E3 ubiquitin-protein ligase RNF170

Overview
NameE3 ubiquitin-protein ligase RNF170
Smed IDSMED30012240
Length (bp)1350
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase RNF170 (SMED30012240) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase RNF170 (SMED30012240) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase RNF170 (SMED30012240) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase RNF170 (SMED30012240) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012240

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012240SMESG000068286.1 SmedASXL_004345SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012240SMESG000068286.1 SmedASXL_004345SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30012240SMESG000068288.1 SMESG000068286.1 dd_Smed_v4_802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012240SMESG000068288.1 SMESG000068286.1 dd_Smed_v4_802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012240SMESG000068288.1 SMESG000068286.1 dd_Smed_v4_802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012240SMESG000068288.1 SMESG000068286.1 dd_Smed_v4_802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012240SMESG000068288.1 SMESG000068286.1 dd_Smed_v4_802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012240SMESG000068288.1 SMESG000068286.1 dd_Smed_v4_802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012240SMESG000068288.1 SMESG000068286.1 dd_Smed_v4_802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012240SMESG000068288.1 SMESG000068286.1 dd_Smed_v4_802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012240SMESG000068288.1 SMESG000068286.1 Contig37230uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012240SMESG000068288.1 SMESG000068286.1 Contig37230newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30012240SMESG000068288.1 SMESG000068286.1 dd_Smed_v6_802_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Human
Match: RNF170 (ring finger protein 170 [Source:HGNC Symbol;Acc:HGNC:25358])

HSP 1 Score: 141.739 bits (356), Expect = 1.529e-38
Identity = 71/210 (33.81%), Postives = 116/210 (55.24%), Query Frame = 3
Query:  687 NLHSTYEIQYQEFLNQARNE-NIHSNAPNR----------CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            N+H     + QE +   R +     +AP            CP+CL    + ++T+C H+FCG C+I +    ++ G  +CP+CR  +  LL  F +D+   +S +   +   +  YNRR+SG   S++++I D PT+LR+    +   G   + FR+RII+ + G   Y++SPLD +PE LFGI GF+DD   IFL L Y++ ++R  +T
Sbjct:   47 NVHQNIHPENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDD---QSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGGLFWMFRIRIILCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVIT 253          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Human
Match: RNF170 (ring finger protein 170 [Source:HGNC Symbol;Acc:HGNC:25358])

HSP 1 Score: 141.739 bits (356), Expect = 1.529e-38
Identity = 71/210 (33.81%), Postives = 116/210 (55.24%), Query Frame = 3
Query:  687 NLHSTYEIQYQEFLNQARNE-NIHSNAPNR----------CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            N+H     + QE +   R +     +AP            CP+CL    + ++T+C H+FCG C+I +    ++ G  +CP+CR  +  LL  F +D+   +S +   +   +  YNRR+SG   S++++I D PT+LR+    +   G   + FR+RII+ + G   Y++SPLD +PE LFGI GF+DD   IFL L Y++ ++R  +T
Sbjct:   47 NVHQNIHPENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDD---QSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGGLFWMFRIRIILCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVIT 253          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Human
Match: RNF170 (ring finger protein 170 [Source:HGNC Symbol;Acc:HGNC:25358])

HSP 1 Score: 137.887 bits (346), Expect = 4.046e-38
Identity = 64/170 (37.65%), Postives = 104/170 (61.18%), Query Frame = 3
Query:  774 CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            CP+CL    + ++T+C H+FCG C+I +    ++ G  +CP+CR  +  LL  F +D+   +S +   +   +  YNRR+SG   S++++I D PT+LR+    +   G   + FR+RII+ + G   Y++SPLD +PE LFGI GF+DD   IFL L Y++ ++R  +T
Sbjct:    3 CPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDD---QSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGGLFWMFRIRIILCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVIT 169          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Human
Match: HMGB2 (high mobility group box 2 [Source:HGNC Symbol;Acc:HGNC:5000])

HSP 1 Score: 69.3218 bits (168), Expect = 4.830e-13
Identity = 37/84 (44.05%), Postives = 51/84 (60.71%), Query Frame = 2
Query:   26 NKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMW--EACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKGAG 271
            N PK   +AFF F  EHR KIK E+P   +GD AK LG+MW  ++ KDK  YE++A + KE+Y K++  Y++        KG G
Sbjct:   93 NAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPG 176          

HSP 2 Score: 49.6766 bits (117), Expect = 2.768e-6
Identity = 27/74 (36.49%), Postives = 49/74 (66.22%), Query Frame = 2
Query:   20 DPNKPKGAWTAFFFFSDEHRKKIKEENPEYKV--GDVAKVLGKMWE--ACKDKSKYEEQAKRDKERYNKELEEY 229
            DPNKP+G  +++ FF    R++ K+++P+  V   + +K   + W+  + K+KSK+E+ AK DK RY++E++ Y
Sbjct:    5 DPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNY 78          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Human
Match: HMGB2 (high mobility group box 2 [Source:HGNC Symbol;Acc:HGNC:5000])

HSP 1 Score: 69.3218 bits (168), Expect = 4.830e-13
Identity = 37/84 (44.05%), Postives = 51/84 (60.71%), Query Frame = 2
Query:   26 NKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMW--EACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKGAG 271
            N PK   +AFF F  EHR KIK E+P   +GD AK LG+MW  ++ KDK  YE++A + KE+Y K++  Y++        KG G
Sbjct:   93 NAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPG 176          

HSP 2 Score: 49.6766 bits (117), Expect = 2.768e-6
Identity = 27/74 (36.49%), Postives = 49/74 (66.22%), Query Frame = 2
Query:   20 DPNKPKGAWTAFFFFSDEHRKKIKEENPEYKV--GDVAKVLGKMWE--ACKDKSKYEEQAKRDKERYNKELEEY 229
            DPNKP+G  +++ FF    R++ K+++P+  V   + +K   + W+  + K+KSK+E+ AK DK RY++E++ Y
Sbjct:    5 DPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNY 78          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Celegans
Match: Y38F1A.2 (pep chromosome:WBcel235:II:12954962:12958018:1 gene:WBGene00012606.1 transcript:Y38F1A.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y38F1A.2)

HSP 1 Score: 88.1965 bits (217), Expect = 1.981e-19
Identity = 55/175 (31.43%), Postives = 91/175 (52.00%), Query Frame = 3
Query:  711 QYQEFLNQAR-NENIHSNAPNRCPVCLEGCKYSIKTSCSHMFCGQCLIG-WSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKY--YNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQGD-FNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDD 1220
            +  + + Q R +E +H ++ + CP+CL    + + T C H+FC +C+I  W  +        C +CR+    LL        TSE T+     N ++   YNRR+S ++  V+D IRD P ++   I      D F   +++RI  V   ++ Y L P D++PE ++GI GF+DD
Sbjct:   84 ERNQIITQRRISEALHQSS-HECPICLANASFPVLTDCGHIFCCECIIQYWQQSKAIVTPCDCAMCRSTFYMLLPVHWPTMGTSEETDDHIQENNIRIDDYNRRFS-INRPVLDYIRDIPILIPYLIRNFFNNDIFTLVYQVRIGFVFICVITYFLLPSDMVPESIYGIIGFLDD 256          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 73.9442 bits (180), Expect = 9.581e-15
Identity = 37/79 (46.84%), Postives = 56/79 (70.89%), Query Frame = 2
Query:    5 KRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSK--YEEQAKRDKERYNKELEEYKS 235
            KR  KDP+ PK A +AFFF+S + R +I+  +P++KVG VA+ LGKMW+    ++K  YE++A+ DK+RY  E+  YK+
Sbjct:  126 KRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 204          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 73.9442 bits (180), Expect = 9.581e-15
Identity = 37/79 (46.84%), Postives = 56/79 (70.89%), Query Frame = 2
Query:    5 KRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSK--YEEQAKRDKERYNKELEEYKS 235
            KR  KDP+ PK A +AFFF+S + R +I+  +P++KVG VA+ LGKMW+    ++K  YE++A+ DK+RY  E+  YK+
Sbjct:  126 KRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 204          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 73.9442 bits (180), Expect = 9.699e-15
Identity = 37/79 (46.84%), Postives = 56/79 (70.89%), Query Frame = 2
Query:    5 KRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSK--YEEQAKRDKERYNKELEEYKS 235
            KR  KDP+ PK A +AFFF+S + R +I+  +P++KVG VA+ LGKMW+    ++K  YE++A+ DK+RY  E+  YK+
Sbjct:  125 KRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 203          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Celegans
Match: hmg-1.2 (High mobility group protein 1.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09390])

HSP 1 Score: 73.559 bits (179), Expect = 1.020e-14
Identity = 37/79 (46.84%), Postives = 56/79 (70.89%), Query Frame = 2
Query:    5 KRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSK--YEEQAKRDKERYNKELEEYKS 235
            KR  KDP+ PK A +AFFF+S + R +I+  +P++KVG VA+ LGKMW+    ++K  YE++A+ DK+RY  E+  YK+
Sbjct:  124 KRAKKDPHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKDMYEQKAQADKDRYADEMRNYKA 202          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089259)

HSP 1 Score: 81.6481 bits (200), Expect = 1.477e-16
Identity = 39/84 (46.43%), Postives = 58/84 (69.05%), Query Frame = 2
Query:    5 KRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEAC--KDKSKYEEQAKRDKERYNKELEEYKSGTPVS 250
            +++IKDPN PK + +AFF+F ++ R K+K  NPE+ VGD+AK LG+ W     + K KYE  A+RDK RY +E+ EYK+   ++
Sbjct:  254 RKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIA 337          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089260)

HSP 1 Score: 81.6481 bits (200), Expect = 1.477e-16
Identity = 39/84 (46.43%), Postives = 58/84 (69.05%), Query Frame = 2
Query:    5 KRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEAC--KDKSKYEEQAKRDKERYNKELEEYKSGTPVS 250
            +++IKDPN PK + +AFF+F ++ R K+K  NPE+ VGD+AK LG+ W     + K KYE  A+RDK RY +E+ EYK+   ++
Sbjct:  254 RKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIA 337          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089261)

HSP 1 Score: 81.6481 bits (200), Expect = 1.477e-16
Identity = 39/84 (46.43%), Postives = 58/84 (69.05%), Query Frame = 2
Query:    5 KRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEAC--KDKSKYEEQAKRDKERYNKELEEYKSGTPVS 250
            +++IKDPN PK + +AFF+F ++ R K+K  NPE+ VGD+AK LG+ W     + K KYE  A+RDK RY +E+ EYK+   ++
Sbjct:  254 RKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIA 337          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0089262)

HSP 1 Score: 81.6481 bits (200), Expect = 1.487e-16
Identity = 39/84 (46.43%), Postives = 58/84 (69.05%), Query Frame = 2
Query:    5 KRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEAC--KDKSKYEEQAKRDKERYNKELEEYKSGTPVS 250
            +++IKDPN PK + +AFF+F ++ R K+K  NPE+ VGD+AK LG+ W     + K KYE  A+RDK RY +E+ EYK+   ++
Sbjct:  255 RKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIA 338          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Fly
Match: Dsp1 (gene:FBgn0278608 transcript:FBtr0339766)

HSP 1 Score: 81.6481 bits (200), Expect = 1.487e-16
Identity = 39/84 (46.43%), Postives = 58/84 (69.05%), Query Frame = 2
Query:    5 KRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEAC--KDKSKYEEQAKRDKERYNKELEEYKSGTPVS 250
            +++IKDPN PK + +AFF+F ++ R K+K  NPE+ VGD+AK LG+ W     + K KYE  A+RDK RY +E+ EYK+   ++
Sbjct:  255 RKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIA 338          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Zebrafish
Match: rnf170 (ring finger protein 170 [Source:NCBI gene;Acc:406612])

HSP 1 Score: 132.494 bits (332), Expect = 3.402e-35
Identity = 64/213 (30.05%), Postives = 116/213 (54.46%), Query Frame = 3
Query:  675 NSSYNLHSTYEIQYQEFLNQARNENIHSNAPNR------CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSEST----EKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            +    +H   + + +    Q + E + S + ++      CPVCL+     ++T+C H+FCG C+I +     + G  +CP+CR ++  L   F   E ++ +     E + +   +  YNRR+SG   S++D++RD PT+LR+    +   G   + FR+RI++ + G + Y++SPLD LPE + G+ GF+DD   I L   Y++ ++R  +T
Sbjct:   49 SEQQRIHPESQERVRVVREQLQAEQVSSESRHQFYSDMSCPVCLQQAVLPVETNCGHLFCGSCIIAYWRYGTWLGAISCPICRQMVTLLFPLFQDSEQSAVAADSLVEPTLILTDISDYNRRFSGQPRSLLDRLRDVPTLLRHAFREMFSVGGLFWMFRVRILLCVCGALAYLVSPLDFLPEGVLGLLGFLDDFFVILLLFIYISIMYREVVT 261          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Zebrafish
Match: rnf170 (ring finger protein 170 [Source:NCBI gene;Acc:406612])

HSP 1 Score: 132.494 bits (332), Expect = 3.402e-35
Identity = 64/213 (30.05%), Postives = 116/213 (54.46%), Query Frame = 3
Query:  675 NSSYNLHSTYEIQYQEFLNQARNENIHSNAPNR------CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSEST----EKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            +    +H   + + +    Q + E + S + ++      CPVCL+     ++T+C H+FCG C+I +     + G  +CP+CR ++  L   F   E ++ +     E + +   +  YNRR+SG   S++D++RD PT+LR+    +   G   + FR+RI++ + G + Y++SPLD LPE + G+ GF+DD   I L   Y++ ++R  +T
Sbjct:   49 SEQQRIHPESQERVRVVREQLQAEQVSSESRHQFYSDMSCPVCLQQAVLPVETNCGHLFCGSCIIAYWRYGTWLGAISCPICRQMVTLLFPLFQDSEQSAVAADSLVEPTLILTDISDYNRRFSGQPRSLLDRLRDVPTLLRHAFREMFSVGGLFWMFRVRILLCVCGALAYLVSPLDFLPEGVLGLLGFLDDFFVILLLFIYISIMYREVVT 261          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Zebrafish
Match: si:dkey-183n20.15 (si:dkey-183n20.15 [Source:ZFIN;Acc:ZDB-GENE-041001-160])

HSP 1 Score: 85.8853 bits (211), Expect = 8.773e-19
Identity = 55/201 (27.36%), Postives = 91/201 (45.27%), Query Frame = 3
Query:  651 LISLINRFNSSYNLHSTYEIQYQEFLNQARNENIHSNAPNRCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFP---TILRNGIWRIIQGDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTL 1244
            L+  I      +N H        +    A + ++H      CPVCL+   Y ++T+C H+FC  CLI +    ++    +CP+CR  +K +   F++++   +  E   V   V+ YN+RYSG    V D + D P    +L  G+  +  G   + F +R+ +   G  +     L  LP  L    G +DD   +FL L
Sbjct:   13 LLPKIRSQGCPHNAHVNNREDLPKMWLPAGSRDVH------CPVCLQMATYPVETNCGHLFCAPCLISYWKHCSWLDAISCPLCRQTVKKMCHLFSENKTDCKERE---VLRHVRDYNKRYSGAPRQVKDYLCDAPLFLLVLVRGLGNM--GGLVWLFLLRVAVCGFGAAMS----LAALPGPLSSALGILDDFVVVFLLL 198          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Zebrafish
Match: si:dkey-183n20.15 (si:dkey-183n20.15 [Source:ZFIN;Acc:ZDB-GENE-041001-160])

HSP 1 Score: 85.8853 bits (211), Expect = 8.773e-19
Identity = 55/201 (27.36%), Postives = 91/201 (45.27%), Query Frame = 3
Query:  651 LISLINRFNSSYNLHSTYEIQYQEFLNQARNENIHSNAPNRCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFP---TILRNGIWRIIQGDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTL 1244
            L+  I      +N H        +    A + ++H      CPVCL+   Y ++T+C H+FC  CLI +    ++    +CP+CR  +K +   F++++   +  E   V   V+ YN+RYSG    V D + D P    +L  G+  +  G   + F +R+ +   G  +     L  LP  L    G +DD   +FL L
Sbjct:   13 LLPKIRSQGCPHNAHVNNREDLPKMWLPAGSRDVH------CPVCLQMATYPVETNCGHLFCAPCLISYWKHCSWLDAISCPLCRQTVKKMCHLFSENKTDCKERE---VLRHVRDYNKRYSGAPRQVKDYLCDAPLFLLVLVRGLGNM--GGLVWLFLLRVAVCGFGAAMS----LAALPGPLSSALGILDDFVVVFLLL 198          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Zebrafish
Match: hmgb2b (high mobility group box 2b [Source:ZFIN;Acc:ZDB-GENE-040912-122])

HSP 1 Score: 74.7146 bits (182), Expect = 5.497e-15
Identity = 36/88 (40.91%), Postives = 59/88 (67.05%), Query Frame = 2
Query:    8 RKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMW--EACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKG 265
            RK KDPN PK   +AFF F  E+R  +K E+P   +G++AK LG++W  ++ KD++ +E++A + +E+Y KE+  Y++G   SK+  G
Sbjct:   89 RKKKDPNAPKRPPSAFFVFCSEYRPTVKSEHPNLTIGEIAKKLGELWSKQSSKDRAPFEQKAGKLREKYEKEVAAYRAGGGASKRGPG 176          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Xenopus
Match: pcmtd2 (protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 2 [Source:Xenbase;Acc:XB-GENE-947888])

HSP 1 Score: 142.124 bits (357), Expect = 1.109e-38
Identity = 70/213 (32.86%), Postives = 118/213 (55.40%), Query Frame = 3
Query:  675 NSSYNLHSTYEIQYQEFLNQARNENIHSNAPN-------RCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKY---YNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            N   N+H   + + +    Q +NE      P         CPVCL+   + ++T+C H+FCG C+I +    ++ G   CP+CR  +  +   F       ++TE+ D  N ++    YNRR+SG   S++D+I D PT+LR+    +   G   + FR+RI++ + G + Y++SPLDI+PE +FG+ GF+DD   +FL L Y++ ++R  +T
Sbjct:   47 NDEQNIHPENQDRVRAVREQLQNEQETPPPPRPQFYSDMTCPVCLQQATFPVETNCGHLFCGSCIIAYWRYGSWLGAINCPICRQTVTLIFPLF-------QATEQEDSQNILREAIGYNRRFSGQPRSLMDRIMDLPTLLRHAFREMFSVGGLFWMFRIRIVLCLLGALFYLVSPLDIIPEAVFGLLGFLDDFFVLFLLLIYISIMYREVVT 252          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Xenopus
Match: ENSXETT00000034170.1 (uncharacterized loc100145035 [Source:NCBI gene;Acc:100145035])

HSP 1 Score: 113.62 bits (283), Expect = 2.173e-28
Identity = 62/208 (29.81%), Postives = 110/208 (52.88%), Query Frame = 3
Query:  669 RFNSSYNLHSTYEIQYQEFLNQARNENI------HSNAPNRCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRI-IQGDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRR 1271
            RF+  Y L        QE L+   N++       H +    CPVCL+     ++T+C H+FCG CL+ +     + G  +CP+CR  +  L   F +++    S    D+ + +++YN R+SG    V D + D P++L  G+ RI   G   + F +RI++ + G+V+   +P D++P+ + GI   +DD+  +FL LS +  +F++
Sbjct:   13 RFSCGYKLDMNSPKPEQEKLSLTNNKDSYKCRQSHFDNDLNCPVCLQTATMPVETNCGHLFCGSCLMTYWKHDPWLGAMSCPLCRQKVVLLYNDFWENQADKLS---RDIVHDIRHYNNRFSGKPRPVTDYLYDMPSLLHLGLRRIFTMGGLVWVFCLRILVCLFGVVVCFSTPFDVIPDPMCGILSIIDDLVVVFLLLSCIINIFQQ 217          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Xenopus
Match: ENSXETT00000034163.1 (uncharacterized loc100145035 [Source:NCBI gene;Acc:100145035])

HSP 1 Score: 111.309 bits (277), Expect = 1.183e-27
Identity = 61/207 (29.47%), Postives = 109/207 (52.66%), Query Frame = 3
Query:  672 FNSSYNLHSTYEIQYQEFLNQARNENI------HSNAPNRCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRI-IQGDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRR 1271
            F+  Y L        QE L+   N++       H +    CPVCL+     ++T+C H+FCG CL+ +     + G  +CP+CR  +  L   F +++    S    D+ + +++YN R+SG    V D + D P++L  G+ RI   G   + F +RI++ + G+V+   +P D++P+ + GI   +DD+  +FL LS +  +F++
Sbjct:    3 FSCGYKLDMNSPKPEQEKLSLTNNKDSYKCRQSHFDNDLNCPVCLQTATMPVETNCGHLFCGSCLMTYWKHDPWLGAMSCPLCRQKVVLLYNDFWENQADKLS---RDIVHDIRHYNNRFSGKPRPVTDYLYDMPSLLHLGLRRIFTMGGLVWVFCLRILVCLFGVVVCFSTPFDVIPDPMCGILSIIDDLVVVFLLLSCIINIFQQ 206          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Xenopus
Match: hmgb2 (high mobility group box 2 [Source:NCBI gene;Acc:394499])

HSP 1 Score: 72.4034 bits (176), Expect = 4.597e-14
Identity = 36/74 (48.65%), Postives = 49/74 (66.22%), Query Frame = 2
Query:   20 DPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMW--EACKDKSKYEEQAKRDKERYNKELEEYKS 235
            DPN PK   +AFF F  EHR +IK E+P   +GD AK LG+MW  +  KDK  YE++A + KE+Y K++  YK+
Sbjct:   92 DPNAPKRPPSAFFLFCSEHRPQIKSESPGLSIGDTAKKLGEMWSEQTPKDKLPYEQKAAKLKEKYEKDVAAYKA 165          

HSP 2 Score: 47.7506 bits (112), Expect = 9.802e-6
Identity = 27/74 (36.49%), Postives = 48/74 (64.86%), Query Frame = 2
Query:   20 DPNKPKGAWTAFFFFSDEHRKKIKEENPEYKV--GDVAKVLGKMWE--ACKDKSKYEEQAKRDKERYNKELEEY 229
            DPNKP+G  +++ +F    R++ K+++P+  V   + +K   + W+  + K+KSK+EE AK DK RY +E++ Y
Sbjct:    5 DPNKPRGKMSSYAYFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEEMAKNDKVRYEREMKTY 78          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Xenopus
Match: cep170b (centrosomal protein 170B [Source:Xenbase;Acc:XB-GENE-5943417])

HSP 1 Score: 71.2478 bits (173), Expect = 1.150e-13
Identity = 38/80 (47.50%), Postives = 51/80 (63.75%), Query Frame = 2
Query:    2 NKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMW--EACKDKSKYEEQAKRDKERYNKELEEYKS 235
             K+K KDPN PK   +AFF F  E R KIK E+P   +GD+AK LG+MW   A  DK  YE +A + KE+Y K++  Y++
Sbjct:   85 TKKKFKDPNAPKRPPSAFFLFCSEFRPKIKGEHPGSTIGDIAKKLGEMWNNTATDDKLPYERKAAKLKEKYEKDVAAYRA 164          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Mouse
Match: Rnf170 (ring finger protein 170 [Source:MGI Symbol;Acc:MGI:1924983])

HSP 1 Score: 139.813 bits (351), Expect = 3.521e-38
Identity = 75/218 (34.40%), Postives = 121/218 (55.50%), Query Frame = 3
Query:  657 SLINRFNSSYNLHSTYEIQYQEFLNQARNENIHSNAPNR--------CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTE-KSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            S I R N   N+H   +   +    Q + E     AP R        CP+CL    + ++T+C H+FCG C+I +    ++ G  +CP+CR  +  LL  F +D+ + +    + DV++    YNRR+SG   S++++I D PT+LR+    +   G   + FR+RI++ + G   Y++SPLD +PE LFGI GF+DD   IFL L Y++ ++R  +T
Sbjct:   23 SWIQR-NVQQNIHPENQELVRVLREQFQTEQ-DVPAPARQQFYTEMYCPICLHQASFPVETNCGHLFCGSCIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVIRLRQDVND----YNRRFSGQPRSIMERIMDLPTLLRHAFREVFSVGGLFWMFRIRIMLCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVIT 234          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Mouse
Match: Rnf170 (ring finger protein 170 [Source:MGI Symbol;Acc:MGI:1924983])

HSP 1 Score: 139.043 bits (349), Expect = 2.149e-37
Identity = 72/212 (33.96%), Postives = 118/212 (55.66%), Query Frame = 3
Query:  675 NSSYNLHSTYEIQYQEFLNQARNENIHSNAPNR--------CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTE-KSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            N   N+H   +   +    Q + E     AP R        CP+CL    + ++T+C H+FCG C+I +    ++ G  +CP+CR  +  LL  F +D+ + +    + DV++    YNRR+SG   S++++I D PT+LR+    +   G   + FR+RI++ + G   Y++SPLD +PE LFGI GF+DD   IFL L Y++ ++R  +T
Sbjct:   75 NVQQNIHPENQELVRVLREQFQTEQ-DVPAPARQQFYTEMYCPICLHQASFPVETNCGHLFCGSCIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVIRLRQDVND----YNRRFSGQPRSIMERIMDLPTLLRHAFREVFSVGGLFWMFRIRIMLCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVIT 281          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Mouse
Match: Rnf170 (ring finger protein 170 [Source:MGI Symbol;Acc:MGI:1924983])

HSP 1 Score: 107.457 bits (267), Expect = 3.595e-26
Identity = 48/139 (34.53%), Postives = 84/139 (60.43%), Query Frame = 3
Query:  774 CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTE-KSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILP 1184
            CP+CL    + ++T+C H+FCG C+I +    ++ G  +CP+CR  +  LL  F +D+ + +    + DV++    YNRR+SG   S++++I D PT+LR+    +   G   + FR+RI++ + G   Y++SPLD +P
Sbjct:  115 CPICLHQASFPVETNCGHLFCGSCIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVIRLRQDVND----YNRRFSGQPRSIMERIMDLPTLLRHAFREVFSVGGLFWMFRIRIMLCLMGAFFYLISPLDFVP 249          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 67.0106 bits (162), Expect = 2.674e-12
Identity = 39/80 (48.75%), Postives = 53/80 (66.25%), Query Frame = 2
Query:    2 NKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMW--EACKDKSKYEEQAKRDKERYNKELEEYKS 235
             K+K KDPN PK   +AFF F  E+R KIK E+P   +GDVAK LG+MW   A  DK  YE++A + KE+Y K++  Y++
Sbjct:   99 TKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 178          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Mouse
Match: Hmgb1 (high mobility group box 1 [Source:MGI Symbol;Acc:MGI:96113])

HSP 1 Score: 66.6254 bits (161), Expect = 3.942e-12
Identity = 39/80 (48.75%), Postives = 53/80 (66.25%), Query Frame = 2
Query:    2 NKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMW--EACKDKSKYEEQAKRDKERYNKELEEYKS 235
             K+K KDPN PK   +AFF F  E+R KIK E+P   +GDVAK LG+MW   A  DK  YE++A + KE+Y K++  Y++
Sbjct:   85 TKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRA 164          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. UniProt/SwissProt
Match: sp|Q28DS3|RN170_XENTR (E3 ubiquitin-protein ligase RNF170 OS=Xenopus tropicalis OX=8364 GN=rnf170 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 5.874e-38
Identity = 70/213 (32.86%), Postives = 118/213 (55.40%), Query Frame = 3
Query:  675 NSSYNLHSTYEIQYQEFLNQARNENIHSNAPN-------RCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKY---YNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            N   N+H   + + +    Q +NE      P         CPVCL+   + ++T+C H+FCG C+I +    ++ G   CP+CR  +  +   F       ++TE+ D  N ++    YNRR+SG   S++D+I D PT+LR+    +   G   + FR+RI++ + G + Y++SPLDI+PE +FG+ GF+DD   +FL L Y++ ++R  +T
Sbjct:   47 NDEQNIHPENQDRVRAVREQLQNEQETPPPPRPQFYSDMTCPVCLQQATFPVETNCGHLFCGSCIIAYWRYGSWLGAINCPICRQTVTLIFPLF-------QATEQEDSQNILREAIGYNRRFSGQPRSLMDRIMDLPTLLRHAFREMFSVGGLFWMFRIRIVLCLLGALFYLVSPLDIIPEAVFGLLGFLDDFFVLFLLLIYISIMYREVVT 252          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. UniProt/SwissProt
Match: sp|Q96K19|RN170_HUMAN (E3 ubiquitin-protein ligase RNF170 OS=Homo sapiens OX=9606 GN=RNF170 PE=1 SV=2)

HSP 1 Score: 141.739 bits (356), Expect = 7.342e-38
Identity = 71/210 (33.81%), Postives = 116/210 (55.24%), Query Frame = 3
Query:  687 NLHSTYEIQYQEFLNQARNE-NIHSNAPNR----------CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            N+H     + QE +   R +     +AP            CP+CL    + ++T+C H+FCG C+I +    ++ G  +CP+CR  +  LL  F +D+   +S +   +   +  YNRR+SG   S++++I D PT+LR+    +   G   + FR+RII+ + G   Y++SPLD +PE LFGI GF+DD   IFL L Y++ ++R  +T
Sbjct:   47 NVHQNIHPENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDD---QSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGGLFWMFRIRIILCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVIT 253          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. UniProt/SwissProt
Match: sp|F1MK05|RN170_BOVIN (E3 ubiquitin-protein ligase RNF170 OS=Bos taurus OX=9913 GN=RNF170 PE=3 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 1.272e-36
Identity = 71/213 (33.33%), Postives = 116/213 (54.46%), Query Frame = 3
Query:  681 SYNLHSTYEIQYQEFLNQARNE-NIHSNAPNR----------CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTE-KSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            S N H     + QE +   R +     +AP            CP+CL      ++T+C H+FCG C++ +    ++ G  +CP+CR  +  LL  F +++ + +      D+S+    YNRR+SG   S++++I D PT+LR+    +   G   + FR+RII+ + G   Y++SPLD +PE LFGI GF+DD   IFL L Y++ ++R  +T
Sbjct:   46 SRNAHQNIHPENQELVRVLREQLQTEQDAPAAARQQFYTDMYCPICLHQASLPVETNCGHLFCGTCIVAYWRYGSWLGAISCPICRQTVTLLLPVFGENDQSQDVVSLHQDISD----YNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGGLFWMFRIRIILCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVIT 254          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. UniProt/SwissProt
Match: sp|Q8CBG9|RN170_MOUSE (E3 ubiquitin-protein ligase RNF170 OS=Mus musculus OX=10090 GN=Rnf170 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.503e-36
Identity = 72/212 (33.96%), Postives = 118/212 (55.66%), Query Frame = 3
Query:  675 NSSYNLHSTYEIQYQEFLNQARNENIHSNAPNR--------CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTE-KSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            N   N+H   +   +    Q + E     AP R        CP+CL    + ++T+C H+FCG C+I +    ++ G  +CP+CR  +  LL  F +D+ + +    + DV++    YNRR+SG   S++++I D PT+LR+    +   G   + FR+RI++ + G   Y++SPLD +PE LFGI GF+DD   IFL L Y++ ++R  +T
Sbjct:   75 NVQQNIHPENQELVRVLREQFQTEQ-DVPAPARQQFYTEMYCPICLHQASFPVETNCGHLFCGSCIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVIRLRQDVND----YNRRFSGQPRSIMERIMDLPTLLRHAFREVFSVGGLFWMFRIRIMLCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVIT 281          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. UniProt/SwissProt
Match: sp|Q7SZN2|RN170_DANRE (E3 ubiquitin-protein ligase RNF170 OS=Danio rerio OX=7955 GN=rnf170 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.905e-34
Identity = 64/213 (30.05%), Postives = 115/213 (53.99%), Query Frame = 3
Query:  675 NSSYNLHSTYEIQYQEFLNQARNENIHSNAPNR------CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITS----ESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            +    +H   + + +    Q + E + S + ++      CPVCL+     ++T+C H+FCG C+I +     + G  +CP+CR ++  L   F   E ++       E + +   +  YNRR+SG   S++D++RD PT+LR+    +   G   + FR+RI++ + G + Y++SPLD LPE + G+ GF+DD   I L   Y++ ++R  +T
Sbjct:   49 SEQQRIHPESQERVRVVREQLQAEQVSSESRHQFYSDMSCPVCLQQAVLPVETNCGHLFCGSCIIAYWRYGTWLGAISCPICRQMVTLLFPLFQDSEQSAVAADSPVEPTLILTDISDYNRRFSGQPRSLLDRLRDVPTLLRHAFREMFSVGGLFWMFRVRILLCVCGALAYLVSPLDFLPEGVLGLLGFLDDFFVILLLFIYISIMYREVVT 261          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. TrEMBL
Match: I1ZIJ2 (High mobility group-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 8.485e-58
Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 2
Query:    2 NKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKGAGDQVNGNH 292
            NKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKGAGDQVNGNH
Sbjct:   83 NKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKGAGDQVNGNH 179          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. TrEMBL
Match: A0A0R3UNK5 (RING-type domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS9383 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.478e-37
Identity = 70/178 (39.33%), Postives = 108/178 (60.67%), Query Frame = 3
Query:  756 SNAPNRCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSEST-EKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQGD-FNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLTT 1283
            + AP+ CP+CLEG  + I+T+C H FCG C   +    +      CPVCR  ++FL++ F  +EI +++T E+SDV + +  +NRRYSG  VS +DQ+RD P ++R G+  ++ GD  +   R+R+I++   +  YV+SPLDI PE + G FG +DD     +   Y+  LFR  L  
Sbjct:   73 ARAPDVCPICLEGITFGIETNCRHQFCGSCFCAYWQHTSPLAQPNCPVCRGQLRFLVKCFTPEEIQADATQERSDVESQIALFNRRYSGNPVSFLDQLRDLPALMRYGVRALLDGDGISCLLRLRLIVLSLFVFFYVVSPLDIFPESVVGAFGLLDDCLVCVVFFIYMAALFRGRLAA 250          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. TrEMBL
Match: A0A2C9K1H4 (RING-type domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106077814 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 6.745e-37
Identity = 75/201 (37.31%), Postives = 113/201 (56.22%), Query Frame = 3
Query:  678 SSYNLHSTYEIQYQEFLNQ---ARNENIHSNAPNRCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFR 1268
             S+N  +T   Q Q    Q    R  N  ++   +CP+CL    ++I+T+C H+FCG C+I +     + G   CP CRT +  LL  F  +E   ES E+ +V   V  YNRRYSG + ++ + ++D PT+LR+        G   + FR+RI+I++    +Y++SPLDILPE  FGI GF+DDI  I     Y++ L+R
Sbjct:   48 DSFNNVATTREQLQTEGGQRGSQRRANHANDGSLQCPICLGSAAFAIETNCGHVFCGHCMITYWEHQTWLGAVRCPSCRTQVSLLLLNFTSEEHAHESDERREVITKVNQYNRRYSGEARTIQEYLQDLPTLLRHTFHEFFSIGGLMWMFRLRIVILVIAAFVYLVSPLDILPEGAFGIIGFLDDIFIILFIAVYISVLYR 248          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. TrEMBL
Match: A0A4W3K3X3 (RING-type domain-containing protein OS=Callorhinchus milii OX=7868 GN=rnf170 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 7.498e-37
Identity = 73/214 (34.11%), Postives = 118/214 (55.14%), Query Frame = 3
Query:  675 NSSYNLHSTYEIQYQEFLNQARNENI-HSNAPNR----------CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            N   N+H   + + +E     + E + H +AP +          CPVCL+   + ++T+C H+FCG C+I +     + G   CP+CR ++  L   F  ++   +  E   +   +  YNRR+SG   S +D+I D PT+LR+    +   G   + FR+RI++ +AG + Y+ SPLD LPE LFGI GF+DD+  IFL L Y++ ++R  +T
Sbjct:   47 NEQQNIHPENQERVRELRQHLQAEALNHQDAPAQDRQLFYTDMSCPVCLQQAAFPVETNCGHLFCGSCIIAYWRYGTWLGAVNCPICRQMVTLLFPLFPVND--QQLPESMQIIQEINNYNRRFSGQPRSWMDRIMDLPTLLRHAFTELFTIGGLFWMFRIRILLCLAGALFYLASPLDFLPEALFGILGFLDDLFVIFLLLIYISIMYREVVT 258          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. TrEMBL
Match: G3SSU1 (Ring finger protein 170 OS=Loxodonta africana OX=9785 GN=RNF170 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.991e-36
Identity = 72/211 (34.12%), Postives = 118/211 (55.92%), Query Frame = 3
Query:  675 NSSYNLHSTYEIQYQEFLNQARNENIHSNAPNR-------CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTE-KSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            N+  N+H   +   +E   Q + E   + A  +       CP+CL    + ++T+C H+FCG C+I +     + G  +CP+CR  +  LL  F  D+ T +    + D+++    YNRR+SG   S++++I D PT+LR+    +   G   + FR+RII+ + G   Y++SPLD +PE LFGI GF+DD   IFL L Y++ ++R  +T
Sbjct:   50 NAHQNIHPENQELVRELREQLQTEQDATAAARQQFYTDMYCPICLHQASFPVETNCGHLFCGTCIIAYWRYGTWLGAISCPICRQTVTLLLTVFGDDDQTQDVVRLRQDIND----YNRRFSGQPRSILERIMDLPTLLRHAFREMFSVGGLFWMFRVRIILCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVIT 256          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Cavefish
Match: rnf170 (ring finger protein 170 [Source:NCBI gene;Acc:406612])

HSP 1 Score: 122.865 bits (307), Expect = 5.621e-32
Identity = 61/170 (35.88%), Postives = 97/170 (57.06%), Query Frame = 3
Query:  774 CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            CPVCL+     ++T+C H+FCG C+I +     + G  +CP+CR + + L                 DV++    YNRR+SG   S++D++RD PT+LR+    +   G   + FR+RII+ + G + Y+ SPLD +PE LFG+ GF+DD   I L   Y++ ++R  +T
Sbjct:   85 CPVCLQQAVLPVETNCGHLFCGSCIIAYWRYGTWLGAISCPICRQMTQRLFW--------------GDVND----YNRRFSGQPRSLLDRLRDVPTLLRHAFREMFSVGGLFWMFRIRIILCLVGALTYLASPLDFIPEALFGLLGFMDDFFVILLLFIYISIMYREVVT 236          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Cavefish
Match: si:dkey-183n20.15 (E3 ubiquitin-protein ligase RNF170-like [Source:NCBI gene;Acc:103034427])

HSP 1 Score: 90.8929 bits (224), Expect = 1.291e-20
Identity = 55/188 (29.26%), Postives = 92/188 (48.94%), Query Frame = 3
Query:  696 STYEIQYQEFLNQARNENIHSNAPNR---CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRII--QGDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTL 1244
            S  + Q Q   N   +      A NR   CPVCL+   + ++T+C H+FC  CLI +    ++    +CP+CR  +  +   F +  +  + TE   V + ++ YN+RYSG    + D + D P  L   I+R +   G   + F +R+ +   G    ++SPL+ +     G  G +DD+A +FL L
Sbjct:   19 SQGQPQGQHVRNGEDSSQSCVTAANRDLHCPVCLQSSIFPVETNCGHLFCAPCLISYWKHGSWLDAISCPLCRQKVSVMSHLFGEGRLDRKQTE---VLDHIRDYNKRYSGAPRRLSDYLCDAPLFLLL-IFRTLGNMGGLVWLFLLRVAVCGFGAAASLVSPLEAVSGPFNGAVGLLDDLAVVFLLL 202          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Cavefish
Match: ENSAMXT00000044228.1 (high mobility group protein B2-like [Source:NCBI gene;Acc:103034313])

HSP 1 Score: 76.2554 bits (186), Expect = 1.477e-15
Identity = 38/88 (43.18%), Postives = 57/88 (64.77%), Query Frame = 2
Query:    8 RKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWE--ACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKG 265
            RK KDPN PK   +AFF F  EHR  +K E+P   +G++AK LG+ W   + KD+S ++++A   +E+Y KE+  Y+SG  V+K+  G
Sbjct:   88 RKKKDPNAPKRPPSAFFIFCSEHRPAVKSEHPNLTIGEIAKKLGEKWSKLSTKDRSPFDQKAVLLREKYEKEVAAYRSGGSVAKRGPG 175          

HSP 2 Score: 48.1358 bits (113), Expect = 5.729e-6
Identity = 29/76 (38.16%), Postives = 47/76 (61.84%), Query Frame = 2
Query:   14 IKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKV--GDVAKVLGKMWEAC--KDKSKYEEQAKRDKERYNKELEEY 229
            +KD NKPKG  +A+ FF    R ++K+++P   V  G  +K   + W+A    +K K+E+ AK DK RY++E++ Y
Sbjct:    2 VKDANKPKGRTSAYAFFVLSSRDELKKKSPGTSVNFGKFSKKCSEDWKALTPSEKKKFEDLAKADKARYDEEMKSY 77          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Cavefish
Match: hmgb2a (high mobility group box 2 [Source:NCBI gene;Acc:111195933])

HSP 1 Score: 72.7886 bits (177), Expect = 1.794e-14
Identity = 34/74 (45.95%), Postives = 52/74 (70.27%), Query Frame = 2
Query:   20 DPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMW--EACKDKSKYEEQAKRDKERYNKELEEYKS 235
            DPN PK   +AFF F  +HR K+K E+P   +GD+AK LG+MW  ++ KDK+ YE++A + KE+Y K++  Y++
Sbjct:   91 DPNAPKRPPSAFFVFCSDHRPKVKSEHPGISIGDIAKKLGEMWSKQSPKDKAPYEQKAMKLKEKYEKDVAAYRA 164          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Cavefish
Match: hmgb1a (high mobility group-T protein-like [Source:NCBI gene;Acc:103039534])

HSP 1 Score: 65.4698 bits (158), Expect = 5.617e-12
Identity = 38/83 (45.78%), Postives = 55/83 (66.27%), Query Frame = 2
Query:    5 KRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMW--EACKDKSKYEEQAKRDKERYNKELEEYKSGTPV 247
            K++ KDPN PK   +AFF F  E+R K+KEE P   +GDVAK LG+MW   + ++K  YE++A + KE+Y K++  Y+ G  V
Sbjct:   85 KKRFKDPNAPKRPPSAFFIFCAEYRPKVKEETPGLSIGDVAKKLGEMWNKTSAEEKQPYEKKAAKLKEKYEKDIAAYRKGKVV 167          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Sea Lamprey
Match: hmgb2b (high mobility group box 2b [Source:ZFIN;Acc:ZDB-GENE-040912-122])

HSP 1 Score: 68.1662 bits (165), Expect = 1.611e-13
Identity = 38/90 (42.22%), Postives = 56/90 (62.22%), Query Frame = 2
Query:    8 RKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMW--EACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKGAG 271
            RK KDPN PK   +AFF +  E+R K++ ENP   +G +AK LG+MW      +KS YE +  + KE+Y+K++  Y+S   V + +KGA 
Sbjct:   88 RKKKDPNAPKRPPSAFFIYCAEYRSKVRAENPGLTIGSIAKKLGEMWNNAPADEKSIYERKTAKLKEKYDKDMASYRSKGKV-ETSKGAS 176          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Sea Lamprey
Match: hmgb2a (high mobility group box 2a [Source:ZFIN;Acc:ZDB-GENE-051120-126])

HSP 1 Score: 62.3882 bits (150), Expect = 1.044e-11
Identity = 36/79 (45.57%), Postives = 52/79 (65.82%), Query Frame = 2
Query:    2 NKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEAC--KDKSKYEEQAKRDKERYNKELEEYK 232
             KRK KDPN PK   +AFF F  EHR K+K ++P   +G++AK LG+MW     + KS YE++A + KE+Y K++  Y+
Sbjct:   83 GKRKTKDPNAPKRPPSAFFVFCSEHRPKVKADHPGLGIGEIAKRLGEMWGLLTPETKSPYEKKAAKLKEKYEKDVAAYR 161          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004052.1 (pep scaffold:Pmarinus_7.0:GL476375:218436:246333:-1 gene:ENSPMAG00000003679.1 transcript:ENSPMAT00000004052.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 8.242e-6
Identity = 22/74 (29.73%), Postives = 43/74 (58.11%), Query Frame = 2
Query:   20 DPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSK--YEEQAKRDKERYNKELEEYKS 235
            DPN+P+   +A+  F  + +  IK +NP    G+V+K++  MW+   ++ K  Y+ + +  K+ Y K+L  Y++
Sbjct:  205 DPNEPQKPVSAYALFFRDTQAAIKGQNPSATFGEVSKIVASMWDGLGEEQKQAYKRRTEAAKKEYLKQLAAYRA 278          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Yeast
Match: NHP6B (High-mobility group (HMG) protein; binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to the chromosomes; functionally redundant with Nhp6Ap; required for transcriptional initiation fidelity of some tRNA genes; homologous to mammalian HMGB1 and HMGB2; NHP6B has a paralog, NHP6A, that arose from the whole genome duplication [Source:SGD;Acc:S000002157])

HSP 1 Score: 67.0106 bits (162), Expect = 2.359e-14
Identity = 32/78 (41.03%), Postives = 51/78 (65.38%), Query Frame = 2
Query:    8 RKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEA--CKDKSKYEEQAKRDKERYNKELEEYKS 235
            R+ KDPN PK   +A+ FF++E+R  ++ ENP+   G V ++LG+ W+A   ++K  YE +A+ DK+RY  E E Y +
Sbjct:   19 RRKKDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGERWKALTAEEKQPYESKAQADKKRYESEKELYNA 96          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Yeast
Match: NHP6A (High-mobility group (HMG) protein; binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to chromosomes; functionally redundant with Nhp6Bp; required for transcriptional initiation fidelity of some tRNA genes; homologous to mammalian HMGB1 and HMGB2; NHP6A has a paralog, NHP6B, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006256])

HSP 1 Score: 63.1586 bits (152), Expect = 4.486e-13
Identity = 32/74 (43.24%), Postives = 48/74 (64.86%), Query Frame = 2
Query:   20 DPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEAC--KDKSKYEEQAKRDKERYNKELEEYKS 235
            DPN PK A +A+ FF++E+R  ++ ENP+   G V K LG+ W+A   ++K  YE +A+ DK+RY  E E Y +
Sbjct:   17 DPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYNA 90          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Nematostella
Match: EDO34494 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP78])

HSP 1 Score: 102.064 bits (253), Expect = 1.317e-24
Identity = 66/211 (31.28%), Postives = 104/211 (49.29%), Query Frame = 3
Query:  639 ILHCLISLINRFNSSYNLHSTYEIQYQEF-------------LNQARNENIHSNAPN---------RCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGI 1202
            IL  ++SLI  +NS + + + + +Q ++                Q  NE     AP          +CPVC+   ++   T+C H FC  C+I +     + G   CPVCR  +  L   F+ +E +S+ + +      +  YNRR+SG+  SV++ +RD PT+LR     +   G   +  RMRII+      LY +SPLDI+PE +FGI
Sbjct:   35 ILIAIVSLI--YNSHFRMLNIHPLQAEQVRLARDWLGIGTGGTEQDNNERDEIQAPEPPRAFSNDRQCPVCITDARFLTMTNCGHEFCAPCIITYWRHGRWLGAVQCPVCRQQVNLLFANFSSEESSSDDSHQW--RGEINEYNRRFSGLPRSVMEHLRDLPTLLRQLFSELFSVGGLVWVLRMRIILCFFAAALYFISPLDIIPESVFGI 241          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Nematostella
Match: EDO41032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5L8])

HSP 1 Score: 69.707 bits (169), Expect = 1.990e-13
Identity = 33/74 (44.59%), Postives = 47/74 (63.51%), Query Frame = 2
Query:   17 KDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEAC--KDKSKYEEQAKRDKERYNKELEEYK 232
            KD N PK   T +  F +EHR+K++ ENP+    +V ++LG MW       K  + E+A++DKERY KELEEY+
Sbjct:   10 KDVNAPKAPLTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQLPTPQKQLFLEEAEKDKERYMKELEEYQ 83          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Nematostella
Match: EDO36028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJW6])

HSP 1 Score: 65.4698 bits (158), Expect = 1.392e-12
Identity = 34/83 (40.96%), Postives = 53/83 (63.86%), Query Frame = 2
Query:   20 DPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACK--DKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTK 262
            DPNKPK   +A+F F +  R  +K++NP    G ++KVLG+MW      DK++Y++ AK+DK RY  E++ +K G   +K+ K
Sbjct:   89 DPNKPKRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTDDDKTQYQDMAKKDKVRYESEMKAFKDGKLPAKQNK 171          

HSP 2 Score: 47.7506 bits (112), Expect = 1.666e-6
Identity = 24/70 (34.29%), Postives = 46/70 (65.71%), Query Frame = 2
Query:   26 NKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSK--YEEQAKRDKERYNKELEEY 229
            NKPKGA +A+ FF  + R+K++ E  ++ + D +KV  + W+   ++ K  + ++A +DKER+ +E++ Y
Sbjct:    1 NKPKGAKSAYNFFLQDQREKLQREEGKFSLADFSKVSAEKWKNMSEEEKETFVQKAGKDKERFKEEMQSY 70          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Nematostella
Match: EDO47230 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMY4])

HSP 1 Score: 64.3142 bits (155), Expect = 1.284e-11
Identity = 31/78 (39.74%), Postives = 47/78 (60.26%), Query Frame = 2
Query:    5 KRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACK--DKSKYEEQAKRDKERYNKELEEYK 232
            ++ ++D N PK   T +  F +E R+K++ E+PE    +V K+LG  W      DK +Y + A+RDKERY  ELE Y+
Sbjct:   12 RKTLRDTNAPKAPLTGYVQFLNEQREKVRSEHPELPFPEVTKILGAEWSKMSQDDKQRYLDDAERDKERYIIELENYQ 89          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Nematostella
Match: EDO39305 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAG5])

HSP 1 Score: 59.3066 bits (142), Expect = 1.439e-11
Identity = 27/66 (40.91%), Postives = 48/66 (72.73%), Query Frame = 2
Query:   32 PKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEY 229
            PK A +A+  + ++ R++IK++NP   V +V+KV G+MW+   DKSK+EE+A  +K++Y + ++EY
Sbjct:    1 PKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKWEEKAAIEKQKYVQRMKEY 66          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Medaka
Match: rnf170 (E3 ubiquitin-protein ligase RNF170 [Source:NCBI gene;Acc:101162541])

HSP 1 Score: 133.65 bits (335), Expect = 1.002e-35
Identity = 78/249 (31.33%), Postives = 133/249 (53.41%), Query Frame = 3
Query:  576 IEGIENXXXXXXXXXXXCFLYILHCLISLINRFNSSYNLHSTYEIQYQ---EFLNQARNENIHSNAPNR------CPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQ----DEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQ-GDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLT 1280
            IEG+ N +L V++L     L  L  L++L+ R     N+H   +   +   + L   ++EN  + A  +      CPVCL+     ++T+C H+FCG C++ +     + G   CP+CR ++  L   F++      +     +   +   +  YNRR+SG   S++D++RD PT+LR+    +   G   + FR+RI++ + G + Y+ SPLDILPE LFG+ GF+DD   I L   Y++ ++R  +T
Sbjct:   20 IEGVSNQVLFVVVLS----LTFLAGLLTLLCR-QDEQNIHPENQEHVRAVRQQLQTEQDENPQAEARQQFYTDMSCPVCLQQAVLPVETNCGHLFCGSCIMAYWRYGTWLGAIHCPICRQIVTLLFPLFHEHAAPQRVQDGEAQPQLILRDINDYNRRFSGQPRSLMDRLRDVPTLLRHAFREMFSVGGLFWMFRIRILLCLVGALTYLASPLDILPEALFGLLGFMDDFFVILLLFVYISIMYREVVT 263          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Medaka
Match: hmgb2a (high mobility group protein B2 [Source:NCBI gene;Acc:101157589])

HSP 1 Score: 75.0998 bits (183), Expect = 3.218e-15
Identity = 35/74 (47.30%), Postives = 52/74 (70.27%), Query Frame = 2
Query:   20 DPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMW--EACKDKSKYEEQAKRDKERYNKELEEYKS 235
            DPN PK   +AFF F  +HR KIKE+NP   +GD+AK LG++W  ++ KDK+ YE +A + KE+Y K++  Y++
Sbjct:   91 DPNAPKRPPSAFFVFCSDHRPKIKEDNPGISIGDIAKKLGELWATQSAKDKAPYEAKAAKLKEKYEKDVAAYRA 164          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Medaka
Match: si:dkey-183n20.15 (E3 ubiquitin-protein ligase RNF170 [Source:NCBI gene;Acc:101156315])

HSP 1 Score: 66.6254 bits (161), Expect = 3.887e-12
Identity = 39/138 (28.26%), Postives = 68/138 (49.28%), Query Frame = 3
Query:  771 RCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILR---NGIWRIIQGDFNFAFRMRIIIVIAGMVLYVLSPLD 1175
            +CPVCL+  ++ ++T+CSH+FC  CL+ +    ++     CP+CR  +  L   F +   +    +   V   +  YNRRYSG    + D + D P +L+    G+  +  G     F  R+ +   G V+ +  PL+
Sbjct:   53 QCPVCLQTPRFPVQTNCSHLFCAPCLLTYWRHGSWLDAINCPLCRQKVSVLCNLFYE---SQSDQQSQQVLGEITDYNRRYSGAPRKMKDYLCDVPLVLQLLARGLGAM--GGLVGLFLFRVALCCVGTVVSISVPLE 185          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Medaka
Match: hmgb1a (high mobility group-T protein [Source:NCBI gene;Acc:101165167])

HSP 1 Score: 63.5438 bits (153), Expect = 2.735e-11
Identity = 36/78 (46.15%), Postives = 52/78 (66.67%), Query Frame = 2
Query:    8 RKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMW--EACKDKSKYEEQAKRDKERYNKELEEYKS 235
            +K KDPN PK   +AFF F  E R K+K E+P   +GDVAK LG+MW   + +DK  YE++A + KE+Y K++  Y++
Sbjct:   86 KKFKDPNAPKRPPSAFFIFCSEFRPKVKGESPGLTIGDVAKRLGEMWNSTSAEDKQPYEKKAAKLKEKYGKDIAAYRA 163          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Medaka
Match: hmgb1b (high mobility group protein B1 [Source:NCBI gene;Acc:101156596])

HSP 1 Score: 59.6918 bits (143), Expect = 4.672e-10
Identity = 34/79 (43.04%), Postives = 53/79 (67.09%), Query Frame = 2
Query:    5 KRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMW--EACKDKSKYEEQAKRDKERYNKELEEYKS 235
            K++ KDPN PK   +AFF F  + R KIK E+P   +GD AK LG+MW   + ++K  YE++A + KE+Y+K++  Y++
Sbjct:   85 KKRFKDPNAPKRPPSAFFLFCADFRPKIKSESPGLSIGDTAKKLGEMWNSSSAEEKQPYEKKAAKLKEKYDKDIVAYRT 163          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Planmine SMEST
Match: SMESG000068288.1 (SMESG000068288.1)

HSP 1 Score: 448.358 bits (1152), Expect = 5.655e-159
Identity = 218/219 (99.54%), Postives = 218/219 (99.54%), Query Frame = 3
Query:  627 CFLYILHCLISLINRFNSSYNLHSTYEIQYQEFLNQARNENIHSNAPNRCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQGDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLTT 1283
            CFLYILHCLISLINRFN SYNLHSTYEIQYQEFLNQARNENIHSNAPNRCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQGDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLTT
Sbjct:    4 CFLYILHCLISLINRFNISYNLHSTYEIQYQEFLNQARNENIHSNAPNRCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQGDFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLTT 222          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Planmine SMEST
Match: SMESG000068286.1 (SMESG000068286.1)

HSP 1 Score: 198.364 bits (503), Expect = 2.360e-61
Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 2
Query:    2 NKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKGAGDQVNGNH 292
            NKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKGAGDQVNGNH
Sbjct:   83 NKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKGAGDQVNGNH 179          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Planmine SMEST
Match: SMESG000020771.1 (SMESG000020771.1)

HSP 1 Score: 123.25 bits (308), Expect = 8.104e-33
Identity = 58/87 (66.67%), Postives = 70/87 (80.46%), Query Frame = 2
Query:    5 KRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKG 265
            KR+ KDPNKPK   TAFFFFS+EHR+ +KE+NPE+KVGD+AKVLGKMW  CKDKSKYEE  K  KE+YN  + EYK+G P +KK+K 
Sbjct:   89 KREAKDPNKPKAPLTAFFFFSNEHRQTVKEKNPEFKVGDIAKVLGKMWSECKDKSKYEEMNKEAKEKYNLAMLEYKNGAPSAKKSKA 175          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Planmine SMEST
Match: SMESG000015032.1 (SMESG000015032.1)

HSP 1 Score: 123.25 bits (308), Expect = 2.760e-32
Identity = 65/198 (32.83%), Postives = 110/198 (55.56%), Query Frame = 3
Query:  687 NLHSTYEIQYQEFLNQARNENIHSNAPNRCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTVNFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSGMSVSVIDQIRDFPTILRNGIWRIIQG-DFNFAFRMRIIIVIAGMVLYVLSPLDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSL 1277
            ++     I+ Q  ++ +RNE +       CP+CL+  ++ ++T+C H FCG C   + +  NF     CP+CRT +  L++ F+ +E  + S  K  + + +  +NR YS    + I+QI D P ILR+G   ++ G   +   R+RI ++   ++ Y LSPLDI+PE  FG+ G +DDI  +   L Y+   FRR++
Sbjct:   40 SVEDVSSIRDQISVSHSRNE-VEIYDSEICPICLDNFEFKVETNCGHEFCGSCFTLYWHVGNFVRSVNCPMCRTNVNLLVKSFSPNENLTNSDNKKRIVDEINCFNRLYSDAPRTWIEQIYDIPVILRHGFRHMLDGSSISIIHRLRITVLSIIVIGYCLSPLDIIPESGFGVLGILDDILILITFLMYILVFFRRAV 236          
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Planmine SMEST
Match: SMESG000034017.1 (SMESG000034017.1)

HSP 1 Score: 97.8265 bits (242), Expect = 3.006e-23
Identity = 40/80 (50.00%), Postives = 64/80 (80.00%), Query Frame = 2
Query:   23 PNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWEACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTK 262
            P +PK AW+AFF+F DE R K+++E+P+++V +VA+ LG++WEAC D+ +YE+ A  DKERY KE+E++++G  V+ +TK
Sbjct:   87 PGQPKRAWSAFFYFCDERRPKVRKEHPDWRVAEVARELGRLWEACSDRDRYEKMATLDKERYEKEMEQFRAGNFVAGETK 166          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RNF1701.529e-3833.81ring finger protein 170 [Source:HGNC Symbol;Acc:HG... [more]
RNF1701.529e-3833.81ring finger protein 170 [Source:HGNC Symbol;Acc:HG... [more]
RNF1704.046e-3837.65ring finger protein 170 [Source:HGNC Symbol;Acc:HG... [more]
HMGB24.830e-1344.05high mobility group box 2 [Source:HGNC Symbol;Acc:... [more]
HMGB24.830e-1344.05high mobility group box 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y38F1A.21.981e-1931.43pep chromosome:WBcel235:II:12954962:12958018:1 gen... [more]
hmg-1.29.581e-1546.84High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.29.581e-1546.84High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.29.699e-1546.84High mobility group protein 1.2 [Source:UniProtKB... [more]
hmg-1.21.020e-1446.84High mobility group protein 1.2 [Source:UniProtKB... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dsp11.477e-1646.43gene:FBgn0278608 transcript:FBtr0089259[more]
Dsp11.477e-1646.43gene:FBgn0278608 transcript:FBtr0089260[more]
Dsp11.477e-1646.43gene:FBgn0278608 transcript:FBtr0089261[more]
Dsp11.487e-1646.43gene:FBgn0278608 transcript:FBtr0089262[more]
Dsp11.487e-1646.43gene:FBgn0278608 transcript:FBtr0339766[more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1703.402e-3530.05ring finger protein 170 [Source:NCBI gene;Acc:4066... [more]
rnf1703.402e-3530.05ring finger protein 170 [Source:NCBI gene;Acc:4066... [more]
si:dkey-183n20.158.773e-1927.36si:dkey-183n20.15 [Source:ZFIN;Acc:ZDB-GENE-041001... [more]
si:dkey-183n20.158.773e-1927.36si:dkey-183n20.15 [Source:ZFIN;Acc:ZDB-GENE-041001... [more]
hmgb2b5.497e-1540.91high mobility group box 2b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcmtd21.109e-3832.86protein-L-isoaspartate (D-aspartate) O-methyltrans... [more]
ENSXETT00000034170.12.173e-2829.81uncharacterized loc100145035 [Source:NCBI gene;Acc... [more]
ENSXETT00000034163.11.183e-2729.47uncharacterized loc100145035 [Source:NCBI gene;Acc... [more]
hmgb24.597e-1448.65high mobility group box 2 [Source:NCBI gene;Acc:39... [more]
cep170b1.150e-1347.50centrosomal protein 170B [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnf1703.521e-3834.40ring finger protein 170 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1702.149e-3733.96ring finger protein 170 [Source:MGI Symbol;Acc:MGI... [more]
Rnf1703.595e-2634.53ring finger protein 170 [Source:MGI Symbol;Acc:MGI... [more]
Hmgb12.674e-1248.75high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
Hmgb13.942e-1248.75high mobility group box 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF170 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28DS3|RN170_XENTR5.874e-3832.86E3 ubiquitin-protein ligase RNF170 OS=Xenopus trop... [more]
sp|Q96K19|RN170_HUMAN7.342e-3833.81E3 ubiquitin-protein ligase RNF170 OS=Homo sapiens... [more]
sp|F1MK05|RN170_BOVIN1.272e-3633.33E3 ubiquitin-protein ligase RNF170 OS=Bos taurus O... [more]
sp|Q8CBG9|RN170_MOUSE1.503e-3633.96E3 ubiquitin-protein ligase RNF170 OS=Mus musculus... [more]
sp|Q7SZN2|RN170_DANRE2.905e-3430.05E3 ubiquitin-protein ligase RNF170 OS=Danio rerio ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF170 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIJ28.485e-58100.00High mobility group-1 OS=Schmidtea mediterranea OX... [more]
A0A0R3UNK51.478e-3739.33RING-type domain-containing protein OS=Mesocestoid... [more]
A0A2C9K1H46.745e-3737.31RING-type domain-containing protein OS=Biomphalari... [more]
A0A4W3K3X37.498e-3734.11RING-type domain-containing protein OS=Callorhinch... [more]
G3SSU11.991e-3634.12Ring finger protein 170 OS=Loxodonta africana OX=9... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1705.621e-3235.88ring finger protein 170 [Source:NCBI gene;Acc:4066... [more]
si:dkey-183n20.151.291e-2029.26E3 ubiquitin-protein ligase RNF170-like [Source:NC... [more]
ENSAMXT00000044228.11.477e-1543.18high mobility group protein B2-like [Source:NCBI g... [more]
hmgb2a1.794e-1445.95high mobility group box 2 [Source:NCBI gene;Acc:11... [more]
hmgb1a5.617e-1245.78high mobility group-T protein-like [Source:NCBI ge... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hmgb2b1.611e-1342.22high mobility group box 2b [Source:ZFIN;Acc:ZDB-GE... [more]
hmgb2a1.044e-1145.57high mobility group box 2a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000004052.18.242e-629.73pep scaffold:Pmarinus_7.0:GL476375:218436:246333:-... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
NHP6B2.359e-1441.03High-mobility group (HMG) protein; binds to and re... [more]
NHP6A4.486e-1343.24High-mobility group (HMG) protein; binds to and re... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO344941.317e-2431.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410321.990e-1344.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360281.392e-1240.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472301.284e-1139.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393051.439e-1140.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1701.002e-3531.33E3 ubiquitin-protein ligase RNF170 [Source:NCBI ge... [more]
hmgb2a3.218e-1547.30high mobility group protein B2 [Source:NCBI gene;A... [more]
si:dkey-183n20.153.887e-1228.26E3 ubiquitin-protein ligase RNF170 [Source:NCBI ge... [more]
hmgb1a2.735e-1146.15high mobility group-T protein [Source:NCBI gene;Ac... [more]
hmgb1b4.672e-1043.04high mobility group protein B1 [Source:NCBI gene;A... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF170 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068288.15.655e-15999.54SMESG000068288.1[more]
SMESG000068286.12.360e-61100.00SMESG000068286.1[more]
SMESG000020771.18.104e-3366.67SMESG000020771.1[more]
SMESG000015032.12.760e-3232.83SMESG000015032.1[more]
SMESG000034017.13.006e-2350.00SMESG000034017.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012240 ID=SMED30012240|Name=E3 ubiquitin-protein ligase RNF170|organism=Schmidtea mediterranea sexual|type=transcript|length=1350bp
AAATAAAAGGAAAATTAAAGATCCAAATAAGCCAAAAGGTGCATGGACAG
CATTCTTCTTTTTTTCTGATGAACATCGCAAAAAAATTAAAGAAGAAAAT
CCAGAATATAAAGTTGGAGATGTTGCTAAAGTACTAGGTAAAATGTGGGA
AGCTTGTAAGGATAAAAGCAAATATGAAGAACAAGCAAAAAGAGATAAAG
AACGTTATAATAAAGAACTTGAAGAATACAAAAGTGGAACTCCGGTATCC
AAAAAAACAAAAGGTGCAGGTGATCAGGTCAATGGTAATCATGAAGATGA
TGATGAAGAAGATGATATCGAAGAAGATGACTAATTAACTGATTCCAGTG
TTTCATCAGATTTTATAGTGTGGTATAATCACGATTATCTGATGTTTTAT
TGTTAAGAAATGTTGCATTTATTTTATAGTGTTTTTGTATTGTAACTGTT
TATGTAATGTAAATATTTAAAAATTAAAGTAGTGTAATGTTAACATCACA
ATTATAAATAAATTTTAACGTAAGATTGTTTAAATCGTTTAGTGAAAGCG
CACATTTTTAAAATTTAAAATGTTTATTGAAGGTATTGAGAATGTTATTT
TATTAGTAATAATGTTAATGATCATATGTTTTCTATATATTTTACATTGT
TTAATATCGTTAATTAATAGATTTAATAGCAGTTACAATTTACATTCAAC
ATATGAAATACAGTACCAAGAATTTTTAAATCAGGCGAGAAATGAAAATA
TTCATAGTAATGCACCAAACAGGTGTCCTGTATGTTTAGAAGGCTGTAAA
TATTCTATTAAAACTAGCTGTAGTCATATGTTTTGTGGCCAGTGTTTGAT
TGGTTGGTCCAACACTGTAAATTTCCCTGGAGGTACCACATGTCCCGTTT
GTAGGACGTTGATAAAATTTTTGCTTCAATATTTTAATCAAGATGAAATA
ACGTCTGAGAGTACTGAAAAATCAGATGTATCAAACTTTGTCAAATATTA
TAATAGACGATATTCCGGAATGTCAGTTTCGGTGATTGATCAAATTCGTG
ATTTCCCAACTATTCTACGCAATGGAATTTGGAGAATAATTCAAGGAGAT
TTTAATTTCGCATTTCGAATGCGTATAATAATTGTCATCGCTGGAATGGT
GCTTTATGTACTATCACCTTTGGACATATTACCAGAATTTTTATTTGGAA
TTTTTGGTTTTGTTGACGATATAGCAGCTATTTTTTTAACTCTAAGCTAC
TTGAACTATTTATTTCGGCGATCTCTAACAACTTAAAATTTCCAAAAATG
TATCTGCCAAATGATTGAAATTTCGTTTGTAATATAAGTTTTGTATATTT
back to top

protein sequence of SMED30012240-orf-1

>SMED30012240-orf-1 ID=SMED30012240-orf-1|Name=SMED30012240-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
NKRKIKDPNKPKGAWTAFFFFSDEHRKKIKEENPEYKVGDVAKVLGKMWE
ACKDKSKYEEQAKRDKERYNKELEEYKSGTPVSKKTKGAGDQVNGNHEDD
DEEDDIEEDD*
back to top

protein sequence of SMED30012240-orf-2

>SMED30012240-orf-2 ID=SMED30012240-orf-2|Name=SMED30012240-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=239bp
MFIEGIENVILLVIMLMIICFLYILHCLISLINRFNSSYNLHSTYEIQYQ
EFLNQARNENIHSNAPNRCPVCLEGCKYSIKTSCSHMFCGQCLIGWSNTV
NFPGGTTCPVCRTLIKFLLQYFNQDEITSESTEKSDVSNFVKYYNRRYSG
MSVSVIDQIRDFPTILRNGIWRIIQGDFNFAFRMRIIIVIAGMVLYVLSP
LDILPEFLFGIFGFVDDIAAIFLTLSYLNYLFRRSLTT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0061630ubiquitin protein ligase activity
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR009071HMG_box_dom
IPR001841Znf_RING
IPR010652DUF1232
IPR013083Znf_RING/FYVE/PHD
IPR017907Znf_RING_CS
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 69..111
e-value: 1.7E-4
score: 30.9
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 69..112
score: 11.973
IPR010652Domain of unknown function DUF1232PFAMPF06803DUF1232coord: 187..223
e-value: 8.7E-9
score: 35.0
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 67..116
e-value: 2.1E-6
score: 27.5
NoneNo IPR availablePANTHERPTHR22894UNCHARACTERIZEDcoord: 13..236
NoneNo IPR availablePANTHERPTHR22894:SF5E3 UBIQUITIN-PROTEIN LIGASE RNF170-LIKE PROTEIN (DUF 1232)coord: 13..236
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 68..122
NoneNo IPR availableTMHMMTMhelixcoord: 182..204
NoneNo IPR availableTMHMMTMhelixcoord: 209..231
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 46..147
e-value: 2.9E-13
score: 51.2
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 84..93