Y K Y +   VVL H++ SCLTL NE   P          AS + +GI          WAF   GGS
Sbjct:    1 MTLMEFFGCTFIAFGPPAALFILTIANEPLRVIVLIASAFFWLLSLLLSSIWWYIVIPLREEIAFGLVFSVIFQEIFRLLFYVLLGKAAEGLK--------------------------------TFCQQGEGDTNMLSLVNHR--------HLMAYVCGLGYGMVCGTFSLVNILADMAGPGTIGIYGDPQNFFLASAFMTLCMVLLHTFWGIIFFDGFYTKKYYQPIVVVLSHLLVSCLTLLNERQPPMYLASILPAYASLVAMGI----------WAFTIVGGS 237          
BLAST of Gamma-secretase subunit Aph-1 vs. TrEMBL
Match: A0A183STB2 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS7464 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.217e-35
Identity = 99/274 (36.13%), Postives = 152/274 (55.47%), Query Frame = 2
Query:   95 GCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALS----CCWAFKEAGGS 904
            GC L  FG  + L L +   +PLRII L +SA FWLV  LISS+LW+AVVPLR+++AFGLVF+V FQEIVR L+ + + K++ G++  I     AE   D S+ + A  A + A V          D + PL++++K      N  + AY  GLGF LM  +   + + + L GPGT     +   F  L A  +  + L  +A++V++ +AY ++ Y++I  ++  H+  S ++L N+   PA E++    C    +S      WAF  AGG+
Sbjct:    8 GCGLVAFGPVVALFLVSCARYPLRIILLALSAFFWLVGLLISSLLWFAVVPLREQLAFGLVFTVLFQEIVRFLYFFLIQKVESGLRSKI-SVTEAEREPDTSVTTYA--ANSQADV----------DSDIPLVASKK---AFLNHNLIAYTAGLGFALMGCVTEYIFLFSQLTGPGTPMQGSRPGAFFLLAALDSCFMSLSQIAWSVLLFRAYRLRKYLQIVIIIAAHLGLSTVSLVNDLALPAPELL----CALLVISFFGFLAWAFFAAGGT 261          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Cavefish
Match: aph1b (gamma-secretase subunit Aph-1b [Source:NCBI gene;Acc:103033594])

HSP 1 Score: 91.6633 bits (226), Expect = 1.095e-20
Identity = 98/311 (31.51%), Postives = 136/311 (43.73%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVA---------FGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCIRLNFVRFNRFLKQKLRP 979
            MAA  F GC    FG    L LFTI   PLR+I LI  A FWLVS L++S++W+  V + +K +         FG+V SV  QE+ R  +   L K + G+  I                                    + +   P+           +V   AYV GLGFG MSG F+ VN+L+   GPGT+G  G S ++    A  TL +IL H+ + V+  +A   + +  + AVV  H++ SCLT  N    P  E  L        +   WAF  AGGS   +  C+     +   FL    RP
Sbjct:    1 MAAAVFFGCTFIAFGPAAALFLFTISRDPLRVIFLIAGAFFWLVSLLLASLVWFVTVQMSNKESSSQQKALLIFGVVLSVLLQELFRFAYYKLLKKANAGLLAI------------------------------------SQEDTMPI-----------SVRQLAYVSGLGFGFMSGAFSVVNILSDSVGPGTVGIHGDSQHYFISSAFMTLAIILLHMFWGVVFFEACENQRWWSVGAVVFSHLLVSCLTFVN----PQYEGSLIPTYLVLCVMAGWAFSCAGGSLRNLKLCLT---CKDKDFLLANHRP 257          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Cavefish
Match: zgc:114200 (zgc:114200 [Source:ZFIN;Acc:ZDB-GENE-050913-96])

HSP 1 Score: 75.0998 bits (183), Expect = 5.424e-15
Identity = 84/286 (29.37%), Postives = 123/286 (43.01%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGS 904
            M A  F GC    FG    L +FTI   PLR+I LI  A FWL+S L+SS++W+  +   +          + FG+ FSV  QE+ R  +   L K + G+  I                                    +++   P+           +V   AYV GLGFG++SG F+ +N+L+   GPGT+G FG S  +    A  TL + L  + + V+         +  I+ VV +H++ S L+L N    P  E  L        L   WAF  +GGS
Sbjct:    1 MTAAVFFGCAFIAFGPAFSLFIFTIARDPLRVIILIAGAFFWLLSLLLSSLVWFIAMKASNAEDTKVQTGLLIFGVFFSVLLQEVFRFAYYRLLRKANEGLAAI------------------------------------SDEETSPI-----------SVQQMAYVAGLGFGIISGAFSMINILSDTLGPGTVGIFGDSQYYFITSALMTLAITLLQIFWGVVFFDGCEKSRWWVIAVVVCLHLLVSGLSLLN----PLYEGSLPPVYAITVLMAVWAFFASGGS 235          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006061.1 (pep scaffold:Pmarinus_7.0:GL486556:137:9454:-1 gene:ENSPMAG00000005474.1 transcript:ENSPMAT00000006061.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 8.622e-16
Identity = 84/297 (28.28%), Postives = 129/297 (43.43%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPS---PASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCI 928
            M+   F GC    FG  + L + T+   P+R+I LI  + FWLVS L+SS++W+ V  + D+         +  G+  SV  QE+ R  +   L + +RG+  I                                    N DG  P+ +++            AY  GLG+GL+SG F+ VN LA   GPGT+G  G S  +    A  T+ ++L H  + V+       + +V +S VV  H + S LTL +   +   P + IVL        +   WAF  +GGS   +  C+
Sbjct:    1 MSLGVFFGCTFIAFGPALALFVLTVAADPVRVIILIAGSFFWLVSLLVSSLVWFVVSVVTDRTNVQLQQELLTLGVFLSVCLQELSRFGYYCLLSRAERGLASI------------------------------------NMDGQPPITTHQ-----------MAYAAGLGYGLVSGAFSVVNTLAQAAGPGTVGIHGDSQYYFLSSAFMTMALVLLHTFWGVVFFHGCEKRRWVAVSLVVGSHFLVSGLTLLSPLMTCGLPVAYIVL-------LVMAVWAFYASGGSLHSLKRCL 243          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002144.1 (pep scaffold:Pmarinus_7.0:GL476583:217959:225651:-1 gene:ENSPMAG00000001941.1 transcript:ENSPMAT00000002144.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 5.378e-13
Identity = 84/290 (28.97%), Postives = 120/290 (41.38%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANE----SPSPASEIVLGINCCFCALSCCWAFKEAGGS 904
            M    F GC    FG    L + T+   PLR+I  I  A FWLVS L+SS++W+      D+         + FG++ SV FQE+ R  +   L K   G+     D                                     N+P IS +++          AYV GLGFG++SG F+ VN+LA   GPGT+G    S  F    A  TL VIL H+ + V+            +  V+ +H + S +T  N     S  P   +++G+          WAF  AGG+
Sbjct:    1 MPLATFFGCTFIAFGPAFALFILTVARDPLRVIIFIAGAFFWLVSLLLSSLVWFIATKASDRKNEELQHGLLIFGVLLSVLFQEVFRYGYYRLLRKAQDGLVTFSQD-------------------------------------NRPPISMQEM----------AYVAGLGFGIISGAFSVVNILAQSIGPGTVGIRQDSEYFFLTSAFLTLAVILLHMCWGVVFFDGCQQSRVWAVLLVIALHFLVSSMTFLNPVYAGSLVPTYVVLVGM--------LLWAFVVAGGT 235          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Sea Lamprey
Match: APH1A (aph-1 homolog A, gamma-secretase subunit [Source:HGNC Symbol;Acc:HGNC:29509])

HSP 1 Score: 54.299 bits (129), Expect = 1.710e-9
Identity = 40/101 (39.60%), Postives = 52/101 (51.49%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDK---------VAFGLVFSVFFQEIVRLLFIYCLHKIDRGI 349
            M A  F GC    FG    L +FTI   PLR+I LI  A FWLVS L+SS+LW+    L DK         +  G++FS+  QE  R  +   L K + G+
Sbjct:    1 MTATVFFGCAFIAFGPAFALFVFTIARDPLRVIVLIAGAFFWLVSLLMSSLLWFIAYQLSDKTNEGLQRGLLIMGVLFSIAMQETFRYGYFRLLKKANEGL 101          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Sea Lamprey
Match: aph1b (APH1B gamma secretase subunit [Source:NCBI gene;Acc:386808])

HSP 1 Score: 54.6842 bits (130), Expect = 1.724e-9
Identity = 39/109 (35.78%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  590 VNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRI 916
            VN+LA   GPGT+G  G SA++    A  T+ ++L H A+ V+  ++   K +  ++AVVL H+  S LT AN    P  E  L       A    WA+  +GGS   I
Sbjct:   16 VNILAESLGPGTVGIHGDSAHYFLSSAFMTMAMVLLHTAWGVVFFQSCDRKHWWGVAAVVLSHVFVSSLTFAN----PNYEASLIPAYLMMAAFGTWAYFTSGGSLRNI 120          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Nematostella
Match: EDO39639 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9N7])

HSP 1 Score: 100.908 bits (250), Expect = 1.159e-24
Identity = 90/273 (32.97%), Postives = 130/273 (47.62%), Query Frame = 2
Query:   89 FMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFC-ALSCCWAFKEAGGS 904
            F GC    FG  + +   TI     ++I LI SA FWL+S LISSI W  V PL+D++AFG+ FSV FQE+ R  +   + K D G+                S+I+N                        PL  +             AYV GLG+GLMSGLFA VN+LA ++GPG++G  G + NF+ + A  T   +L +  + VI    +  K ++ +  VV  H+  S +TL N+     + +   ++  F   +    AFK AGGS
Sbjct:    6 FFGCTFIAFGPALAMFSLTIAGDAQQVIVLIASAFFWLLSLLISSIWWMVVSPLKDELAFGMTFSVLFQELFRFAYFKIIRKADEGL---------------LSMINN----------------------QSPLRKHR-----------IAYVAGLGYGLMSGLFAMVNVLADISGPGSIGLHGNAQNFLIVSAFLTSCFVLLNTFWGVIWFDGWENKKWLNVFVVVASHLFVSLMTLLNQDSQYIATL---LSAYFTLVVMAVLAFKVAGGS 227          
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Medaka
Match: aph1b (gamma-secretase subunit Aph-1b [Source:NCBI gene;Acc:101159650])

HSP 1 Score: 92.8189 bits (229), Expect = 3.518e-21
Identity = 99/315 (31.43%), Postives = 138/315 (43.81%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVA---------FGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPS----PASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCIRLNFVRFNRFLKQKLRP 979
            M A  F GC    FG  I L LFTI   PLR+I LI  A FWLVS L+SS++W+  V + +K +         FG+V SV  QE  R  +   L K + G+  +     S E ++  S                                          +   AYV GLGFG MSG F+ VN+LA   GPGT+G  G S ++    A  T+ +IL H+ + V+   A   + +  +  VV++H++ SCLT  N   +    PA  I+ G+          WAF  AGGS   +  C+     +   FL    RP
Sbjct:    1 MTAAVFFGCTFIAFGPAISLFLFTIAREPLRVIFLIAGAFFWLVSLLLSSLVWFISVQISNKESAAQQKGLLIFGVVLSVLLQETFRFGYYKLLKKANEGLLTL-----SQEETMPIS------------------------------------------IRQLAYVSGLGFGFMSGAFSVVNILADSAGPGTIGIHGDSQHYFLSSAFMTMAIILLHMFWGVVFFDACEKRCWWAVGLVVIVHLLVSCLTFQNPDYTATLVPAYVILFGMG--------VWAFYTAGGSLRNLKLCLT---CKDKDFLLSNHRP 257          
BLAST of Gamma-secretase subunit Aph-1 vs. Planmine SMEST
Match: SMESG000065416.1 (SMESG000065416.1)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 304/307 (99.02%), Postives = 304/307 (99.02%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCIRLNFVRFNRFLKQKLRPVRSME 994
            MA DEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVGGLGFGLMSGLFATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIM KAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCIRLNFVRFNRFLKQKLRPVR ME
Sbjct:    1 MAVDEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVGGLGFGLMSGLFATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMFKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCIRLNFVRFNRFLKQKLRPVRRME 307          
BLAST of Gamma-secretase subunit Aph-1 vs. Planmine SMEST
Match: SMESG000065416.1 (SMESG000065416.1)

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 299/301 (99.34%), Postives = 299/301 (99.34%), Query Frame = 2
Query:   92 MGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCIRLNFVRFNRFLKQKLRPVRSME 994
            MGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVGGLGFGLMSGLFATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIM KAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCIRLNFVRFNRFLKQKLRPVR ME
Sbjct:    1 MGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVGGLGFGLMSGLFATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMFKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCIRLNFVRFNRFLKQKLRPVRRME 301          
BLAST of Gamma-secretase subunit Aph-1 vs. Planmine SMEST
Match: SMESG000065416.1 (SMESG000065416.1)

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 289/307 (94.14%), Postives = 289/307 (94.14%), Query Frame = 2
Query:   74 MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFKSAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVXXXXXXXXXXXXATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCIRLNFVRFNRFLKQKLRPVRSME 994
            MA DEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIK               SLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVGGLGFGLMSGLFATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIM KAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCIRLNFVRFNRFLKQKLRPVR ME
Sbjct:    1 MAVDEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISSILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIK---------------SLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVFNVTMFAYVGGLGFGLMSGLFATVNMLAALNGPGTLGYFGQSANFINLYAGQTLLVILFHVAFNVIMFKAYYMKSYVKISAVVLIHMIYSCLTLANESPSPASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCIRLNFVRFNRFLKQKLRPVRRME 292          
The following BLAST results are available for this feature:
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
APH1A9.976e-2029.31aph-1 homolog A, gamma-secretase subunit [Source:H... [more]
APH1A1.132e-1929.31aph-1 homolog A, gamma-secretase subunit [Source:H... [more]
APH1B6.714e-1731.61aph-1 homolog B, gamma-secretase subunit [Source:H... [more]
APH1B1.659e-1336.99aph-1 homolog B, gamma-secretase subunit [Source:H... [more]
APH1B2.375e-1343.27aph-1 homolog B, gamma-secretase subunit [Source:H... [more]
back to top
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aph-14.712e-2831.77gene:FBgn0031458 transcript:FBtr0077716[more]
aph-14.712e-2831.77gene:FBgn0031458 transcript:FBtr0335127[more]
back to top
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
aph1b7.368e-1831.63APH1B gamma secretase subunit [Source:NCBI gene;Ac... [more]
aph1b7.368e-1831.63APH1B gamma secretase subunit [Source:NCBI gene;Ac... [more]
zgc:1142002.308e-1127.27zgc:114200 [Source:ZFIN;Acc:ZDB-GENE-050913-96][more]
back to top
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aph1a1.285e-1928.19regulator of G-protein signaling 9-binding protein... [more]
aph1a1.298e-1928.19regulator of G-protein signaling 9-binding protein... [more]
back to top
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aph1a9.634e-2029.31aph1 homolog A, gamma secretase subunit [Source:MG... [more]
Aph1a1.268e-1929.31aph1 homolog A, gamma secretase subunit [Source:MG... [more]
Aph1b2.571e-1831.97aph1 homolog B, gamma secretase subunit [Source:MG... [more]
Aph1c2.087e-1732.65aph1 homolog C, gamma secretase subunit [Source:MG... [more]
Aph1b2.741e-1434.42aph1 homolog B, gamma secretase subunit [Source:MG... [more]
back to top
BLAST of Gamma-secretase subunit Aph-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VQG2|APH1_DROME4.723e-2731.77Gamma-secretase subunit Aph-1 OS=Drosophila melano... [more]
sp|Q96BI3|APH1A_HUMAN4.791e-1929.31Gamma-secretase subunit APH-1A OS=Homo sapiens OX=... [more]
sp|Q8BVF7|APH1A_MOUSE6.739e-1929.31Gamma-secretase subunit APH-1A OS=Mus musculus OX=... [more]
sp|Q8C7N7|APH1B_MOUSE1.798e-1731.97Gamma-secretase subunit APH-1B OS=Mus musculus OX=... [more]
sp|Q8JHE9|APH1B_DANRE5.562e-1731.63Gamma-secretase subunit Aph-1b OS=Danio rerio OX=7... [more]
back to top
BLAST of Gamma-secretase subunit Aph-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QT581.416e-3839.08Gamma-secretase subunit Aph-1 OS=Mizuhopecten yess... [more]
A0A2C9K6P48.375e-3837.04Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A433T1H41.430e-3637.54Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
R7V9081.296e-3537.98Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A183STB22.217e-3536.13Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aph1b1.095e-2031.51gamma-secretase subunit Aph-1b [Source:NCBI gene;A... [more]
zgc:1142005.424e-1529.37zgc:114200 [Source:ZFIN;Acc:ZDB-GENE-050913-96][more]
back to top
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000006061.18.622e-1628.28pep scaffold:Pmarinus_7.0:GL486556:137:9454:-1 gen... [more]
ENSPMAT00000002144.15.378e-1328.97pep scaffold:Pmarinus_7.0:GL476583:217959:225651:-... [more]
APH1A1.710e-939.60aph-1 homolog A, gamma-secretase subunit [Source:H... [more]
aph1b1.724e-935.78APH1B gamma secretase subunit [Source:NCBI gene;Ac... [more]
back to top
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO396391.159e-2432.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gamma-secretase subunit Aph-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
aph1b3.518e-2131.43gamma-secretase subunit Aph-1b [Source:NCBI gene;A... [more]
back to top
BLAST of Gamma-secretase subunit Aph-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000065416.10.000e+099.02SMESG000065416.1[more]
SMESG000065416.10.000e+099.34SMESG000065416.1[more]
SMESG000065416.10.000e+094.14SMESG000065416.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012256 ID=SMED30012256|Name=Gamma-secretase subunit Aph-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1241bp
TACAATTTGAAATTATTTATTTGTTAATTATATATGGAATAATTTTTATT
AAATTTAATAAATAATTTAAATAATGGCAGCTGATGAATTTATGGGATGT
CTCTTGACAGGATTTGGCATACCTATTGTTTTAGTATTATTTACTATTAT
AACTCACCCATTAAGAATAATTACACTAATTATCAGTGCAAGCTTTTGGT
TAGTTTCATTTTTAATTTCTTCAATACTATGGTATGCTGTCGTACCTTTG
AGGGATAAAGTAGCTTTTGGTTTGGTGTTTTCTGTTTTCTTCCAAGAAAT
CGTTCGCTTACTATTTATTTATTGCCTGCACAAAATTGATCGAGGCATCA
AGTTAATTATTTTGGATTTCAAAAGTGCTGAATCGAGTATTGATAGATCA
CTAATTAGCAATGCCGATTTTGCAACAACATCAGCAATTGTTATCCAAAA
TAGACTAGATGACGGCAATAACGATGGAAATAAACCTCTGATTAGTAATG
AGAAGCTGACAGATGATGTTTTTAACGTGACAATGTTTGCATATGTTGGT
GGATTGGGATTCGGGTTGATGTCGGGACTGTTTGCCACAGTGAACATGTT
GGCGGCCCTAAATGGACCGGGAACGCTCGGATATTTTGGTCAATCTGCCA
ATTTCATTAATTTATATGCGGGCCAAACATTGCTGGTGATTCTGTTCCAC
GTTGCGTTTAATGTCATCATGTCCAAGGCGTACTATATGAAGTCCTACGT
GAAAATAAGCGCAGTTGTCCTGATTCACATGATATACTCGTGCTTGACAC
TCGCTAATGAATCTCCTTCACCAGCTTCAGAAATCGTTCTCGGAATCAAT
TGCTGTTTTTGTGCATTGTCTTGCTGTTGGGCATTCAAGGAAGCCGGTGG
GAGTTTCTCGCGAATCCCTTGGTGCATTCGCCTGAATTTCGTCCGATTCA
ATAGATTCCTAAAGCAAAAACTGCGACCCGTGCGCAGCATGGAATGAATG
TCATGGCTTCTATTTTTAATATTTTGTAAATTTGATAGCTCCAATTTACT
TGATTTAATTTTATTGTTTCTTTTCCATTGATTGTGATTTGGGGCCATTT
AGTCCGATTTTGGTTAGTTTTATTTAAATAAATTTACAGGAAAAGAAAAA
ATACCGAATGGAATCTTTGCATTTCATTGGATGGTGGATTACAGGTAACA
CTGCAGGTAACTGACGGCTAAAGGGATAAAGTGATCGGCGG
back to top

protein sequence of SMED30012256-orf-1

>SMED30012256-orf-1 ID=SMED30012256-orf-1|Name=SMED30012256-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=308bp
MAADEFMGCLLTGFGIPIVLVLFTIITHPLRIITLIISASFWLVSFLISS
ILWYAVVPLRDKVAFGLVFSVFFQEIVRLLFIYCLHKIDRGIKLIILDFK
SAESSIDRSLISNADFATTSAIVIQNRLDDGNNDGNKPLISNEKLTDDVF
NVTMFAYVGGLGFGLMSGLFATVNMLAALNGPGTLGYFGQSANFINLYAG
QTLLVILFHVAFNVIMSKAYYMKSYVKISAVVLIHMIYSCLTLANESPSP
ASEIVLGINCCFCALSCCWAFKEAGGSFSRIPWCIRLNFVRFNRFLKQKL
RPVRSME*
back to top

protein sequence of SMED30012256-orf-2

>SMED30012256-orf-2 ID=SMED30012256-orf-2|Name=SMED30012256-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=108bp
MAPNHNQWKRNNKIKSSKLELSNLQNIKNRSHDIHSMLRTGRSFCFRNLL
NRTKFRRMHQGIREKLPPASLNAQQQDNAQKQQLIPRTISEAGEGDSLAS
VKHEYIM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR009294Aph-1
Vocabulary: biological process
TermDefinition
GO:0043085positive regulation of catalytic activity
GO:0016485protein processing
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 306..307
NoneNo IPR availablePANTHERPTHR12889:SF0GAMMA-SECRETASE SUBUNIT APH-1coord: 1..272
NoneNo IPR availableTMHMMTMhelixcoord: 63..85
NoneNo IPR availableTMHMMTMhelixcoord: 35..57
NoneNo IPR availableTMHMMTMhelixcoord: 194..216
NoneNo IPR availableTMHMMTMhelixcoord: 6..28
NoneNo IPR availableTMHMMTMhelixcoord: 157..179
IPR009294Gamma-secretase subunit Aph-1PFAMPF06105Aph-1coord: 5..280
e-value: 9.0E-64
score: 215.0
IPR009294Gamma-secretase subunit Aph-1PANTHERPTHR12889GAMMA-SECRETASE SUBUNIT APH-1coord: 1..272