C-CAP/cofactor C-like domain-containing protein

Overview
NameC-CAP/cofactor C-like domain-containing protein
Smed IDSMED30012250
Length (bp)1799
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C-CAP/cofactor C-like domain-containing protein (SMED30012250) t-SNE clustered cells

Violin plots show distribution of expression levels for C-CAP/cofactor C-like domain-containing protein (SMED30012250) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C-CAP/cofactor C-like domain-containing protein (SMED30012250) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C-CAP/cofactor C-like domain-containing protein (SMED30012250) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012250

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012250h1SMcG0014031 SmedASXL_012800SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
head regionSMED30012250h1SMcG0014031 OX_Smed_1.0.07058ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30012250h1SMcG0014031 dd_Smed_v4_12514_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Human
Match: TBCCD1 (TBCC domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25546])

HSP 1 Score: 66.6254 bits (161), Expect = 2.042e-12
Identity = 31/71 (43.66%), Postives = 45/71 (63.38%), Query Frame = 1
Query:   67 LWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN 276
            LWV++EPF  G L V P P   S+H ++K+ +Y +++   G YP+L +  W+HIAC KLQL + L W  F 
Sbjct:    8 LWVKAEPFIVGALQV-PPPSKFSLHYLRKISTYVQIRATEGAYPRLYWSTWRHIACGKLQLAKDLAWLYFE 77          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Human
Match: TBCCD1 (TBCC domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25546])

HSP 1 Score: 67.0106 bits (162), Expect = 7.298e-12
Identity = 31/71 (43.66%), Postives = 45/71 (63.38%), Query Frame = 1
Query:   67 LWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN 276
            LWV++EPF  G L V P P   S+H ++K+ +Y +++   G YP+L +  W+HIAC KLQL + L W  F 
Sbjct:    8 LWVKAEPFIVGALQVPP-PSKFSLHYLRKISTYVQIRATEGAYPRLYWSTWRHIACGKLQLAKDLAWLYFE 77          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Human
Match: TBCCD1 (TBCC domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25546])

HSP 1 Score: 66.6254 bits (161), Expect = 7.778e-11
Identity = 31/73 (42.47%), Postives = 46/73 (63.01%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN 276
            + LWV++EPF  G L V P P   S+H ++K+ +Y +++   G YP+L +  W+HIAC KLQL + L W  F 
Sbjct:    6 VLLWVKAEPFIVGALQVPP-PSKFSLHYLRKISTYVQIRATEGAYPRLYWSTWRHIACGKLQLAKDLAWLYFE 77          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Human
Match: TBCCD1 (TBCC domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25546])

HSP 1 Score: 66.6254 bits (161), Expect = 7.778e-11
Identity = 31/73 (42.47%), Postives = 46/73 (63.01%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN 276
            + LWV++EPF  G L V P P   S+H ++K+ +Y +++   G YP+L +  W+HIAC KLQL + L W  F 
Sbjct:    6 VLLWVKAEPFIVGALQVPP-PSKFSLHYLRKISTYVQIRATEGAYPRLYWSTWRHIACGKLQLAKDLAWLYFE 77          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Zebrafish
Match: tbccd1 (TBCC domain containing 1 [Source:NCBI gene;Acc:100037389])

HSP 1 Score: 65.0846 bits (157), Expect = 1.312e-10
Identity = 31/74 (41.89%), Postives = 43/74 (58.11%), Query Frame = 1
Query:   55 YLIQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWT*FN 276
            Y   +W R EPF  G+L   P P   SMH ++K+ SY + +    +P+L + +W+HIAC KLQL E L W  F 
Sbjct:    4 YTAYVWPRLEPFLVGVLPATP-PSKFSMHYLRKMASYVRTR-DGCFPRLGWQMWRHIACGKLQLAEDLAWLYFE 75          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Zebrafish
Match: tbccd1 (TBCC domain containing 1 [Source:NCBI gene;Acc:100037389])

HSP 1 Score: 65.0846 bits (157), Expect = 1.335e-10
Identity = 31/74 (41.89%), Postives = 43/74 (58.11%), Query Frame = 1
Query:   55 YLIQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWT*FN 276
            Y   +W R EPF  G+L   P P   SMH ++K+ SY + +    +P+L + +W+HIAC KLQL E L W  F 
Sbjct:    4 YTAYVWPRLEPFLVGVLPATP-PSKFSMHYLRKMASYVRTR-DGCFPRLGWQMWRHIACGKLQLAEDLAWLYFE 75          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Zebrafish
Match: tbccd1 (TBCC domain containing 1 [Source:NCBI gene;Acc:100037389])

HSP 1 Score: 65.0846 bits (157), Expect = 1.335e-10
Identity = 31/74 (41.89%), Postives = 43/74 (58.11%), Query Frame = 1
Query:   55 YLIQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWT*FN 276
            Y   +W R EPF  G+L   P P   SMH ++K+ SY + +    +P+L + +W+HIAC KLQL E L W  F 
Sbjct:    4 YTAYVWPRLEPFLVGVLPATP-PSKFSMHYLRKMASYVRTR-DGCFPRLGWQMWRHIACGKLQLAEDLAWLYFE 75          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Xenopus
Match: tbccd1 (TBCC domain containing 1 [Source:NCBI gene;Acc:549715])

HSP 1 Score: 69.707 bits (169), Expect = 2.162e-12
Identity = 30/73 (41.10%), Postives = 46/73 (63.01%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN 276
            +QLWV+++PF  G L + P P   SMH ++K+ +Y + +   G YP+L + +W+HIAC KLQ+ E   W  F 
Sbjct:    6 VQLWVKTDPFLLGALQIPP-PEKFSMHYLRKMATYVRTRASEGCYPRLCWCMWRHIACGKLQILEETAWLYFE 77          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Xenopus
Match: tbccd1 (TBCC domain containing 1 [Source:NCBI gene;Acc:549715])

HSP 1 Score: 69.707 bits (169), Expect = 7.009e-12
Identity = 30/73 (41.10%), Postives = 46/73 (63.01%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN 276
            +QLWV+++PF  G L + P P   SMH ++K+ +Y + +   G YP+L + +W+HIAC KLQ+ E   W  F 
Sbjct:    6 VQLWVKTDPFLLGALQIPP-PEKFSMHYLRKMATYVRTRASEGCYPRLCWCMWRHIACGKLQILEETAWLYFE 77          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Mouse
Match: Tbccd1 (TBCC domain containing 1 [Source:MGI Symbol;Acc:MGI:1917823])

HSP 1 Score: 67.781 bits (164), Expect = 2.017e-13
Identity = 33/78 (42.31%), Postives = 47/78 (60.26%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN*MMDD 291
            + LWV++EPF  G L   P P   S+H ++K+ +Y + +   G YP L +P W+HIAC KLQL + L W  F  M D+
Sbjct:    6 VLLWVKAEPFLVGALQ-EPPPSKFSLHYLRKIATYVRTRATEGAYPHLYWPTWRHIACGKLQLAKDLAWLYFE-MFDN 81          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Mouse
Match: Tbccd1 (TBCC domain containing 1 [Source:MGI Symbol;Acc:MGI:1917823])

HSP 1 Score: 67.3958 bits (163), Expect = 2.403e-12
Identity = 33/78 (42.31%), Postives = 47/78 (60.26%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN*MMDD 291
            + LWV++EPF  G L   P P   S+H ++K+ +Y + +   G YP L +P W+HIAC KLQL + L W  F  M D+
Sbjct:    6 VLLWVKAEPFLVGALQ-EPPPSKFSLHYLRKIATYVRTRATEGAYPHLYWPTWRHIACGKLQLAKDLAWLYFE-MFDN 81          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Mouse
Match: Tbccd1 (TBCC domain containing 1 [Source:MGI Symbol;Acc:MGI:1917823])

HSP 1 Score: 67.781 bits (164), Expect = 6.144e-12
Identity = 33/78 (42.31%), Postives = 47/78 (60.26%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN*MMDD 291
            + LWV++EPF  G L   P P   S+H ++K+ +Y + +   G YP L +P W+HIAC KLQL + L W  F  M D+
Sbjct:    6 VLLWVKAEPFLVGALQ-EPPPSKFSLHYLRKIATYVRTRATEGAYPHLYWPTWRHIACGKLQLAKDLAWLYFE-MFDN 81          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Mouse
Match: Tbccd1 (TBCC domain containing 1 [Source:MGI Symbol;Acc:MGI:1917823])

HSP 1 Score: 67.781 bits (164), Expect = 2.256e-11
Identity = 33/78 (42.31%), Postives = 47/78 (60.26%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN*MMDD 291
            + LWV++EPF  G L   P P   S+H ++K+ +Y + +   G YP L +P W+HIAC KLQL + L W  F  M D+
Sbjct:    6 VLLWVKAEPFLVGALQ-EPPPSKFSLHYLRKIATYVRTRATEGAYPHLYWPTWRHIACGKLQLAKDLAWLYFE-MFDN 81          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Mouse
Match: Tbccd1 (TBCC domain containing 1 [Source:MGI Symbol;Acc:MGI:1917823])

HSP 1 Score: 67.781 bits (164), Expect = 2.256e-11
Identity = 33/78 (42.31%), Postives = 47/78 (60.26%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN*MMDD 291
            + LWV++EPF  G L   P P   S+H ++K+ +Y + +   G YP L +P W+HIAC KLQL + L W  F  M D+
Sbjct:    6 VLLWVKAEPFLVGALQ-EPPPSKFSLHYLRKIATYVRTRATEGAYPHLYWPTWRHIACGKLQLAKDLAWLYFE-MFDN 81          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. UniProt/SwissProt
Match: sp|A1L0Z4|TBCC1_XENTR (TBCC domain-containing protein 1 OS=Xenopus tropicalis OX=8364 GN=tbccd1 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 3.713e-11
Identity = 30/73 (41.10%), Postives = 46/73 (63.01%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN 276
            +QLWV+++PF  G L + P P   SMH ++K+ +Y + +   G YP+L + +W+HIAC KLQ+ E   W  F 
Sbjct:    6 VQLWVKTDPFLLGALQIPP-PEKFSMHYLRKMATYVRTRASEGCYPRLCWCMWRHIACGKLQILEETAWLYFE 77          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. UniProt/SwissProt
Match: sp|A4IF93|TBCC1_BOVIN (TBCC domain-containing protein 1 OS=Bos taurus OX=9913 GN=TBCCD1 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 6.602e-11
Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKG-KAGYPKLSYPIWKHIACNKLQLTETLTWT*FN*MMDD 291
            + LWV++EPF  G L + P P   S+H ++K+ +Y + +  + GYP+LS+  W+HIAC KLQL + L W  F  M D 
Sbjct:    6 VLLWVKAEPFIVGALQIPP-PSKFSLHYLRKISTYVRTRTIEGGYPRLSWSTWRHIACGKLQLAKDLAWLYFE-MFDS 81          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5FVR8|TBCC1_RAT (TBCC domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Tbccd1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.041e-10
Identity = 34/81 (41.98%), Postives = 50/81 (61.73%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKG-KAGYPKLSYPIWKHIACNKLQLTETLTWT*FN*MMDDSGE 300
            + LWV++EPF  G L   P P  LS+H +KK+ +Y + +  +  YP+L +P W+HIAC KLQL + L W  F  + D+  E
Sbjct:    6 VLLWVKAEPFIVGALQ-EPPPSKLSLHYLKKVAAYVRTRATERAYPRLYWPTWRHIACGKLQLAKDLAWLYFE-IFDNLSE 84          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q08AV6|TBCC1_XENLA (TBCC domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=tbccd1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.350e-10
Identity = 30/73 (41.10%), Postives = 45/73 (61.64%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN 276
            +QLW +++PF  G L + P P   SMH ++K+ SY + +   G YP+L + +W+HIAC KLQ+ E   W  F 
Sbjct:    6 VQLWAKTDPFLLGALQMPP-PAKFSMHYLRKMASYVRTRATEGCYPRLYWAMWRHIACGKLQIVEETAWLYFE 77          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q640P7|TBCC1_MOUSE (TBCC domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tbccd1 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.578e-10
Identity = 33/78 (42.31%), Postives = 47/78 (60.26%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAG-YPKLSYPIWKHIACNKLQLTETLTWT*FN*MMDD 291
            + LWV++EPF  G L   P P   S+H ++K+ +Y + +   G YP L +P W+HIAC KLQL + L W  F  M D+
Sbjct:    6 VLLWVKAEPFLVGALQ-EPPPSKFSLHYLRKIATYVRTRATEGAYPHLYWPTWRHIACGKLQLAKDLAWLYFE-MFDN 81          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. TrEMBL
Match: A0A3M7PNI1 (Uncharacterized protein (Fragment) OS=Brachionus plicatilis OX=10195 GN=BpHYR1_026613 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.873e-31
Identity = 82/220 (37.27%), Postives = 119/220 (54.09%), Query Frame = 2
Query:  719 KRRMCWFHMIKSVDNYLSILGDKGLKCAMLKDINVLQLATTEKQFNAATKLFTQKY--SSNSNMKQFLKYLKTEWLVKHIGWYEAYLENDPSTNYDLQSINSILKKEAIFRVRMPLTQFLT---------TKLRCQ*MVRKTRSWLITTPDLNWMTKSI--------VIQKNCQYTKQFFIKSKEATMEFNNASVKAYCDATKADHLMNIIAFAFQFGML 1321
            KR MCWFH  K++   ++IL D  L+  ++ D++ LQL  ++  F  A+KLF +K+   SN N+K FL+Y ++EWL+KH GWYE +L + PSTN  L+SINS LKK   FR R+PL QFL+         +K R    V      L  T D   +TK+          I ++       +  S  A +E NN ++K Y  A   +HL N  +F   +G+L
Sbjct:  162 KRGMCWFHPKKAITTRIAILNDSTLQSQIMLDLDALQLCQSDCLFEKASKLFLKKWINHSNKNIKDFLRYFESEWLLKHPGWYEGFLSDGPSTNNGLESINSTLKKNHSFRKRLPLHQFLSLAKDIIKHWSKRRDPLSVNCKNFSLQPTIDTQLLTKTYDWIKHKKKSIARDEDNMIINYTNSTMANVEVNNQNIKTYRSA--VEHL-NFKSFDKFYGIL 378          

HSP 2 Score: 38.891 bits (89), Expect = 1.873e-31
Identity = 21/43 (48.84%), Postives = 29/43 (67.44%), Query Frame = 1
Query:  571 KFMFESLQADLEATSQLIMAYDGSIGLIADSADAITNEFKAVF 699
            +F+F SL   L+ T+Q  + Y   + L+AD+ADAITN FK VF
Sbjct:  119 QFIFSSLLIGLQLTNQQELGY---VDLVADAADAITNGFKNVF 158          

HSP 3 Score: 24.2534 bits (51), Expect = 1.873e-31
Identity = 13/29 (44.83%), Postives = 16/29 (55.17%), Query Frame = 3
Query:  426 SERMGETKFNLVFCQGPQY*CRLIWNNFP 512
            S+R+ E   N  F Q      +LIWNNFP
Sbjct:   86 SQRLLENCKNTKFIQADST-YKLIWNNFP 113          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. TrEMBL
Match: A0A2H1BTX7 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_15685 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 4.893e-24
Identity = 50/71 (70.42%), Postives = 59/71 (83.10%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWT*F 273
            + LW R+EPFTYGI  V+PHPRL ++HNIKKLVSYAK KGK G+PKLSY +WKH+ACNKLQL+E L W  F
Sbjct:    9 VSLWPRAEPFTYGIFQVHPHPRL-AVHNIKKLVSYAKSKGKTGFPKLSYSVWKHVACNKLQLSEELAWVLF 78          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. TrEMBL
Match: A0A074YZ65 (C-CAP/cofactor C-like domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_11384 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.804e-23
Identity = 52/71 (73.24%), Postives = 61/71 (85.92%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWT*F 273
            + LW R+EPFTYGI  V+PHPRL ++HNIKKLVSYAK KGK+G+PKLSYP+WKH+ACNKLQLTE L W  F
Sbjct:    9 VSLWPRAEPFTYGIFQVHPHPRL-AVHNIKKLVSYAKSKGKSGFPKLSYPVWKHVACNKLQLTEDLAWILF 78          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. TrEMBL
Match: A0A4S2LXH0 (C-CAP/cofactor C-like domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004190 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 3.228e-23
Identity = 52/71 (73.24%), Postives = 61/71 (85.92%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWT*F 273
            + LW R+EPFTYGI  V+PHPRL ++HNIKKLVSYAK KGK+G+PKLSYP+WKH+ACNKLQLTE L W  F
Sbjct:   50 VSLWPRAEPFTYGIFQVHPHPRL-AVHNIKKLVSYAKSKGKSGFPKLSYPVWKHVACNKLQLTEDLAWILF 119          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. TrEMBL
Match: A0A226DW34 (MULE domain-containing protein OS=Folsomia candida OX=158441 GN=Fcan01_15770 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 3.497e-23
Identity = 48/136 (35.29%), Postives = 76/136 (55.88%), Query Frame = 2
Query:  713 NVKRRMCWFHMIKSVDNYLSILGDKGLKCAMLKDINVLQLATTEKQFNAATKLFTQKYSSNSNMKQFLKYLKTEWLVKHIGWYEAYLENDPSTNYDLQSINSILKKEAIFRVRMPLTQFLTTKLRCQ*MVRKTRSW 1120
            ++ R  CWFH+ K++D   S + +K L   +  D+N LQLA + + F AA +LF +KY + +++ QF+ Y K E L    GWYE +    PSTN  ++  N+ +K++  FR R+ + Q L      Q M  +T  W
Sbjct:  304 DITRIYCWFHLCKNIDARQSTIKNKELWRKLRGDVNELQLARSPEDFLAAKELFLKKYRTEADLTQFMAYFKQEHLDTRDGWYEGHCMGFPSTNNGIEGTNAWIKRQGTFRERLSIGQLL------QYMTNQTEIW 433          

HSP 2 Score: 33.113 bits (74), Expect = 3.497e-23
Identity = 22/44 (50.00%), Postives = 29/44 (65.91%), Query Frame = 1
Query:  568 LKFMFESLQADLEATSQLIMAYDGSIGLIADSADAITNEFKAVF 699
             KF+FESL+     TS+    Y  +I LIAD+A++ITN FK VF
Sbjct:  265 FKFIFESLKM---GTSE---KYKPTI-LIADAAESITNGFKEVF 301          

HSP 3 Score: 32.7278 bits (73), Expect = 3.497e-23
Identity = 11/27 (40.74%), Postives = 18/27 (66.67%), Query Frame = 3
Query:  489 RLIWNNFPVLICGTIDQYKFFHPFGIS 569
            +L W  +PV++ G  DQ + FHP G++
Sbjct:  229 KLCWQGYPVILTGVSDQDRTFHPTGMA 255          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Cavefish
Match: tbccd1 (TBCC domain containing 1 [Source:NCBI gene;Acc:103033584])

HSP 1 Score: 66.6254 bits (161), Expect = 3.766e-11
Identity = 32/70 (45.71%), Postives = 44/70 (62.86%), Query Frame = 1
Query:   67 LWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWT*FN 276
            +W R EPF  G L V P P  LSMH ++K+  Y + + +  +P+LS+ +W+HIAC KLQL E L W  F 
Sbjct:    8 IWPRMEPFLLGALQVAP-PSKLSMHYLRKMACYVRTR-EGCFPQLSWHMWRHIACGKLQLAEELAWLYFE 75          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Nematostella
Match: EDO30525 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0J5])

HSP 1 Score: 87.0409 bits (214), Expect = 5.042e-18
Identity = 42/81 (51.85%), Postives = 55/81 (67.90%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWT*FN--*MMDDSG 297
            + LWVR+EPF  G +HV P P  L++HN+ KL  Y++ KGKAGYPK+S+ +WKH+ACNKL L E   W  F    M+ DS 
Sbjct:    6 VSLWVRAEPFDCGAIHV-PLPPKLTLHNLHKLSIYSRSKGKAGYPKISFSLWKHVACNKLGLKEDQAWMYFETFDMLSDSS 85          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Planmine SMEST
Match: SMESG000036233.1 (SMESG000036233.1)

HSP 1 Score: 149.058 bits (375), Expect = 6.933e-38
Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWT*F 273
            +QLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWT F
Sbjct:    9 LQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWTLF 79          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Planmine SMEST
Match: SMESG000036233.1 (SMESG000036233.1)

HSP 1 Score: 149.058 bits (375), Expect = 9.906e-38
Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 1
Query:   61 IQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWT*F 273
            +QLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWT F
Sbjct:    9 LQLWVRSEPFTYGILHVNPHPRLLSMHNIKKLVSYAKVKGKAGYPKLSYPIWKHIACNKLQLTETLTWTLF 79          
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Planmine SMEST
Match: SMESG000026165.1 (SMESG000026165.1)

HSP 1 Score: 58.9214 bits (141), Expect = 5.590e-10
Identity = 31/89 (34.83%), Postives = 46/89 (51.69%), Query Frame = 2
Query:  728 MCWFHMIKSVDNYLSILGDKGLKCAMLKDINVLQLATTEKQFNAATKLFTQKYSSNSNMKQFLKYLKTEWLVKHIGWYEAYLENDPSTN 994
            MCW+HM + V   L ++ DK L   ++ D++ LQL+  +  F+ A  LF +K+ S    ++   Y   EWL     WYE      PSTN
Sbjct:   32 MCWYHMRERVAKKLCVIDDKDLCSEIMDDVDALQLSKNKPIFDMAVNLFLKKWKS----QERFDYFSREWLGLKSDWYEGLELYVPSTN 116          
The following BLAST results are available for this feature:
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TBCCD12.042e-1243.66TBCC domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
TBCCD17.298e-1243.66TBCC domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
TBCCD17.778e-1142.47TBCC domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
TBCCD17.778e-1142.47TBCC domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tbccd11.312e-1041.89TBCC domain containing 1 [Source:NCBI gene;Acc:100... [more]
tbccd11.335e-1041.89TBCC domain containing 1 [Source:NCBI gene;Acc:100... [more]
tbccd11.335e-1041.89TBCC domain containing 1 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tbccd12.162e-1241.10TBCC domain containing 1 [Source:NCBI gene;Acc:549... [more]
tbccd17.009e-1241.10TBCC domain containing 1 [Source:NCBI gene;Acc:549... [more]
back to top
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tbccd12.017e-1342.31TBCC domain containing 1 [Source:MGI Symbol;Acc:MG... [more]
Tbccd12.403e-1242.31TBCC domain containing 1 [Source:MGI Symbol;Acc:MG... [more]
Tbccd16.144e-1242.31TBCC domain containing 1 [Source:MGI Symbol;Acc:MG... [more]
Tbccd12.256e-1142.31TBCC domain containing 1 [Source:MGI Symbol;Acc:MG... [more]
Tbccd12.256e-1142.31TBCC domain containing 1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of C-CAP/cofactor C-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1L0Z4|TBCC1_XENTR3.713e-1141.10TBCC domain-containing protein 1 OS=Xenopus tropic... [more]
sp|A4IF93|TBCC1_BOVIN6.602e-1142.31TBCC domain-containing protein 1 OS=Bos taurus OX=... [more]
sp|Q5FVR8|TBCC1_RAT1.041e-1041.98TBCC domain-containing protein 1 OS=Rattus norvegi... [more]
sp|Q08AV6|TBCC1_XENLA1.350e-1041.10TBCC domain-containing protein 1 OS=Xenopus laevis... [more]
sp|Q640P7|TBCC1_MOUSE1.578e-1042.31TBCC domain-containing protein 1 OS=Mus musculus O... [more]
back to top
BLAST of C-CAP/cofactor C-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M7PNI11.873e-3137.27Uncharacterized protein (Fragment) OS=Brachionus p... [more]
A0A2H1BTX74.893e-2470.42Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A074YZ652.804e-2373.24C-CAP/cofactor C-like domain-containing protein OS... [more]
A0A4S2LXH03.228e-2373.24C-CAP/cofactor C-like domain-containing protein OS... [more]
A0A226DW343.497e-2335.29MULE domain-containing protein OS=Folsomia candida... [more]
back to top
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tbccd13.766e-1145.71TBCC domain containing 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO305255.042e-1851.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-CAP/cofactor C-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000036233.16.933e-3897.18SMESG000036233.1[more]
SMESG000036233.19.906e-3897.18SMESG000036233.1[more]
SMESG000026165.15.590e-1034.83SMESG000026165.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012250 ID=SMED30012250|Name=C-CAP/cofactor C-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1799bp
TTTCAAATTGGTTGTTAAGTACAATAATATGATATAATTTAAAATTTTTC
ACTTTATCTAATTCAACTATGGGTGAGGTCTGAGCCATTTACTTATGGTA
TACTTCACGTAAATCCTCATCCGAGATTGCTATCAATGCATAATATCAAA
AAATTGGTTAGTTATGCCAAAGTCAAGGGTAAAGCAGGATATCCTAAATT
AAGCTATCCAATATGGAAGCATATTGCTTGCAACAAATTGCAATTGACAG
AAACCTTGACATGGACCTAATTTAATTAAATGATGGATGACAGTGGTGAA
TATCTTATATTGGATGTATACCATTCCGACTCAGATTTGCCAGAGTCTGA
AGATGGGCTGCCAGCTTTTGACACAAGAAAATCTCGAACTTGGCAAACTG
TTAACGTATTTTAAAACAGAGACCAAGTGAAAGAATGGGTGAAACAAAAT
TCAATTTGGTCTTTTGTCAGGGCCCACAATACTGATGCAGGTTGATTTGG
AACAATTTTCCAGTTCTTATTTGTGGTACAATTGACCAGTATAAATTTTT
TCATCCATTTGGAATATCTTAAATTCATGTTTGAGAGCCTACAAGCCGAT
TTAGAAGCCACTAGTCAACTAATAATGGCTTATGATGGATCCATAGGCTT
GATTGCAGATTCTGCTGATGCCATAACAAATGAATTCAAAGCAGTTTTTT
TCTCATGAGACAAACGTCAAGCGTCGCATGTGCTGGTTTCACATGATAAA
ATCAGTTGACAATTACTTGTCGATTCTTGGAGATAAAGGCCTAAAATGTG
CCATGCTGAAAGATATAAATGTTTTGCAGTTAGCCACAACTGAGAAACAA
TTCAACGCGGCCACCAAACTATTTACTCAGAAATACAGTTCCAACTCCAA
CATGAAACAATTTCTCAAGTATTTAAAAACTGAATGGCTTGTCAAACACA
TTGGCTGGTATGAAGCTTATTTAGAAAATGACCCTTCCACAAACTATGAC
CTTCAATCAATCAATAGCATCCTGAAGAAAGAAGCAATTTTTCGAGTAAG
AATGCCATTGACCCAATTTCTGACAACTAAATTACGTTGTCAATAAATGG
TCAGAAAAACGAGATCCTGGCTCATTACAACACCTGATCTCAATTGGATG
ACAAAATCAATTGTTATACAGAAAAACTGTCAGTATACCAAGCAATTCTT
TATTAAGAGCAAAGAAGCAACAATGGAGTTCAATAATGCCTCAGTTAAGG
CATATTGTGATGCAACCAAAGCAGATCATTTGATGAATATCATCGCATTT
GCTTTTCAATTTGGAATGTTGTGTTTTGGGCCAATTTAGATAAAACAAAT
TGGAAGAATGCAAAATGCCCATGTCCTTTACATCAAAGAATTATATTTGC
AAAAACTTAATAGAAATTGCAACTTTGTTACCGTTCAATCTTTGGCTAAA
TTTGTTCCAATTGTTGAGAACCGAAAAAAGGTCGTCCAGCACTTACTCAT
AAAGCTTTGGAATACCAACCAGATCATGCTCCAACACAGTCGGTAACATA
GAAATTCTTCTGCAAAAATACAATCTGAAGTTGATTGCACTACTATTCAT
CCAGCAAAAATAACCTCGAGGCAGACTACCGAAGTCATCATCAAACTAAA
TTTCAATCAATCTACCATTACTATTATTAAATTAAATAATATAAAAGAAA
AAAATATCAAAAAATAGTTCACATTCAAACAAAAAATTAATAAAATTTTG
TTATTATTTCTCTATTTTATACTTTTAATTGAAAAATCCGACGAAGGGC
back to top

protein sequence of SMED30012250-orf-1

>SMED30012250-orf-1 ID=SMED30012250-orf-1|Name=SMED30012250-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=139bp
MNSKQFFSHETNVKRRMCWFHMIKSVDNYLSILGDKGLKCAMLKDINVLQ
LATTEKQFNAATKLFTQKYSSNSNMKQFLKYLKTEWLVKHIGWYEAYLEN
DPSTNYDLQSINSILKKEAIFRVRMPLTQFLTTKLRCQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002109X1 cell
Vocabulary: biological process
TermDefinition
GO:0000902cell morphogenesis