Replication protein A subunit

Overview
NameReplication protein A subunit
Smed IDSMED30012234
Length (bp)1772
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Replication protein A subunit (SMED30012234) t-SNE clustered cells

Violin plots show distribution of expression levels for Replication protein A subunit (SMED30012234) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Replication protein A subunit (SMED30012234) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Replication protein A subunit (SMED30012234) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012234

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012234h1SMcG0000482 SmedASXL_008522SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30012234h1SMcG0000482 dd_Smed_v4_3342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012234h1SMcG0000482 dd_Smed_v4_3342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012234h1SMcG0000482 Contig47795uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012234h1SMcG0000482 Contig47795newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Replication protein A subunit vs. Ensembl Human
Match: RPA1 (replication protein A1 [Source:HGNC Symbol;Acc:HGNC:10289])

HSP 1 Score: 351.288 bits (900), Expect = 6.494e-113
Identity = 177/432 (40.97%), Postives = 270/432 (62.50%), Query Frame = 2
Query:  422 ANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQG----QQSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            + + PI+ + PYQ++WTI  RV+ KS I+TW+N+RG+GKLFS  L D S +I+  AFN +V +FF ++++ K Y  SKG++K AN +F   K ++E+  N E+ V   ED      +Q+DF  I ++ N   D+ +DI+GI +   D + IT ++ N+E  KR++ L+D SG  +  TLWGED  + D    PV+ +KGA V +F G+++S  ++STI+ NP +IPEA  L GW+D  G  L        +   +GG    T   T+ E+     G  +KPDYFS  A V   R++  +Y+ACP + CNKK+ID  NGLY+CEKC+TE   F +RM+LS+ I DF    W T FQE  + +LG +A  +G   EL+ K+E A   +F+ A ++ F F+++VK E++NDE+R+K TV+D K ++Y E  +R++
Sbjct:  182 SKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANP-DIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSN--TNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLG---ELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLV 607          

HSP 2 Score: 58.151 bits (139), Expect = 3.206e-8
Identity = 25/98 (25.51%), Postives = 61/98 (62.24%), Query Frame = 2
Query:   26 LTKGSLESIIN-GVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFI 313
            L++G++ +I+  G     PI +++  + + + +  PRYRL ++DG+   +  MLATQLN  ++  ++    + ++ +++VN  KD +++++L+++  +
Sbjct:    5 LSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVL 102          
BLAST of Replication protein A subunit vs. Ensembl Human
Match: RPA1 (replication protein A1 [Source:HGNC Symbol;Acc:HGNC:10289])

HSP 1 Score: 177.563 bits (449), Expect = 2.627e-50
Identity = 112/363 (30.85%), Postives = 186/363 (51.24%), Query Frame = 2
Query:  611 FFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQVPTKMGTISELVCSGNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            FF ++++ K Y  SKG++K AN +F   K ++E+  N E+ V   ED      +Q+DF  I ++ N   D+ +DI+GI +   D + IT ++ N+E  KR++ L+D SG  +  TLWGED  + D    PV+ +KGA V +F G+++S  ++STI+ NP +IPEA  L GW         F  +   L G+       +IS+L   G         +  +   ++                        LY+ +     + +        + I DF    W T FQE  + +LG +A  +G   EL+ K+E A   +F+ A ++ F F+++VK E++NDE+R+K TV+D K ++Y E  +R++
Sbjct:    1 FFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANP-DIPEAYKLRGW---------FDAEGQALDGV-------SISDLKSGG---------VGGSNTNWKT-----------------------LYEVKSENLGQGD-------KVNIADFQENQWVTCFQESAEAILGQNAAYLG---ELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLV 304          
BLAST of Replication protein A subunit vs. Ensembl Human
Match: RPA1 (replication protein A1 [Source:HGNC Symbol;Acc:HGNC:10289])

HSP 1 Score: 57.7658 bits (138), Expect = 1.505e-9
Identity = 21/80 (26.25%), Postives = 51/80 (63.75%), Query Frame = 2
Query:   77 PIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFI 313
            PI +++  + + + +  PRYRL ++DG+   +  MLATQLN  ++  ++    + ++ +++VN  KD +++++L+++  +
Sbjct:   10 PILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVL 89          
BLAST of Replication protein A subunit vs. Ensembl Human
Match: RPA1 (replication protein A1 [Source:HGNC Symbol;Acc:HGNC:10289])

HSP 1 Score: 57.3806 bits (137), Expect = 3.677e-9
Identity = 21/80 (26.25%), Postives = 51/80 (63.75%), Query Frame = 2
Query:   77 PIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFI 313
            PI +++  + + + +  PRYRL ++DG+   +  MLATQLN  ++  ++    + ++ +++VN  KD +++++L+++  +
Sbjct:   10 PILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVL 89          
BLAST of Replication protein A subunit vs. Ensembl Celegans
Match: rpa-1 (Probable replication factor A 73 kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q19537])

HSP 1 Score: 195.282 bits (495), Expect = 4.423e-54
Identity = 127/430 (29.53%), Postives = 222/430 (51.63%), Query Frame = 2
Query:  425 NITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCD-IKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWG-EDTKRL-DNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGL-QVPTKMGTISELVCSGNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIANMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEIN---YVEEIKRIM 1693
             + PI+ + PY + + I G VS+K  I+T+     + K+F+F + D++ D I+  AFN      +  +    +Y +S GSVK AN KFNNT  ++EI L ++S +    +     ++    V + EI+       ID++ + +++   +T       K  +KR++ L+D SG+ +R+TLWG E TK L D+    VI  KG I +EF G       ++T +I+   I     L  WY     T   +      GG  + P  +  + E+    +++K DY ++ A + +      +Y+ C  E C KKL+   NG Y+CEKC     +F +  ++  E+ D +G V+ TAF +    ++G SA ++G + + E  DE   +FE   +    ++L+ K +S+N+E R K+TV    ++N   Y+E +K+++
Sbjct:  222 GVMPIAMVTPYVSNFKIHGMVSRKEEIRTFPAK--NTKVFNFEITDSNGDTIRCTAFNEVAESLYTTITENLSYYLSGGSVKQANKKFNNTGHDYEITLRSDSIIEAGGELLAAPKLILKRVKLGEIAGY-AGQLIDVLVVVEKMDPEATEFTSKAGKSLIKREMELIDESGALVRLTLWGDEATKALVDDYVQKVIAFKGVIPREFNGGFSLGTGSATRIISVPEIAGVSELYDWYANVKPTTEVKMMSQAAGGSNEAPRTIAGLQEMQFGKDSDKGDYATVKAMITRVNPTNALYRGCASEGCQKKLVG-ENGDYRCEKCNKNMNKFKWLYMMQFELSDETGQVYVTAFGDSAAKIVGKSAAELGELHD-ESPDEYNAIFERLQFVPKMWRLRCKMDSYNEEVRQKMTVYGVDDVNQDKYIENLKQMI 646          
BLAST of Replication protein A subunit vs. Ensembl Celegans
Match: R03H10.6 (pep chromosome:WBcel235:II:4171294:4173875:-1 gene:WBGene00019858.1 transcript:R03H10.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R03H10.6)

HSP 1 Score: 68.9366 bits (167), Expect = 1.912e-12
Identity = 52/213 (24.41%), Postives = 98/213 (46.01%), Query Frame = 2
Query:  419 PANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCD-NSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPV-DTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDT--KRLDNLDHPVIVVKGAIVKEFFGK 1045
            PA +TPI+++N   + + I GRV+         + R   K+FSF + D N   I+  AF     + +  +   ++Y ++ G VK  +  +N T   FEI L+    +          ++  + V +  + N       ID++   +E+ D     +   NK  + R++V++D S   IR+TLWG       ++   + ++  KG +  +F G+
Sbjct:  117 PAAVTPIANLNDSVDNFKIHGRVT------LMDDKRRPEKVFSFEITDVNGYTIRCVAFGELGVRLYGSIAKDQSYYLTGGKVKNGHTLYNQTGHAFEIILDEFPTIEPAPAVLTVPKLNLNRVMLCNVQNEQYYRKPIDVIVAVEEINDFLDDYHPIENKPPVLRNMVVIDDSNFRIRLTLWGYRAMDSGVEEFQNKIVAFKGIVPTQFEGE 323          
BLAST of Replication protein A subunit vs. Ensembl Celegans
Match: R03H10.7 (pep chromosome:WBcel235:II:4177267:4178927:-1 gene:WBGene00019859.1 transcript:R03H10.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R03H10.7)

HSP 1 Score: 63.929 bits (154), Expect = 1.034e-10
Identity = 69/263 (26.24%), Postives = 120/263 (45.63%), Query Frame = 2
Query:  428 ITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCD-IKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNV--PVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGE---DTKRLDNLDHPVIVVKGAIVKEFFGKT-VSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQVPT 1195
            +TPI ++    N + I GRV+    +          K F+F + D + D I  +A + E   F+  +   ++Y ++ G +K  +  +N T  +++I LN  + +          +     V + +++NV  P+D  + I    +E  D+   T  T NK   KR + ++D S S IR T WG    D  R + L+  V+  KG I  E  G+  +S    + I+I P  +  A  L  W+D   +    +G  +T+   Q+PT
Sbjct:  114 VTPIENLKESVNYFKIHGRVT----LMDTRPPHHYQKRFNFEITDFNGDTIACSASSPEADVFYQNLVKEQSYYLAGGHIKKGHEIYNQTGIDYQIDLNNFTIMEPAPTLLTLPKFNIQRVFLSDVANVKKPIDVLVCI----KEFKDVENYT-PTENKPPHKRHIQVIDDSKSEIRATFWGYNAVDAIREEFLNK-VVAFKGVIPTEGNGQLFLSITPGTRIVIQPE-VDGAAYLEAWFDGYNA----RGAITTIS--QIPT 359          
BLAST of Replication protein A subunit vs. Ensembl Fly
Match: RpA-70 (gene:FBgn0010173 transcript:FBtr0081867)

HSP 1 Score: 330.487 bits (846), Expect = 2.548e-105
Identity = 194/587 (33.05%), Postives = 315/587 (53.66%), Query Frame = 2
Query:   26 LTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVNF--KDE--KKIIVLLDISFIDE-------------QNNITNSSSIPKLVVESXXXXXXXXXXXX---------XRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKE--YSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTIL-INPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIANMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            L+ G +  I++G  V  P+ +ILA K + S +   RYR+ ++DG   ++Y MLA+QLN    +  ++   I++LDKY+ +   KD   K+++++ +++ ++                N       PK  V S          +          + IN     PIS ++PYQN+W I+ RV+ KS I+TW+NARG+GKLFS  L D S +I+  AF  +  +F+D++Q+   Y ISK  +K AN ++++    +E+  + E+ V   ED  +    E++Y+ V I ++S +     +D +GI +EV ++ +   +TTNKE  KRD+ LVD S S+I +TLWG+D    D    PVI+VKG  + EF G         +I+ INP +IPEA  L GW+D  G         +  GG    T+  T+ +      G+ +KPDYF   A V   +++   Y+ACP   CNKK++D  N  ++CEKC      F +R+L++M I D++   W ++F E+G+ +LG+++ +VG   E +   +   +F    +    FKL+ KNE + D TR K+TV     IN+ E  K ++
Sbjct:    6 LSTGVIARIMHGEVVDAPVLQILAIKKINSAADSERYRILISDGKYFNSYAMLASQLNVMQHNGELEEFTIVQLDKYVTSLVGKDGAGKRVLIISELTVVNPGAEVKSKIGEPVTYENAAKQDLAPKPAVTSNSKPIAKKEPSHNNNNNIVMNSSINSGMTHPISSLSPYQNKWVIKARVTSKSGIRTWSNARGEGKLFSMDLMDESGEIRATAFKEQCDKFYDLIQVDSVYYISKCQLKPANKQYSSLNNAYEMTFSGETVVQLCEDTDDDPIPEIKYNLVPISDVSGMENKAAVDTIGICKEVGELQSFVARTTNKEFKKRDITLVDMSNSAISLTLWGDDAVNFDGHVQPVILVKGTRINEFNGGKSLSLGGGSIMKINP-DIPEAHKLRGWFDNGGGDSVANMVSARTGGGSFSTEWMTLKDARARNLGSGDKPDYFQCKAVVHIVKQENAFYRACPQSDCNKKVVDEGNDQFRCEKCNALFPNFKYRLLINMSIGDWTSNRWVSSFNEVGEQLLGHTSQEVGEALENDPA-KAEQIFSALNFTSHIFKLRCKNEVYGDMTRNKLTVQSVAPINHKEYNKHLL 590          
BLAST of Replication protein A subunit vs. Ensembl Zebrafish
Match: rpa1 (replication protein A1 [Source:NCBI gene;Acc:327491])

HSP 1 Score: 392.119 bits (1006), Expect = 5.259e-129
Identity = 208/593 (35.08%), Postives = 348/593 (58.68%), Query Frame = 2
Query:   26 LTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESXXXXXXXXXXXXXR-INPAN------------------------------ITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLG-GLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            L++G++ES+  G +V +PI + +  + +   +G  R+R+ ++DG+   +  ML+TQLN   + N++    +  L + + N  KD ++++V+LDI  +   + +      P   VE     P   P  T R + P N                              + PI+ +NPYQ++WTI+ RV+ KSAI+TW+N+RGDGKLFS  L D S +I+   FNNEV +FF +++ GK + ISKG++K AN +F++ K ++E+ LN E+ +   ED  +   +Q DFVSI ++ +   DT +D++G+ +   D++ I  K + +E  KR++ L+D SG  I++T+WG D +  D    P++ +KGA + +F G+++S   +ST++INP +IPEA  L GWYD+ G  L  Q      G G    T   T++E+     G+ +K DYFS  A +   R++  +Y+ACP + CNKK++D  NG+++CEKC+ E  +F +R++LS  I DF    W T FQ+  + +LG ++  +G   +L+  +E A   +F+ A +  F F+ +VK E++NDE+R+KVTV+DAK +++ E  KR++
Sbjct:    5 LSEGAIESLSKGTEVNNPILQCVNIRKIDGGNGVSRFRVMMSDGLHTMSSFMLSTQLNPMAEQNQLATNCVCVLKRSVTNVLKDGRRVVVILDIEVLKSADQMPGKIGDPTPYVEGQSKAPSTAPAPTARPLQPQNGSDGSTYRPSAQSFGKKPMAAPNTPGGSSKVVPIASLNPYQSKWTIRARVTNKSAIRTWSNSRGDGKLFSMELVDESGEIRATGFNNEVDKFFSLIEQGKVFYISKGTLKIANKQFSSLKNDYEMTLNGETSIIPCEDSNDVPMLQCDFVSIADLESREKDTILDVIGVCKNAEDVARIMTKNS-REVSKRNIQLIDMSGRVIQLTMWGSDAETFDGSGQPILAIKGARLSDFGGRSLSTLYSSTVMINP-DIPEAYKLRGWYDKEGHALDGQSMTELRGPGGGGNTNWKTLAEVKNEHLGHGDKADYFSCIATIVYIRKENCLYQACPSKDCNKKVVDQQNGMFRCEKCDKEFPDFKYRLMLSANIADFGDNQWVTCFQDTAETLLGQNSSYLG---QLKDTNEAAFDEVFQHANFNTFVFRNRVKLETYNDESRIKVTVVDAKPVDHREYSKRLI 592          
BLAST of Replication protein A subunit vs. Ensembl Xenopus
Match: rpa1 (replication protein A1 [Source:NCBI gene;Acc:548449])

HSP 1 Score: 366.311 bits (939), Expect = 3.654e-119
Identity = 190/571 (33.27%), Postives = 343/571 (60.07%), Query Frame = 2
Query:   23 VLTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQNNITNSSSIP--------KLVVESXXXXXXXXXXXXXRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQG-QQSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            VL++G++ +I+ G     P  +++  + + + +G PRYRL ++DG+   +  MLATQLN  +D+N +    I ++ +++VN  KD +++I+++++  +   + +      P        K  + +       +   T   + + + PI+ +NPYQ++WT++ RV+ K  I+TW+N+RG+GKLFS  + D S +I+  AFN +  +FF ++++ K Y  SKG++K AN ++ + K ++E+  N+E+ V   +D  +   +Q++FV I E+ +   DT +DI+GI +   +++ +T ++ N+E  KR++ L+D SG  +  TLWGED  + D    PV+ +KGA + +F G+++S  ++ST++INP +IPEA  L  W+D  G  +      +S  G     T   ++ E+     G+ EK DYF+  A +   R++  +Y+ACP + CNKK+ID  NGL++CEKC+ E   + +R++LS  I DF    W T FQE  + +LG +A  +G   EL+ K+E A   +F+ A ++ + F+++VK E++NDE+R+K T +D K +++ E  +R++
Sbjct:    5 VLSEGAISAILGGDSSCKPTLQVINIRSINTGNGPPRYRLLMSDGLNTLSSFMLATQLNFLVDNNLLATNCICQVSRFIVNNLKDGRRVIIVMEMEVLKSADLVKGKIGNPHPYNDGTKKYELGASKLFGGGSVVNTPGGSQSKVVPIASLNPYQSKWTVRARVTNKGQIRTWSNSRGEGKLFSIEMVDESGEIRATAFNEQADKFFSLIEVNKVYYFSKGTLKIANKQYTSVKNDYEMTFNSETSVIPCDDSADVPMVQFEFVPIGELESKNKDTVLDIIGICKNAEEVTKVTIRSNNREVSKRNINLMDSSGKVVSTTLWGEDADKFDGSRQPVVAIKGARLSDFGGRSLSVLSSSTVMINP-DIPEAFKLRAWFDSEGQVVEGTSISESRGGTGGGNTNWKSLLEVKTENLGHGEKADYFTSVATIVYLRKENCLYQACPSQDCNKKVIDQQNGLFRCEKCDKEFPNYKYRLILSANIADFGENQWITCFQESAESILGQNATYLG---ELKEKNEQAYDEVFQNANFRSYTFRIRVKLETYNDESRIKATAMDVKPVDHKEYSRRLI 571          
BLAST of Replication protein A subunit vs. Ensembl Xenopus
Match: rpa1 (replication protein A1 [Source:NCBI gene;Acc:548449])

HSP 1 Score: 339.347 bits (869), Expect = 1.508e-108
Identity = 186/572 (32.52%), Postives = 324/572 (56.64%), Query Frame = 2
Query:  101 KGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMV-NFKDEKKIIVLLDISFIDEQNNITNSSSIPKL---VVESXXXXXXXXXXXXXRINPANI-----------------------TP---------ISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQG-QQSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            + + + +G PRYRL ++DG+   +  MLATQLN  +D+N +    I ++ +++V N KD +++I+++++  +   + +      P                         P NI                       TP         I+ +NPYQ++WT++ RV+ K  I+TW+N+RG+GKLFS  + D S +I+  AFN +  +FF ++++ K Y  SKG++K AN ++ + K ++E+  N+E+ V   +D  +   +Q++FV I E+ +   DT +DI+GI +   +++ +T ++ N+E  KR++ L+D SG  +  TLWGED  + D    PV+ +KGA + +F G+++S  ++ST++INP +IPEA  L  W+D  G  +      +S  G     T   ++ E+     G+ EK DYF+  A +   R++  +Y+ACP + CNKK+ID  NGL++CEKC+ E   + +R++LS  I DF    W T FQE  + +LG +A  +G   EL+ K+E A   +F+ A ++ + F+++VK E++NDE+R+K T +D K +++ E  +R++
Sbjct:   15 RSINTGNGPPRYRLLMSDGLNTLSSFMLATQLNFLVDNNLLATNCICQVSRFIVNNLKDGRRVIIVMEMEVLKSADLVKGKIGNPHPYNDGQGPPQPAAPAPASAPPPSKPQNISAPPPPSMNRGASKLFGGGSVVNTPGGSQSKVVPIASLNPYQSKWTVRARVTNKGQIRTWSNSRGEGKLFSIEMVDESGEIRATAFNEQADKFFSLIEVNKVYYFSKGTLKIANKQYTSVKNDYEMTFNSETSVIPCDDSADVPMVQFEFVPIGELESKNKDTVLDIIGICKNAEEVTKVTIRSNNREVSKRNINLMDSSGKVVSTTLWGEDADKFDGSRQPVVAIKGARLSDFGGRSLSVLSSSTVMINP-DIPEAFKLRAWFDSEGQVVEGTSISESRGGTGGGNTNWKSLLEVKTENLGHGEKADYFTSVATIVYLRKENCLYQACPSQDCNKKVIDQQNGLFRCEKCDKEFPNYKYRLILSANIADFGENQWITCFQESAESILGQNATYLG---ELKEKNEQAYDEVFQNANFRSYTFRIRVKLETYNDESRIKATAMDVKPVDHKEYSRRLI 582          
BLAST of Replication protein A subunit vs. Ensembl Xenopus
Match: rpa1 (replication protein A1 [Source:NCBI gene;Acc:548449])

HSP 1 Score: 333.183 bits (853), Expect = 1.595e-106
Identity = 179/532 (33.65%), Postives = 314/532 (59.02%), Query Frame = 2
Query:  170 TYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQ-------------NNITNSSSIPKLVVESXXXXXXXXXXXXXRINP-----ANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQG-QQSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            T  MLATQLN  +D+N +    I ++ +++VN  KD +++I+++++  +                N+ T+S+  P                  + +N      + + PI+ +NPYQ++WT++ RV+ K  I+TW+N+RG+GKLFS  + D S +I+  AFN +  +FF ++++ K Y  SKG++K AN ++ + K ++E+  N+E+ V   +D  +   +Q++FV I E+ +   DT +DI+GI +   +++ +T ++ N+E  KR++ L+D SG  +  TLWGED  + D    PV+ +KGA + +F G+++S  ++ST++INP +IPEA  L  W+D  G  +      +S  G     T   ++ E+     G+ EK DYF+  A +   R++  +Y+ACP + CNKK+ID  NGL++CEKC+ E   + +R++LS  I DF    W T FQE  + +LG +A  +G   EL+ K+E A   +F+ A ++ + F+++VK E++NDE+R+K T +D K +++ E  +R++
Sbjct:   26 TAFMLATQLNFLVDNNLLATNCICQVSRFIVNNLKDGRRVIIVMEMEVLKSADLVKGKIGNPHPYNDGTSSAPPPSKPQNISGKGASKLFGGGSVVNTPGGSQSKVVPIASLNPYQSKWTVRARVTNKGQIRTWSNSRGEGKLFSIEMVDESGEIRATAFNEQADKFFSLIEVNKVYYFSKGTLKIANKQYTSVKNDYEMTFNSETSVIPCDDSADVPMVQFEFVPIGELESKNKDTVLDIIGICKNAEEVTKVTIRSNNREVSKRNINLMDSSGKVVSTTLWGEDADKFDGSRQPVVAIKGARLSDFGGRSLSVLSSSTVMINP-DIPEAFKLRAWFDSEGQVVEGTSISESRGGTGGGNTNWKSLLEVKTENLGHGEKADYFTSVATIVYLRKENCLYQACPSQDCNKKVIDQQNGLFRCEKCDKEFPNYKYRLILSANIADFGENQWITCFQESAESILGQNATYLG---ELKEKNEQAYDEVFQNANFRSYTFRIRVKLETYNDESRIKATAMDVKPVDHKEYSRRLI 553          
BLAST of Replication protein A subunit vs. Ensembl Xenopus
Match: rpa1 (replication protein A1 [Source:NCBI gene;Acc:548449])

HSP 1 Score: 328.561 bits (841), Expect = 1.760e-104
Identity = 176/535 (32.90%), Postives = 313/535 (58.50%), Query Frame = 2
Query:  170 TYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQNNITN---------------------SSSIPKLVVESXXXXXXXXXXXXXRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQG-QQSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            T  MLATQLN  +D+N +    I ++ +++VN  KD +++I+++++  +   + +                       +   P +   +       +   T   + + + PI+ +NPYQ++WT++ RV+ K  I+TW+N+RG+GKLFS  + D S +I+  AFN +  +FF ++++ K Y  SKG++K AN ++ + K ++E+  N+E+ V   +D  +   +Q++FV I E+ +   DT +DI+GI +   +++ +T ++ N+E  KR++ L+D SG  +  TLWGED  + D    PV+ +KGA + +F G+++S  ++ST++INP +IPEA  L  W+D  G  +      +S  G     T   ++ E+     G+ EK DYF+  A +   R++  +Y+ACP + CNKK+ID  NGL++CEKC+ E   + +R++LS  I DF    W T FQE  + +LG +A  +G   EL+ K+E A   +F+ A ++ + F+++VK E++NDE+R+K T +D K +++ E  +R++
Sbjct:   50 TAFMLATQLNFLVDNNLLATNCICQVSRFIVNNLKDGRRVIIVMEMEVLKSADLVKGKIGNPHPYNDGTLLWIFFLPTAPPPPSMNRGASKLFGGGSVVNTPGGSQSKVVPIASLNPYQSKWTVRARVTNKGQIRTWSNSRGEGKLFSIEMVDESGEIRATAFNEQADKFFSLIEVNKVYYFSKGTLKIANKQYTSVKNDYEMTFNSETSVIPCDDSADVPMVQFEFVPIGELESKNKDTVLDIIGICKNAEEVTKVTIRSNNREVSKRNINLMDSSGKVVSTTLWGEDADKFDGSRQPVVAIKGARLSDFGGRSLSVLSSSTVMINP-DIPEAFKLRAWFDSEGQVVEGTSISESRGGTGGGNTNWKSLLEVKTENLGHGEKADYFTSVATIVYLRKENCLYQACPSQDCNKKVIDQQNGLFRCEKCDKEFPNYKYRLILSANIADFGENQWITCFQESAESILGQNATYLG---ELKEKNEQAYDEVFQNANFRSYTFRIRVKLETYNDESRIKATAMDVKPVDHKEYSRRLI 580          
BLAST of Replication protein A subunit vs. Ensembl Xenopus
Match: rpa1 (replication protein A1 [Source:NCBI gene;Acc:548449])

HSP 1 Score: 318.546 bits (815), Expect = 3.084e-100
Identity = 158/429 (36.83%), Postives = 271/429 (63.17%), Query Frame = 2
Query:  422 ANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQG-QQSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            + + PI+ +NPYQ++WT++ RV+ K  I+TW+N+RG+GKLFS  + D S +I+  AFN +  +FF ++++ K Y  SKG++K AN ++ + K ++E+  N+E+ V   +D  +   +Q++FV I E+ +   DT +DI+GI +   +++ +T ++ N+E  KR++ L+D SG  +  TLWGED  + D    PV+ +KGA + +F G+++S  ++ST++INP +IPEA  L  W+D  G  +      +S  G     T   ++ E+     G+ EK DYF+  A +   R++  +Y+ACP + CNKK+ID  NGL++CEKC+ E   + +R++LS  I DF    W T FQE  + +LG +A  +G   EL+ K+E A   +F+ A ++ + F+++VK E++NDE+R+K T +D K +++ E  +R++
Sbjct:  184 SKVVPIASLNPYQSKWTVRARVTNKGQIRTWSNSRGEGKLFSIEMVDESGEIRATAFNEQADKFFSLIEVNKVYYFSKGTLKIANKQYTSVKNDYEMTFNSETSVIPCDDSADVPMVQFEFVPIGELESKNKDTVLDIIGICKNAEEVTKVTIRSNNREVSKRNINLMDSSGKVVSTTLWGEDADKFDGSRQPVVAIKGARLSDFGGRSLSVLSSSTVMINP-DIPEAFKLRAWFDSEGQVVEGTSISESRGGTGGGNTNWKSLLEVKTENLGHGEKADYFTSVATIVYLRKENCLYQACPSQDCNKKVIDQQNGLFRCEKCDKEFPNYKYRLILSANIADFGENQWITCFQESAESILGQNATYLG---ELKEKNEQAYDEVFQNANFRSYTFRIRVKLETYNDESRIKATAMDVKPVDHKEYSRRLI 608          

HSP 2 Score: 62.3882 bits (150), Expect = 1.410e-9
Identity = 30/104 (28.85%), Postives = 61/104 (58.65%), Query Frame = 2
Query:   23 VLTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMV-NFKDEKKIIVLLDISFIDEQNNI 331
            VL++G++ +I+ G     P  +++  + + + +G PRYRL ++DG+   +  MLATQLN  +D+N +    I ++ +++V N KD +  +      F+ +++ I
Sbjct:    5 VLSEGAISAILGGDSSCKPTLQVINIRSINTGNGPPRYRLLMSDGLNTLSSFMLATQLNFLVDNNLLATNCICQVSRFIVNNLKDGRHFVSYGQQDFLKDEHLI 108          
BLAST of Replication protein A subunit vs. Ensembl Mouse
Match: Rpa1 (replication protein A1 [Source:MGI Symbol;Acc:MGI:1915525])

HSP 1 Score: 332.028 bits (850), Expect = 1.548e-105
Identity = 173/432 (40.05%), Postives = 267/432 (61.81%), Query Frame = 2
Query:  422 ANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTL---SFQGQQSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIMS 1696
            + + PI+ + PYQ++WTI  RV+ KS I+TW+N+RG+GKLFS  L D S +I+  AFN +V +FF ++++ K Y  SKG++K AN +F+  K ++E+  N E+ V   ED      +Q+DF  I ++ +   D  +DI+GI +   D   IT K+ N+E  KR++ L+D SG  +  TLWGED  + D    PV+ +KGA V +F G+++S  ++ST+++NP +IPEA  L GW+D  G  L   S    +S  G     T   T+ E      G  +K DYFS  AAV   R++  +Y+ACP + CNKK+ID  NGLY+CEKC+ E   F +RM+LS  I DF    W T FQE  + +LG +   +G   EL+ K+E A   +F+ A ++ F F+++VK E++NDE+R+K TV+D K +++ +  +R+++
Sbjct:  191 SKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGALKIANKQFSAVKNDYEMTFNNETSVLPCEDGHHLPTVQFDFTGIGDLESKAKDALVDIIGICKSYEDSIKITVKSNNREVAKRNIYLMDMSGKVVTTTLWGEDADKFDGSRQPVMAIKGARVSDFGGRSLSVLSSSTVIVNP-DIPEAYKLRGWFDSEGQALDGVSISDHRSG-GAGGGNTNWKTLHEAKSENLGQGDKADYFSTVAAVVFLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDREFPNFKYRMILSANIADFQENQWVTCFQESAEAILGQNTMYLG---ELKEKNEQAFEEVFQNANFRSFTFRIRVKLETYNDESRIKATVMDVKPVDFRDYGRRLIA 617          

HSP 2 Score: 62.003 bits (149), Expect = 1.308e-9
Identity = 29/104 (27.88%), Postives = 63/104 (60.58%), Query Frame = 2
Query:   26 LTKGSLESIINGVQVP-DPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQNNI 331
            L++G++E +I        PI +++  + +++ +  PRYRL ++DG+   +  MLATQLN  ++  ++    + ++ K++VN  KD +K++VL+D+  +    ++
Sbjct:    5 LSEGAIEVMIQQENTSIKPILQVINIRPISTGNRSPRYRLLMSDGLNTLSSFMLATQLNTLVEGGQLASNCVCQVHKFIVNTLKDGRKVVVLMDLEVMKSAEDV 108          
BLAST of Replication protein A subunit vs. Ensembl Mouse
Match: Rpa1 (replication protein A1 [Source:MGI Symbol;Acc:MGI:1915525])

HSP 1 Score: 332.413 bits (851), Expect = 2.159e-105
Identity = 173/432 (40.05%), Postives = 267/432 (61.81%), Query Frame = 2
Query:  422 ANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTL---SFQGQQSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIMS 1696
            + + PI+ + PYQ++WTI  RV+ KS I+TW+N+RG+GKLFS  L D S +I+  AFN +V +FF ++++ K Y  SKG++K AN +F+  K ++E+  N E+ V   ED      +Q+DF  I ++ +   D  +DI+GI +   D   IT K+ N+E  KR++ L+D SG  +  TLWGED  + D    PV+ +KGA V +F G+++S  ++ST+++NP +IPEA  L GW+D  G  L   S    +S  G     T   T+ E      G  +K DYFS  AAV   R++  +Y+ACP + CNKK+ID  NGLY+CEKC+ E   F +RM+LS  I DF    W T FQE  + +LG +   +G   EL+ K+E A   +F+ A ++ F F+++VK E++NDE+R+K TV+D K +++ +  +R+++
Sbjct:  212 SKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGALKIANKQFSAVKNDYEMTFNNETSVLPCEDGHHLPTVQFDFTGIGDLESKAKDALVDIIGICKSYEDSIKITVKSNNREVAKRNIYLMDMSGKVVTTTLWGEDADKFDGSRQPVMAIKGARVSDFGGRSLSVLSSSTVIVNP-DIPEAYKLRGWFDSEGQALDGVSISDHRSG-GAGGGNTNWKTLHEAKSENLGQGDKADYFSTVAAVVFLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDREFPNFKYRMILSANIADFQENQWVTCFQESAEAILGQNTMYLG---ELKEKNEQAFEEVFQNANFRSFTFRIRVKLETYNDESRIKATVMDVKPVDFRDYGRRLIA 638          

HSP 2 Score: 50.447 bits (119), Expect = 6.358e-6
Identity = 23/81 (28.40%), Postives = 49/81 (60.49%), Query Frame = 2
Query:   26 LTKGSLESIINGVQVP-DPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN 265
            L++G++E +I        PI +++  + +++ +  PRYRL ++DG+   +  MLATQLN  ++  ++    + ++ K++VN
Sbjct:    5 LSEGAIEVMIQQENTSIKPILQVINIRPISTGNRSPRYRLLMSDGLNTLSSFMLATQLNTLVEGGQLASNCVCQVHKFIVN 85          
BLAST of Replication protein A subunit vs. UniProt/SwissProt
Match: sp|Q6NY74|RFA1_DANRE (Replication protein A 70 kDa DNA-binding subunit OS=Danio rerio OX=7955 GN=rpa1 PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 3.970e-128
Identity = 208/593 (35.08%), Postives = 348/593 (58.68%), Query Frame = 2
Query:   26 LTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESXXXXXXXXXXXXXR-INPAN------------------------------ITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLG-GLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            L++G++ES+  G +V +PI + +  + +   +G  R+R+ ++DG+   +  ML+TQLN   + N++    +  L + + N  KD ++++V+LDI  +   + +      P   VE     P   P  T R + P N                              + PI+ +NPYQ++WTI+ RV+ KSAI+TW+N+RGDGKLFS  L D S +I+   FNNEV +FF +++ GK + ISKG++K AN +F++ K ++E+ LN E+ +   ED  +   +Q DFVSI ++ +   DT +D++G+ +   D++ I  K + +E  KR++ L+D SG  I++T+WG D +  D    P++ +KGA + +F G+++S   +ST++INP +IPEA  L GWYD+ G  L  Q      G G    T   T++E+     G+ +K DYFS  A +   R++  +Y+ACP + CNKK++D  NG+++CEKC+ E  +F +R++LS  I DF    W T FQ+  + +LG ++  +G   +L+  +E A   +F+ A +  F F+ +VK E++NDE+R+KVTV+DAK +++ E  KR++
Sbjct:    5 LSEGAIESLSKGTEVNNPILQCVNIRKIDGGNGVSRFRVMMSDGLHTMSSFMLSTQLNPMAEQNQLATNCVCVLKRSVTNVLKDGRRVVVILDIEVLKSADQMPGKIGDPTPYVEGQSKAPSTAPAPTARPLQPQNGSDGSTYRPSAQSFGKKPMAAPNTPGGSSKVVPIASLNPYQSKWTIRARVTNKSAIRTWSNSRGDGKLFSMELVDESGEIRATGFNNEVDKFFSLIEQGKVFYISKGTLKIANKQFSSLKNDYEMTLNGETSIIPCEDSNDVPMLQCDFVSIADLESREKDTILDVIGVCKNAEDVARIMTKNS-REVSKRNIQLIDMSGRVIQLTMWGSDAETFDGSGQPILAIKGARLSDFGGRSLSTLYSSTVMINP-DIPEAYKLRGWYDKEGHALDGQSMTELRGPGGGGNTNWKTLAEVKNEHLGHGDKADYFSCIATIVYIRKENCLYQACPSKDCNKKVVDQQNGMFRCEKCDKEFPDFKYRLMLSANIADFGDNQWVTCFQDTAETLLGQNSSYLG---QLKDTNEAAFDEVFQHANFNTFVFRNRVKLETYNDESRIKVTVVDAKPVDHREYSKRLI 592          
BLAST of Replication protein A subunit vs. UniProt/SwissProt
Match: sp|Q5ZJJ2|RFA1_CHICK (Replication protein A 70 kDa DNA-binding subunit OS=Gallus gallus OX=9031 GN=RPA1 PE=2 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 4.159e-125
Identity = 209/605 (34.55%), Postives = 341/605 (56.36%), Query Frame = 2
Query:   26 LTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESXXXXXXXXXXXXXRIN---------------------PAN--------------------ITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQ--VPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIMS 1696
            L++G++ +I+ G  V  P+ +++  + +A+ +G PRYR+ ++DGV   +  MLATQLN  ++  R+    I ++++++VN  KD +++++L+D+  +   + +  +   P    E         P      N                     P+N                    + PI+ +NPYQ++WTI  RV+QK  I+TW+N+RG+GKLFS  L D S +I+  AFN++  +FF +++L K Y  +KG++K AN ++   K ++EI  N E+ V   +D +    +Q+DFVSI ++ N P D+ +D++GI +   D++ I  K +N+E  KR+V L+D SG  +  TLWG + ++ D    PVI +KGA V +F G+++S  ++ST+++NP + PEA  L GW+D  G  L         GG    V T   T+ E      G  +K DYFS    +   R++  +Y+ACP + CNKK+ID  NGLY+CEKC+ E   F +RM+L + I D     W T FQE  + +LG SA  +G   EL+ K+E A   +F+ A +  + FK++VK E++NDE+R+K T +D K +NY E  KR+++
Sbjct:    5 LSEGAIAAIMQGENVYKPVLQVINTRAIATGNGPPRYRVLMSDGVNTLSSFMLATQLNPLVEEERLSAHCICQVNRFIVNSLKDGRRVVILMDLDVLKTADMVGGTVGNPVPYNEGQGQQRSSAPTANAAPNKPQQQDGNLSVAGSAAPKYHAPSNQFSKASAPSSVKTPGGTQSKVVPIASLNPYQSKWTICARVTQKGQIRTWSNSRGEGKLFSIELVDESGEIRATAFNDQADKFFPLIELNKVYYFTKGNLKTANKQYTAVKNDYEITFNNETSVVPCDDAQHLPSVQFDFVSISDLENTPKDSIVDVIGICKSYEDVTKIVVKASNREVSKRNVHLMDTSGKLVTATLWGNEAEKFDGSRQPVIAIKGARVSDFGGRSLSVLSSSTVVVNPDS-PEAFKLRGWFDSEGQLLECASISDVRGGSASGVNTNWKTLYEAKSERLGQGDKADYFSCVGTIVHLRKENCMYQACPSQDCNKKVIDQQNGLYRCEKCDREFPNFKYRMMLLVTIADSLDYQWVTCFQESAEFILGQSATFLG---ELKDKNEQAFEEVFQNANFNTYEFKIRVKLETYNDESRIKATALDVKPVNYREYSKRLIA 605          
BLAST of Replication protein A subunit vs. UniProt/SwissProt
Match: sp|Q01588|RFA1_XENLA (Replication protein A 70 kDa DNA-binding subunit OS=Xenopus laevis OX=8355 GN=rpa1 PE=1 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 3.048e-115
Identity = 192/597 (32.16%), Postives = 340/597 (56.95%), Query Frame = 2
Query:   26 LTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQNNI----------------------------------TNSSSIPKLVVESXXXXXXXXXXXXXRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQVPTKMGTISELVCS----GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            L++G++ +++ G     P  +++  + + + +G PRYRL ++DG+   +  MLATQLN  +D+N +    I ++ +++VN  KD +++I+++++  +   + +                                   NS+  P +   +       +   T   + + + PI+ +NPYQ++WT++ RV+ K  I+TW+N+RG+GKLFS  + D S +I+  AFN +  +FF ++++ K Y  SKG++K AN ++ + K ++E+  N+E+ V   +D  +   +Q++FVSI E+ +   DT +DI+G+ + V +++ +T K+ N+E  KR + L+D SG  +  TLWGED  + D    PV+ +KGA + +F G+++S  ++ST++INP +IPEA  L  W+D  G  +       + GG          S L       G+ EK DYF+  A +   R++  +Y+ACP + CNKK+ID  NGL++CEKC  E   F +R++LS  I DF    W T FQE  + +LG +A  +G   EL+ K+E A   +F+ A ++ + F+ +VK E++NDE+R+K T +D K +++ E  +R++
Sbjct:    6 LSEGAISAMLGGDSSCKPTLQVINIRPINTGNGPPRYRLLMSDGLNTLSSFMLATQLNSLVDNNLLATNCICQVSRFIVNNLKDGRRVIIVMELDVLKSADLVMGKIGNPQPYNDGQPQPAAPAPASAPAPAPSKLQNNSAPPPSMNRGTSKLFGGGSLLNTPGGSQSKVVPIASLNPYQSKWTVRARVTNKGQIRTWSNSRGEGKLFSIEMVDESGEIRATAFNEQADKFFSIIEVNKVYYFSKGTLKIANKQYTSVKNDYEMTFNSETSVIPCDDSADVPMVQFEFVSIGELESKNKDTVLDIIGVCKNVEEVTKVTIKSNNREVSKRSIHLMDSSGKVVSTTLWGEDADKFDGSRQPVVAIKGARLSDFGGRSLSVLSSSTVMINP-DIPEAFKLRAWFDSEGQVVEGTSISESRGGGTGGGNTNWKSLLEVKNENLGHGEKADYFTSVATIVYLRKENCLYQACPSQDCNKKVIDQQNGLFRCEKCNKEFPNFKYRLILSANIADFGENQWITCFQESAESILGQNATYLG---ELKEKNEQAYDEVFQNANFRSYTFRARVKLETYNDESRIKATAVDVKPVDHKEYSRRLI 598          
BLAST of Replication protein A subunit vs. UniProt/SwissProt
Match: sp|Q5FW17|RFA1_XENTR (Replication protein A 70 kDa DNA-binding subunit OS=Xenopus tropicalis OX=8364 GN=rpa1 PE=2 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 7.737e-113
Identity = 192/598 (32.11%), Postives = 339/598 (56.69%), Query Frame = 2
Query:   23 VLTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMV-NFKDEKKIIVLLDISFIDEQNNITNSSSIPKL---VVESXXXXXXXXXXXXXRINPANI-----------------------TP---------ISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQG-QQSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            VL++G++ +I+ G     P  +++  + + + +G PRYRL ++DG+   +  MLATQLN  +D+N +    I ++ +++V N KD +++I+++++  +   + +      P                         P NI                       TP         I+ +NPYQ++WT++ RV+ K  I+TW+N+RG+GKLFS  + D S +I+  AFN +  +FF ++++ K Y  SKG++K AN ++ + K ++E+  N+E+ V   +D  +   +Q++FV I E+ +   DT +DI+GI +   +++ +T ++ N+E  KR++ L+D SG  +  TLWGED  + D    PV+ +KGA + +F G+++S  ++ST++INP +IPEA  L  W+D  G  +      +S  G     T   ++ E+     G+ EK DYF+  A +   R++  +Y+ACP + CNKK+ID  NGL++CEKC+ E   + +R++LS  I DF    W T FQE  + +LG +A  +G   EL+ K+E A   +F+ A ++ + F+++VK E++NDE+R+K T +D K +++ E  +R++
Sbjct:    5 VLSEGAISAILGGDSSCKPTLQVINIRSINTGNGPPRYRLLMSDGLNTLSSFMLATQLNFLVDNNLLATNCICQVSRFIVNNLKDGRRVIIVMEMEVLKSADLVKGKIGNPHPYNDGQGPPQPAAPAPASAPPPSKPQNISAPPPPSMNRGASKLFGGGSVVNTPGGSQSKVVPIASLNPYQSKWTVRARVTNKGQIRTWSNSRGEGKLFSIEMVDESGEIRATAFNEQADKFFSLIEVNKVYYFSKGTLKIANKQYTSVKNDYEMTFNSETSVIPCDDSADVPMVQFEFVPIGELESKNKDTVLDIIGICKNAEEVTKVTIRSNNREVSKRNINLMDSSGKVVSTTLWGEDADKFDGSRQPVVAIKGARLSDFGGRSLSVLSSSTVMINP-DIPEAFKLRAWFDSEGQVVEGTSISESRGGTGGGNTNWKSLLEVKTENLGHGEKADYFTSVATIVYLRKENCLYQACPSQDCNKKVIDQQNGLFRCEKCDKEFPNYKYRLILSANIADFGENQWITCFQESAESILGQNATYLG---ELKEKNEQAYDEVFQNANFRSYTFRIRVKLETYNDESRIKATAMDVKPVDHKEYSRRLI 598          
BLAST of Replication protein A subunit vs. UniProt/SwissProt
Match: sp|P27694|RFA1_HUMAN (Replication protein A 70 kDa DNA-binding subunit OS=Homo sapiens OX=9606 GN=RPA1 PE=1 SV=2)

HSP 1 Score: 351.288 bits (900), Expect = 3.119e-112
Identity = 177/432 (40.97%), Postives = 270/432 (62.50%), Query Frame = 2
Query:  422 ANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQG----QQSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            + + PI+ + PYQ++WTI  RV+ KS I+TW+N+RG+GKLFS  L D S +I+  AFN +V +FF ++++ K Y  SKG++K AN +F   K ++E+  N E+ V   ED      +Q+DF  I ++ N   D+ +DI+GI +   D + IT ++ N+E  KR++ L+D SG  +  TLWGED  + D    PV+ +KGA V +F G+++S  ++STI+ NP +IPEA  L GW+D  G  L        +   +GG    T   T+ E+     G  +KPDYFS  A V   R++  +Y+ACP + CNKK+ID  NGLY+CEKC+TE   F +RM+LS+ I DF    W T FQE  + +LG +A  +G   EL+ K+E A   +F+ A ++ F F+++VK E++NDE+R+K TV+D K ++Y E  +R++
Sbjct:  182 SKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANP-DIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSN--TNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLG---ELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLV 607          

HSP 2 Score: 58.151 bits (139), Expect = 1.540e-7
Identity = 25/98 (25.51%), Postives = 61/98 (62.24%), Query Frame = 2
Query:   26 LTKGSLESIIN-GVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFI 313
            L++G++ +I+  G     PI +++  + + + +  PRYRL ++DG+   +  MLATQLN  ++  ++    + ++ +++VN  KD +++++L+++  +
Sbjct:    5 LSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVL 102          
BLAST of Replication protein A subunit vs. TrEMBL
Match: A0A0R3T2Y4 (Replication protein A subunit OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS1335 PE=3 SV=1)

HSP 1 Score: 417.157 bits (1071), Expect = 2.370e-135
Identity = 214/580 (36.90%), Postives = 352/580 (60.69%), Query Frame = 2
Query:   26 LTKGSLESIINGVQVPDPIFKILAFKGM-ASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQNNITNSSSI------------PKLVVESXXXXXXXXXXXXXRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYS--EMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECG-STLSFQG--QQSTLG----GLQVPTKMGTISELVCSG--NAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIANMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRI 1690
            LT G++E +  G  + DPI K+L FK +  +N G+ RYRL +TDGV  H++ MLATQLN  I++N ++ G+I++L KY+ N  +  K ++++LD+  +  + + T  + +            P ++      V       +       +  I  +NPYQ+RWTI+ RV+QK +I+TW     +GKLFSF L D++ +I+  AFN EV +FFD++++ K + ISK S+K AN +FNNT  ++E+++NA++ +   +D ++ S     + FV I ++ +     F+DIVGI  E  D++TIT KT+N++  KR++ +VD SG  +R+TLWG++    D  +HP IVV+ A V +F G+++S    ST++I PS IPEA  L GWYD  G S+L+F+    +  +G    G         +S+L   G     K DYF+  A V   +++  +Y++C  E C KK++DL NGLY+CEKC  E   + +R++LS++I D +G  W T FQ   +++LG SADD+G + E + + ++ N+F  A +K + F+L+ K ++FNDE+R++V  ++ K +NY E  +++
Sbjct:    4 LTVGAIEQLYAGKIIQDPILKVLGFKNVPGANPGQNRYRLLITDGVKSHSFAMLATQLNCMIENNELKNGSIVRLKKYVCNNVQQGKFVVIVLDLEIVGYEADKTRQADVNMEEKPVAAAPAPSVLKTPPKNVSQPFSTASPGTPAGKVFAIRGLNPYQSRWTIRARVTQKGSIRTWNKNGREGKLFSFTLLDSTGEIRATAFNAEVDRFFDLIEVNKVFYISKASLKPANRQFNNTDNDYEMNINADTQIVPCDDGEDISVPGFSFKFVKIGKLDDCKAGDFVDIVGIVHEAGDLTTITMKTSNRDVQKRELGIVDDSGCLVRLTLWGQEAANFDGSNHPAIVVRSARVSDFNGRSLSATAQSTVMIAPSTIPEANKLKGWYDNSGGSSLNFETYRGEGLVGEGGDGYNGSRDWNLLSDLEAPGIGGQAKADYFTTKATVTFLKKENFMYQSCVTEGCQKKVVDLGNGLYRCEKCNRESPIYKWRLMLSLKISDITGEHWITCFQNTAEVILGRSADDLGAIKESKDEVQMENVFVNATFKSWVFRLRAKVDTFNDESRLRVVAVEVKPVNYAEYGRKL 583          
BLAST of Replication protein A subunit vs. TrEMBL
Match: A0A293LLH6 (Replication protein A subunit (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 9.702e-135
Identity = 217/606 (35.81%), Postives = 351/606 (57.92%), Query Frame = 2
Query:   26 LTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFI---------------------------DEQNNITNSSSIPKLVVESXX--------------XXXXXXXXXXXRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQVPTKMGTISELVCS------GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFEL--ERKDEIANMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            LT G+++ I++G  V  P+ ++L FK +   + E RYRL ++DGV  HTY ML TQLN+ I S  ++  A+I+LDKYM N    EKKI+++L+++ +                            +Q+  T + + P    +                    + +  +  + N   + PIS + PYQN+WTI+ RV+ KSAI+TW+N++G+GKLFS  L D S +I+  AFN E  +F+D++++ K Y +SK ++K AN  F + K EFE+  N E+ V   +D      +Q+ FV I ++  +P DT +D++G+ +   ++ T+  +TTN+E  KRDV LVD++ + I +TLWG   +  D  +HPV+ +KGA V +F G ++S   +S + +NP ++PE+ +L GWY   GS++  Q      G     T  GT+ + +        G  +KPDYF+  A++   R++R +YKACP E+CNKK++DL NG  +CEKC  E   + +R+L+S  + DF+   W T F +  + +LG SAD++G  FE+   R ++I N   EA +KEF F+L+VK E++NDETR+K +++    +NYVE   +++
Sbjct:    5 LTGGAVQRILDGELVEKPVLQVLNFKPIPGGNSE-RYRLLLSDGVMCHTYAMLGTQLNEKITSKEVEKFAVIQLDKYMCNTVNPEKKILIILELTIVVPGADVGSKIGNPVTNVPGAAVTHSGPAQQHATTPAETAPSARPQQPTDFQFRSNAPSFPRPQPSMASGGSMQQANGVVVFPISSLTPYQNKWTIRARVTNKSAIRTWSNSKGEGKLFSMDLLDESGEIRATAFNAECDRFYDVIEVNKVYYVSKANLKPANKNFTSIKNEFEMSFNNETHVSPCDDSANIPTVQFSFVPIQKLQGMPRDTLVDVIGVCKSAGEVQTVVRRTTNQELKKRDVQLVDKTNTEISLTLWGNQAETFDASEHPVVAIKGARVSDFSGVSLSLIGSSMMQVNP-DLPESHSLYGWYINEGSSMESQSITVRGGTGTSLTGPGTVWKTLEQVKKENLGQGDKPDYFTTKASIAIVRKERCMYKACPTEQCNKKVVDLENGFVRCEKCMQEFPNYKWRLLVSANLSDFTDSQWVTCFGKEAEELLGASADELGGYFEMNNPRFEDIIN---EAAFKEFIFRLRVKTETYNDETRLKTSIVSLAPVNYVEHTHKLL 605          
BLAST of Replication protein A subunit vs. TrEMBL
Match: A0A2R5LE87 (Replication protein A subunit OS=Ornithodoros turicata OX=34597 PE=3 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 3.136e-134
Identity = 212/605 (35.04%), Postives = 356/605 (58.84%), Query Frame = 2
Query:   26 LTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFI----DEQNNITNS-SSIPKLV-------------------------------------VESXXXXXXXXXXXXXRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQVPTKMGTISELVCS------GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIANMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            LT G+++ I++G  V  P+ ++L FK +   S E RYRL ++DGV  HTY ML TQLN+ I S  ++  A+I+LDKYM N    EKKI+++L+++ +    D  + I N  +++P +V                                     + +     + T  +  + N   + PIS + PYQN+WTI+ RV+ KSAI+TW+N++G+GKLFS  L D S +I+  AFN E  +F+D++++ K Y +SK ++K AN  F + K EFE+  N+E+ +   +D      +Q+ FV IL++  +P DT +D++G+ +   ++ T+  + TN+E  KRD+ LVD++ + I +TLWG   +  +  +HPV+ +KGA + +F G ++S   +S + +NP ++PE+ +L GWY   GS++  Q      G     T  GT+ + +        G  +KPDYF+  A++   R+++ +YKACP E+CNKK++D+ NG  +CEKC  E + + +R+L+S  + DFS   W T F +  + +LG SA+++G+ FE+       ++  +A +KEF F+L+VK E++NDETR+K +V+    +NYVE  ++++
Sbjct:    5 LTGGAVQRILDGELVDKPVLQVLNFKPIPGGSSE-RYRLLLSDGVMCHTYAMLGTQLNEKITSKEVEKFAVIQLDKYMCNTVNPEKKILIILELTVVAAGADVGSKIGNPVTNVPGVVAQQSAQAQQNVSAPAEAAAPQRPQQPTQFQFRGNTSSMSAPQRPQMSTGGSLQQTNGVVVFPISSLTPYQNKWTIRARVTNKSAIRTWSNSKGEGKLFSMDLLDESGEIRATAFNAECDRFYDVIEVNKVYYVSKANLKPANKNFTSIKNEFEMSFNSETHISPCDDSSSIPTVQFSFVPILKLQGMPRDTLVDVIGVCKSAGEVQTVIRRNTNQELKKRDIQLVDKTNTEISLTLWGTQAETFEAGEHPVVAIKGARISDFSGVSLSLIGSSMMQVNP-DLPESHSLYGWYVNEGSSMESQSITVRGGAGGSLTGPGTVWKSLEQVKKENLGQGDKPDYFTTKASIAIVRKEKCLYKACPTEQCNKKVVDMENGFVRCEKCAQEFSNYKWRLLVSANLADFSDSQWVTCFGKEAEQLLGASAEELGSYFEM-NNPRFEDIISDAAFKEFIFRLRVKMETYNDETRLKTSVVSLSPVNYVEHTQKLL 606          
BLAST of Replication protein A subunit vs. TrEMBL
Match: V5IEU7 (Replication protein A subunit OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 2.034e-132
Identity = 219/604 (36.26%), Postives = 344/604 (56.95%), Query Frame = 2
Query:   26 LTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESXXXXXXXXXXXXXRIN-----------------PANIT------------------------PISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEY-SEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQ-VPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFE--LERKDEIANMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            LT G++E I+NG  V  P+ ++L FK +A N+ + RYRL ++DGV  HTY ML TQLN  I    I+  A+++LDKYM N    EKKI+++L+++ I    ++ +    P +   +    P      + R                   PA  T                        PI  + PYQN+WTI+ RV+ KSAI+ W NARG+GKLFS  L D S +I+  AFN E  +F+D+V++ K Y IS+ ++K AN KF++ K EFE+    E+ +   E+   +   +Q++F+ I  + ++  D  +D++G+ ++   + T+  +  N+E  KRD+ LVD+S + + +TLWG+  +  D  ++PVI VKG  V +F G ++S    S + +NP +IPE+ AL+GWY   G++L  Q      GG +        +SE      G  ++PDYFS  A+V   R++  +YKACP EKCNKKL++L NGLY+CEKC  + +EF +R+++S  + DFS   W T F    + +LGN+A ++G  FE   ER +E  N   +A ++ F FKL+ K E++NDE+R+K +V+    +NYV+  K+++
Sbjct:    5 LTGGAVERILNGETVEKPVLQVLNFKPIAGNTTD-RYRLLLSDGVKCHTYAMLGTQLNSKIIDKEIERFAVVQLDKYMCNTISPEKKILIILELTVIANGADVGSKLGNPAMPSSTGAAAPSDGDGASNRTPASSEFAASVKPQGGAQFPARSTQPAPMQSSFRSGGGPTSGGDVVVLPICSLTPYQNKWTIRARVTNKSAIRNWNNARGEGKLFSMDLLDESGEIRATAFNAECDRFYDLVEVNKVYYISRANLKTANPKFSSLKNEFEMSFTQETAMTPCEEAAPHIPTLQFNFIPIRRLQDIGTDKVVDVIGVCKDAGTVQTVVRRANNQELKKRDISLVDKSSAEVSLTLWGDQAETFDGSNNPVIAVKGVRVSDFNGVSLSMIGASQLQVNP-DIPESHALIGWYSNEGASLQTQALSVRTGGFEGAGASWKHLSEAKSQQLGFGDRPDYFSCKASVAIVRKENCLYKACPAEKCNKKLVNLENGLYRCEKCNEQTSEFKWRLIVSAHLCDFSAGQWVTCFGAEAEQLLGNTAAELGGFFEGDHERFEEAVN---DAAFRTFIFKLRTKMETYNDESRLKTSVVSISPVNYVDYTKKLL 603          
BLAST of Replication protein A subunit vs. TrEMBL
Match: A0A224Z7G6 (Replication protein A subunit OS=Rhipicephalus zambeziensis OX=60191 PE=3 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 3.255e-132
Identity = 224/593 (37.77%), Postives = 358/593 (60.37%), Query Frame = 2
Query:   26 LTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQNNI---TNSSSIP---------------KLVVESXXXXXXXXXXXXXRINPAN-----ITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVK----FNNTKCEFEIHLNAESDVHEIED-RKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGG-LQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMF-----ELERKDEIANMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            LT G++E I+N  QV  P+ ++L FK ++SN+ + RYRL ++DGV  HTY ML TQLN  I++N I   A+++LDKYM N    +KK++++LD++ I + + +     S  IP               K  ++     P   P    R  PA+     + PI+ + PYQNRWTI+ RV+ KS I+TW+N++G+GKLFS  L D S +I+  AFN E  +F+D++++ K Y IS+  +K  NVK    F++ K +FE+ L +E+ +   +D       +Q++FV I  +  +  D+ ID++G+ +   D+ T+T +TT++E  KRDV LVDRSG+ + +TLWG+  ++ D  D+PV+ VKGA V +F G ++S  ++S + +NP +IPE+ AL+GWY   G+ L      +  GG +   +   +I++      G  +KPDY+S+ A V   R++  +YKACP E CNKK++DL  G Y+CEKC  E  EF +R+L+S  + DFS   W T F +  + ++G SA+D+G ++     E  R D+I N   +  +K F F+L+ K E +NDE+R+K +V+    ++YVE  K+++
Sbjct:    5 LTAGAVERILNNQQVDKPVLQVLNFKPISSNTAD-RYRLLLSDGVQCHTYAMLGTQLNGMINNNEIDKFAVVQLDKYMCNVVSPDKKVLIVLDLTVIAKGSTVGCRLGSPVIPTSSSGAAQPTDGGASKPPLQQNSAAPSAAPSFGNRAYPASTSDVVVVPIASLTPYQNRWTIRARVTNKSNIRTWSNSKGEGKLFSMDLLDESGEIRATAFNAECDRFYDVIEVNKVYYISRAVIK--NVKKGYSFSSIKNDFEMSLISETTITPCDDVTANIPTLQFNFVPIPRLQELSKDSVIDVIGVCKSAGDVQTVTRRTTSQELKKRDVSLVDRSGTEVSLTLWGDQAEKFDGSDNPVVAVKGARVSDFNGVSLSLISSSMLQVNP-DIPESHALMGWYSREGTLLQTHSLSTQRGGPMGGNSNWKSIAQAKSEDLGQGDKPDYYSVKACVSIIRKENCLYKACPSENCNKKVVDLQTGYYRCEKCAQETMEFKWRLLVSANLTDFSDGQWVTCFGKEAETLIGASAEDLGELYSNSSKEDSRYDDILN---DVPFKPFIFRLRTKMEVYNDESRLKTSVMSVSPVDYVEYTKKLL 590          
BLAST of Replication protein A subunit vs. Ensembl Cavefish
Match: rpa1 (replication protein A1 [Source:NCBI gene;Acc:103028131])

HSP 1 Score: 381.333 bits (978), Expect = 5.781e-125
Identity = 203/597 (34.00%), Postives = 347/597 (58.12%), Query Frame = 2
Query:   20 MVLTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESXXXXXXXXXXXXXR---INPAN------------------------------ITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQ-QSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            + L++G++E +I G +V +P+ + +  + +   SG  R+RL ++DG+   +  ML+TQLN   + + + P  +  + + + N  KD + ++++LD+  I   + +      P   VE     P   P        + P N                              I PI+ +NPYQ++WTI+ RV+ KSAI+TW+N+RGDGKLFS  + D S +I++  FN EV +F+ +++ GK Y ISKGS+K AN ++ + K ++E+ LN ES +   ED ++   +Q DFV+I ++     D  +D++G+ + V D++ IT K + +E  KR++ L+D SG  I++T+WG + +  D    P++ +KGA + +F G+++S   +ST++INP +IPEA  L GWYD+ G  L  Q   +   GG   PT   T++++     G+ +K DYF+    +   R++  +Y+ACP + CNKK++D  NG+++CEKC+ E  +F +R++LS  I DF    W T FQ+  + +LG  AD +G   +L+  +E A   +F+ A +  F F+ +VK E++NDE+R+KVTV++AK +++ E  KR++
Sbjct:    3 VTLSEGAIELLIKGSEVSNPVLQCVNIRKIDGGSGPVRFRLMMSDGLHTMSSFMLSTQLNYLAEQSLVAPNCVCTVKRSVTNVLKDGRPVVIILDMEVIKPADQVGGKIGDPTPYVEGQSKPPQPAPAPAPSSRPLQPQNGSDGHTNRGPSRDFGRKPMNAPNTPSGTSKIVPIASLNPYQSKWTIRARVTNKSAIRTWSNSRGDGKLFSMEIVDESGEIRVTGFNQEVDKFYSIIEQGKVYYISKGSLKIANKQYTSLKNDYEMTLNGESTIIPCEDSQDVPMVQCDFVAIADLEAREKDAIVDVIGVCKSVEDVTRITTKNS-REVSKRNIQLMDMSGRVIQVTMWGNEAETFDGSGQPILAIKGARLSDFGGRSLSTLYSSTLMINP-DIPEAYKLRGWYDKEGHALDGQSMTEMRGGGGGGPTNWKTLADVKNEHLGHGDKADYFTCIGTIVYMRKENCLYQACPSKDCNKKVVDQQNGMFRCEKCDKEFPDFKYRLMLSANIADFGDNQWVTCFQDSAETLLGQKADYIG---QLKESNEAAFDEVFQHANFNTFVFRNRVKLETYNDESRIKVTVMEAKPVDHKEYSKRLI 594          
BLAST of Replication protein A subunit vs. Ensembl Cavefish
Match: rpa1 (replication protein A1 [Source:NCBI gene;Acc:103028131])

HSP 1 Score: 377.867 bits (969), Expect = 3.506e-124
Identity = 195/550 (35.45%), Postives = 329/550 (59.82%), Query Frame = 2
Query:   83 FKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESXXXXXXXXXXXXXRINPAN-------ITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQ-QSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            F +   + +   SG  R+RL ++DG+   +  ML+TQLN   + + + P  +  + + + N  KD + ++++LD+  I   + +      P   VE               +N  N       I PI+ +NPYQ++WTI+ RV+ KSAI+TW+N+RGDGKLFS  + D S +I++  FN EV +F+ +++ GK Y ISKGS+K AN ++ + K ++E+ LN ES +   ED ++   +Q DFV+I ++     D  +D++G+ + V D++ IT K + +E  KR++ L+D SG  I++T+WG + +  D    P++ +KGA + +F G+++S   +ST++INP +IPEA  L GWYD+ G  L  Q   +   GG   PT   T++++     G+ +K DYF+    +   R++  +Y+ACP + CNKK++D  NG+++CEKC+ E  +F +R++LS  I DF    W T FQ+  + +LG  AD +G   +L+  +E A   +F+ A +  F F+ +VK E++NDE+R+KVTV++AK +++ E  KR++
Sbjct:    1 FSLQNIRKIDGGSGPVRFRLMMSDGLHTMSSFMLSTQLNYLAEQSLVAPNCVCTVKRSVTNVLKDGRPVVIILDMEVIKPADQVGGKIGDPTPYVEGHTNRGPSRDFGRKPMNAPNTPSGTSKIVPIASLNPYQSKWTIRARVTNKSAIRTWSNSRGDGKLFSMEIVDESGEIRVTGFNQEVDKFYSIIEQGKVYYISKGSLKIANKQYTSLKNDYEMTLNGESTIIPCEDSQDVPMVQCDFVAIADLEAREKDAIVDVIGVCKSVEDVTRITTKNS-REVSKRNIQLMDMSGRVIQVTMWGNEAETFDGSGQPILAIKGARLSDFGGRSLSTLYSSTLMINP-DIPEAYKLRGWYDKEGHALDGQSMTEMRGGGGGGPTNWKTLADVKNEHLGHGDKADYFTCIGTIVYMRKENCLYQACPSKDCNKKVVDQQNGMFRCEKCDKEFPDFKYRLMLSANIADFGDNQWVTCFQDSAETLLGQKADYIG---QLKESNEAAFDEVFQHANFNTFVFRNRVKLETYNDESRIKVTVMEAKPVDHKEYSKRLI 545          
BLAST of Replication protein A subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008983.1 (pep scaffold:Pmarinus_7.0:GL483239:38:3891:1 gene:ENSPMAG00000008127.1 transcript:ENSPMAT00000008983.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.895 bits (359), Expect = 1.993e-39
Identity = 66/207 (31.88%), Postives = 120/207 (57.97%), Query Frame = 2
Query: 1067 STILINPSNIPEAMALVGWYDECGSTL---SFQGQQSTLGGLQVPTKM-GTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIANMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINY 1669
            S+I +NP ++P A  L  WYD  G+     S   ++S++ G    T +  T +E      G  E+PDYF++   V   +++  +Y+ACP   C+KK++ +++G ++CE+C+ E   F FR+ L   + DFS   W T F E  +++LG++A+ +G +      + I  +F EA ++ + F+L+VK E +NDE R+K  ++D + +++
Sbjct:    1 SSIQLNP-DMPPAFQLRSWYDRVGAHTQGESISDRRSSMSGWSSATPIWKTFAESKDENLGQGEQPDYFTVKGTVIFLKKENYLYQACPSADCSKKVVTMSSGKFRCERCDRETTNFKFRLFLQANLADFSDNQWVTCFHETSEVLLGDTAERLGALKAQGDDEAIDRIFHEATFRSYMFRLRVKAEHYNDEMRLKAVMMDTRPLDH 206          
BLAST of Replication protein A subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008701.1 (pep scaffold:Pmarinus_7.0:GL483250:7082:14431:-1 gene:ENSPMAG00000007874.1 transcript:ENSPMAT00000008701.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 7.921e-33
Identity = 53/156 (33.97%), Postives = 100/156 (64.10%), Query Frame = 2
Query: 1229 GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIANMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIMS 1696
            G+ +K DY ++  ++   ++D  +Y+ACP   CNKK++DL NG ++CEKC+ E   F +R++L   IVD++   W T FQE G+ +LG   + +G++ +  R      +F+ A +  + F+++VK E++NDE+R+K+T+++ +  +  E  KR+++
Sbjct:   40 GHGDKADYVTVKGSIISIKKDNCLYQACPKLDCNKKVLDLNNGSFRCEKCDAEVPNFKYRLILQANIVDYTDNQWVTCFQEQGESILGMKTEALGDLKDSVR-GAYEQVFQNANFTTYIFRMRVKLENYNDESRIKMTIMEVRPCDPSEHSKRLIT 194          
BLAST of Replication protein A subunit vs. Ensembl Yeast
Match: RFA1 (Subunit of heterotrimeric Replication Protein A (RPA); RPA is a highly conserved single-stranded DNA binding protein involved in DNA replication, repair, and recombination; RPA protects against inappropriate telomere recombination, and upon telomere uncapping, prevents cell proliferation by a checkpoint-independent pathway; role in DNA catenation/decatenation pathway of chromosome disentangling; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000000065])

HSP 1 Score: 266.929 bits (681), Expect = 9.643e-82
Identity = 142/427 (33.26%), Postives = 245/427 (57.38%), Query Frame = 2
Query:  428 ITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSF--QGQQSTLGGLQVPTKMGTISELVC--------SGNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIANMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEE 1678
            I  I  ++PYQN WTI+ RVS K  IKTW N RGDGKLF+    D S +I+  AFN+  T+F +++Q GK Y +SK  ++ A  +F N    +E++L+ ++ + E  D     +  ++F+ +  I N  V++ +D++GI Q +     +T++   K+  +RD+ +VD SG SI + LW +     +  +  V  +KG  V +F GK++S G +ST++ NP  IPEA AL GWYD  G   +F    Q+  +GG    +    I++ +          G +EK D+FS+ AA+   + D   Y AC  E CNKK+++  +G ++CEKC+T  A  ++R +L++ I+D +  +W T F +  + +LG  A+ + ++ E E  +E   + +     E++F+++ + +++ND++R++ TV +   +NY  E
Sbjct:  184 IFAIEQLSPYQNVWTIKARVSYKGEIKTWHNQRGDGKLFNVNFLDTSGEIRATAFNDFATKFNEILQEGKVYYVSKAKLQPAKPQFTNLTHPYELNLDRDTVIEECFDESNVPKTHFNFIKLDAIQNQEVNSNVDVLGIIQTINPHFELTSR-AGKKFDRRDITIVDDSGFSISVGLWNQQALDFNLPEGSVAAIKGVRVTDFGGKSLSMGFSSTLIPNPE-IPEAYALKGWYDSKGRNANFITLKQEPGMGGQSAASLTKFIAQRITIARAQAENLGRSEKGDFFSVKAAISFLKVDNFAYPACSNENCNKKVLEQPDGTWRCEKCDTNNARPNWRYILTISIIDETNQLWLTLFDDQAKQLLGVDANTLMSLKE-EDPNEFTKITQSIQMNEYDFRIRAREDTYNDQSRIRYTVANLHSLNYRAE 607          
BLAST of Replication protein A subunit vs. Ensembl Nematostella
Match: EDO36119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJL0])

HSP 1 Score: 382.104 bits (980), Expect = 2.406e-125
Identity = 204/618 (33.01%), Postives = 352/618 (56.96%), Query Frame = 2
Query:   17 VMVLTKGSLESIINGV-----QVPD-PIFKILAFKGMASNSGEP--RYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVNF-KDEKKIIVLLDISFIDEQNNIT--------------------NSSSIPKLV-----------------VESXXXXXXXXXXXXXRINPAN--------ITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNL--DHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGST---LSFQGQQSTLGGLQVPTKMGTISELVCSGNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIANMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
             + L++G+++ I+N       ++P+ P+F+IL  K +    G+   RYRL ++DGV  HT  MLATQLN  +    I+  A+++LDKY+ N  ++ +K+++LL+++ +   + +                     N++  PK V                  ++  +       +     P N        + PIS + PYQNRWTI+ R++ KS I+TW N+RG+G+LF+  + D S +I+   FN  V +F+ M+++ K + I+KGS++ AN ++++ + ++E++LN ++ +    +      +QY+FV+I ++ N+  D  +DI+G+   V D++ IT KTTNK+  KRD+ L+DRS  S+  TLWG++ ++ +     +PV+ ++GA V +F G+++S  N+S + +NP ++ EA  L GWYD  G      S  GQ+ + GG   P K  +  +    G  EK DY S+      FRR+  +YKACP E+CNKK+I+  +G Y CEKC  +   + +R++LS  + DF+G  W T FQE  + +LG SA D+G M E + + +   +F  + +K   FK++ K E++N+ETR+K +V++   +NY +E KR++
Sbjct:    2 TITLSEGAIQEILNTPSDQPDRLPEQPVFQILGLKKIQPKQGDASDRYRLVLSDGVLIHTSAMLATQLNDKVTDGEIEVKAVVRLDKYICNIIQETRKVLILLELTTVKRASEVPGKIGNPRNAADNNAGGQQNGNAAPAPKNVGGGSFGGQNNPPAQRQQAQTFGSKGFGGGSSYKSNQPVNRGGDGAKTVFPISGLTPYQNRWTIRARITSKSNIRTWNNSRGEGRLFNVEMVDESGEIRATGFNEAVDKFYQMLEVDKVFYITKGSLRTANKQYSSIRNDYEMYLNNDTIIEPCNETCNLPTLQYNFVNIGDLENINKDQIVDILGVVTNVGDLAQITTKTTNKQVSKRDITLLDRSEKSVTATLWGDEAEKFEEHAGKNPVLAIRGAKVSDFGGRSLSVLNSSNMRVNPVDMKEAQVLRGWYDNTGKNNEVASISGQRYSAGG-GGPLKFLSQIKNEQLGMGEKADYISVKGVCVYFRRENCMYKACPSEECNKKVIEEDSGFY-CEKCGRKYPNYKYRLILSAHLADFTGSQWVTCFQESAEALLGRSASDLGQMKENQDEAQFDQVFASSEFKLHTFKIRAKMETYNEETRLKCSVVNVVPVNYKQESKRLI 617          
BLAST of Replication protein A subunit vs. Ensembl Nematostella
Match: EDO25726 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVN3])

HSP 1 Score: 100.138 bits (248), Expect = 3.456e-25
Identity = 45/99 (45.45%), Postives = 62/99 (62.63%), Query Frame = 2
Query: 1229 GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFE 1525
            G  EK DY S+      FRR+  +YKACP E+CNKK+I+  +G Y CEKC  +   + +R++LS  + DF+G  W T FQE  + +LG SA D+G M E
Sbjct:   17 GMGEKADYISVKGVCVYFRRENCMYKACPSEECNKKVIEEDSGFY-CEKCGRKYPNYKYRLILSAHLADFTGSQWVTCFQESAEALLGRSASDLGQMKE 114          
BLAST of Replication protein A subunit vs. Ensembl Medaka
Match: rpa1 (replication protein A1 [Source:NCBI gene;Acc:101164080])

HSP 1 Score: 379.793 bits (974), Expect = 1.882e-124
Identity = 205/592 (34.63%), Postives = 343/592 (57.94%), Query Frame = 2
Query:   26 LTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESXXXXXXXXXXXXXRI--NPAN----------------------------ITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGL-QVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIM 1693
            L++G++E++ NG    + I +++  + +   SG  R+R+ ++DG    +  ML+TQLN   + N +    +  L +++ N  KD ++++++L+I  I     +      P    E+   V    P    R+   P N                            + PI+ +NPYQ++WTI+ RV+ KS I+TW+N+RGDGKLFS  L D S +I++  FN EV +FF ++++GK Y ISKGS+K AN ++ + K ++E+ LN ES +   E+  +   MQ DFV I ++ +   D  +D++G+ + V +++ +T K TN+E  KR + L+D SG  + +TLWGE+ ++ D    P++ +KGA + +F G+++S   +ST++INP +IPEA  L GWYD+ G  +  Q      GG     T   T+S+L     G+ EK DY+S  A V   R++  +Y+ACP + CNKK+ID  NG+++CEKC+ E   F +R++LS  I D+    W T FQE  + +LG +A  +G   +L+  +E A   +F++A +K F F+ +VK E++NDE+R+K TV+D K +++ + IK ++
Sbjct:    4 LSEGAIEALANGTGGNEAILQLVNIRKIDGGSGPSRFRVMMSDGRHTLSSFMLSTQLNCMAEENILAQNCVCLLKRHVTNVLKDGRRVVIILEIEVIKPAGEVGGKLGDPVPYNEAQKGVSQPAPAQENRLPLQPQNKIEVKSFNRDFGKKAPLAMPSTPGGSSKVVPIASLNPYQSKWTIRARVTNKSGIRTWSNSRGDGKLFSMELVDESGEIRVTGFNQEVDKFFSLIEVGKVYYISKGSLKIANKQYTSVKNDYEMTLNGESTILPCEESGDVPMMQCDFVPIGDLESRDKDAIVDVIGVCKSVDEVTRLTTK-TNREVSKRSLSLMDMSGKLVTVTLWGEEAEKFDGSGQPIVAIKGAKLSDFGGRSLSASFSSTLMINP-DIPEAYKLRGWYDKDGHAVEGQSLTELKGGSGGGSTNWKTLSDLKNEHLGHGEKADYYSCIATVVYLRKENCLYQACPNQDCNKKVIDQHNGMFRCEKCDKEFPNFKYRLILSANIADYGDNQWVTCFQESAEAILGQNAAYLG---QLKDSNESAFDEVFQQANFKTFVFRNRVKLETYNDESRIKATVMDLKPVDHKDYIKSLI 590          
BLAST of Replication protein A subunit vs. Ensembl Medaka
Match: RPA1 (replication protein A 70 kDa DNA-binding subunit [Source:NCBI gene;Acc:101164493])

HSP 1 Score: 343.969 bits (881), Expect = 7.793e-110
Identity = 177/434 (40.78%), Postives = 278/434 (64.06%), Query Frame = 2
Query:  416 NPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQG---QQSTLGGLQVPTKMGTISELVCS--GNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELERKDEIA--NMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINYVEEIKRIMS 1696
            +P  + PIS +NPYQ++WTI+ RV+ KS ++ W+N+RG+GKLFSF + D S +IKI AFNNEV +FF +++ GK Y ISK ++K AN +++  K ++E+ L+A S +   ED +    M  +FV I E+ N   D  ID++GI ++  D+S IT K + +E  KR + L+D SG  +  TLWGE+ ++ D    PV+ +KGA + +F G+++S   +STI++NP +IPEA  L  WYD  G  ++ Q    ++ST  G ++  K  T+S++     G+ +K +YFS  A V   R++  +Y+ACP   CNKK+I   NGLY+CEKC  E ++F +R LLS  + DF    W T FQE  +++LG+SA  +G   +L   DE A   +F++A ++   FK +VK E++NDE+R+KVTV++   +++ E  +R++S
Sbjct:  222 SPMKVFPISTLNPYQSKWTIRARVTNKSNVRQWSNSRGEGKLFSFEVVDESGEIKITAFNNEVDKFFSLLEQGKVYYISKATLKVANKQYSTLKNDYEMTLHAHSSIVPCEDNQSIPTMNCNFVQIEELENRDKDAIIDVIGICKKAEDVSRITTKNS-REVSKRALHLIDSSGKEVTATLWGEEAEKFDGSGQPVVAIKGARLSDFGGRSLSALFSSTIMVNP-DIPEAFRLRAWYDREGYAVNSQSLTERRSTNSGSRMNWK--TLSDVKNENMGHEDKAEYFSCLATVVYMRKENCLYQACPSADCNKKVIIQHNGLYRCEKCNREFSDFKYRFLLSANLADFGDNQWVTCFQETAEVLLGHSAQTLG---QLRETDEAAFDEVFQKANFRTHIFKNRVKLETYNDESRVKVTVMEVLPVDHREYSRRLLS 648          

HSP 2 Score: 59.6918 bits (143), Expect = 6.299e-9
Identity = 28/99 (28.28%), Postives = 56/99 (56.57%), Query Frame = 2
Query:   20 MVLTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVN-FKDEKKIIVLLDISFI 313
            + LT+G++E++  G+ + +P+ ++L  + M SNSG PR+RL ++DG    +  +L TQLN   +   +    I  L K + +   D +  + ++D+  +
Sbjct:    3 ITLTQGAIEALYKGLPIKNPLLQLLNIRQMTSNSGLPRFRLMMSDGQHALSSFLLTTQLNHLPEQKLLVQHCICMLKKVVTSTLADGRTAVTVMDMEVV 101          
BLAST of Replication protein A subunit vs. Planmine SMEST
Match: SMESG000005326.1 (SMESG000005326.1)

HSP 1 Score: 941.799 bits (2433), Expect = 0.000e+0
Identity = 474/490 (96.73%), Postives = 474/490 (96.73%), Query Frame = 2
Query:  107 MASNSGEPRYRLHVTDGVTDHTY---------------VMLATQLNKYIDSNRIQPGAIIKLDKYMVNFKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESXXXXXXXXXXXXXRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQVPTKMGTISELVCSGNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELE 1531
            MASNSGEPRYRLHVTDGVTDHT                VMLATQLNKYIDSNRIQPGAIIKLDKYMVNFKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESVPTVPVITPQTTTRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQVPTKMGTISELVCSGNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELE
Sbjct:    1 MASNSGEPRYRLHVTDGVTDHTCEFFIYLFIYLFTYLDVMLATQLNKYIDSNRIQPGAIIKLDKYMVNFKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESVPTVPVITPQTTTRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQVPTKMGTISELVCSGNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNMFELE 490          
BLAST of Replication protein A subunit vs. Planmine SMEST
Match: SMESG000005326.1 (SMESG000005326.1)

HSP 1 Score: 882.863 bits (2280), Expect = 0.000e+0
Identity = 439/444 (98.87%), Postives = 442/444 (99.55%), Query Frame = 2
Query:  107 MASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVNFKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESXXXXXXXXXXXXXRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQVPTKMGTISELVCSGNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSMEIVDF 1438
            MASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVNFKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESVPTVPVITPQTTTRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQVPTKMGTISELVCSGNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLS+ + D+
Sbjct:    1 MASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVNFKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESVPTVPVITPQTTTRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQVPTKMGTISELVCSGNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKCEKCETEKAEFSFRMLLSVSLGDY 444          
BLAST of Replication protein A subunit vs. Planmine SMEST
Match: SMESG000045678.1 (SMESG000045678.1)

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 336/338 (99.41%), Postives = 336/338 (99.41%), Query Frame = 2
Query:  107 MASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVNFKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESXXXXXXXXXXXXXRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVG 1120
            MASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVNFKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESV TVPVITPQ TTRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVG
Sbjct:    1 MASNSGEPRYRLHVTDGVTDHTYVMLATQLNKYIDSNRIQPGAIIKLDKYMVNFKDEKKIIVLLDISFIDEQNNITNSSSIPKLVVESVSTVPVITPQITTRINPANITPISHINPYQNRWTIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFDMVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSEMQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVVLVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNSTILINPSNIPEAMALVG 338          

HSP 2 Score: 159.073 bits (401), Expect = 6.865e-43
Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 3
Query: 1119 GGMMSVAAHFPSKVNKVHWEVCKYQLKWEQFPNWFAVEMQRNPIISPFQPRFVSSDEIGLSTRLAQSRNATK 1334
            GGMMSVAAHFPSKVNKVHWEVCKYQLKWEQFPNWFAVEMQRNPIISPFQPRFVSSDEIGLSTRLAQSRNATK
Sbjct:  338 GGMMSVAAHFPSKVNKVHWEVCKYQLKWEQFPNWFAVEMQRNPIISPFQPRFVSSDEIGLSTRLAQSRNATK 409          
The following BLAST results are available for this feature:
BLAST of Replication protein A subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RPA16.494e-11340.97replication protein A1 [Source:HGNC Symbol;Acc:HGN... [more]
RPA12.627e-5030.85replication protein A1 [Source:HGNC Symbol;Acc:HGN... [more]
RPA11.505e-926.25replication protein A1 [Source:HGNC Symbol;Acc:HGN... [more]
RPA13.677e-926.25replication protein A1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Replication protein A subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpa-14.423e-5429.53Probable replication factor A 73 kDa subunit [Sou... [more]
R03H10.61.912e-1224.41pep chromosome:WBcel235:II:4171294:4173875:-1 gene... [more]
R03H10.71.034e-1026.24pep chromosome:WBcel235:II:4177267:4178927:-1 gene... [more]
back to top
BLAST of Replication protein A subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RpA-702.548e-10533.05gene:FBgn0010173 transcript:FBtr0081867[more]
back to top
BLAST of Replication protein A subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpa15.259e-12935.08replication protein A1 [Source:NCBI gene;Acc:32749... [more]
back to top
BLAST of Replication protein A subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpa13.654e-11933.27replication protein A1 [Source:NCBI gene;Acc:54844... [more]
rpa11.508e-10832.52replication protein A1 [Source:NCBI gene;Acc:54844... [more]
rpa11.595e-10633.65replication protein A1 [Source:NCBI gene;Acc:54844... [more]
rpa11.760e-10432.90replication protein A1 [Source:NCBI gene;Acc:54844... [more]
rpa13.084e-10036.83replication protein A1 [Source:NCBI gene;Acc:54844... [more]
back to top
BLAST of Replication protein A subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rpa11.548e-10540.05replication protein A1 [Source:MGI Symbol;Acc:MGI:... [more]
Rpa12.159e-10540.05replication protein A1 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Replication protein A subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NY74|RFA1_DANRE3.970e-12835.08Replication protein A 70 kDa DNA-binding subunit O... [more]
sp|Q5ZJJ2|RFA1_CHICK4.159e-12534.55Replication protein A 70 kDa DNA-binding subunit O... [more]
sp|Q01588|RFA1_XENLA3.048e-11532.16Replication protein A 70 kDa DNA-binding subunit O... [more]
sp|Q5FW17|RFA1_XENTR7.737e-11332.11Replication protein A 70 kDa DNA-binding subunit O... [more]
sp|P27694|RFA1_HUMAN3.119e-11240.97Replication protein A 70 kDa DNA-binding subunit O... [more]
back to top
BLAST of Replication protein A subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3T2Y42.370e-13536.90Replication protein A subunit OS=Rodentolepis nana... [more]
A0A293LLH69.702e-13535.81Replication protein A subunit (Fragment) OS=Ornith... [more]
A0A2R5LE873.136e-13435.04Replication protein A subunit OS=Ornithodoros turi... [more]
V5IEU72.034e-13236.26Replication protein A subunit OS=Ixodes ricinus OX... [more]
A0A224Z7G63.255e-13237.77Replication protein A subunit OS=Rhipicephalus zam... [more]
back to top
BLAST of Replication protein A subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpa15.781e-12534.00replication protein A1 [Source:NCBI gene;Acc:10302... [more]
rpa13.506e-12435.45replication protein A1 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of Replication protein A subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000008983.11.993e-3931.88pep scaffold:Pmarinus_7.0:GL483239:38:3891:1 gene:... [more]
ENSPMAT00000008701.17.921e-3333.97pep scaffold:Pmarinus_7.0:GL483250:7082:14431:-1 g... [more]
back to top
BLAST of Replication protein A subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RFA19.643e-8233.26Subunit of heterotrimeric Replication Protein A (R... [more]
back to top
BLAST of Replication protein A subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO361192.406e-12533.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO257263.456e-2545.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Replication protein A subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpa11.882e-12434.63replication protein A1 [Source:NCBI gene;Acc:10116... [more]
RPA17.793e-11040.78replication protein A 70 kDa DNA-binding subunit [... [more]
back to top
BLAST of Replication protein A subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000005326.10.000e+096.73SMESG000005326.1[more]
SMESG000005326.10.000e+098.87SMESG000005326.1[more]
SMESG000045678.16.865e-4399.41SMESG000045678.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012234 ID=SMED30012234|Name=Replication protein A subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1772bp
TTTTTTTTAAATTCATGTTATGGTGCTTACTAAAGGATCTTTAGAATCTA
TTATTAATGGAGTCCAAGTACCTGATCCAATTTTCAAAATATTGGCATTT
AAAGGTATGGCTTCAAACAGTGGTGAACCACGATATCGATTGCATGTTAC
CGATGGAGTTACAGATCATACATATGTCATGCTAGCAACTCAATTAAATA
AATACATAGATTCAAATAGAATTCAACCAGGTGCTATTATCAAGCTTGAT
AAATATATGGTTAATTTCAAAGATGAAAAGAAAATAATAGTTCTTCTGGA
TATAAGTTTTATTGATGAGCAAAATAATATCACAAATTCATCCAGTATTC
CAAAGCTTGTAGTTGAAAGTGTTCCAACAGTTCCTGTAATTACACCACAA
ACCACAACTAGAATTAACCCAGCAAATATTACCCCGATTAGTCATATAAA
TCCCTATCAAAATCGTTGGACTATTCAAGGTCGTGTATCTCAAAAATCGG
CCATTAAAACATGGACAAATGCTAGAGGAGATGGAAAGTTATTCAGTTTT
GTGTTGTGTGACAATTCGTGCGACATCAAAATTGCAGCCTTCAACAATGA
AGTTACACAATTTTTCGACATGGTCCAACTCGGAAAAACATACTCAATTT
CTAAAGGCTCTGTTAAAGCTGCAAATGTGAAGTTCAACAATACAAAATGC
GAGTTTGAAATCCATCTGAATGCGGAATCGGACGTCCATGAGATTGAGGA
TAGAAAAGAATATTCGGAAATGCAATATGATTTTGTTTCCATTTTGGAGA
TATCGAACGTTCCGGTCGATACATTTATTGATATTGTCGGAATCGCTCAA
GAAGTAATGGATATCTCTACCATTACCAACAAGACTACTAATAAAGAAAC
AATGAAAAGAGATGTAGTACTGGTTGATAGATCTGGATCCAGCATAAGAA
TGACGCTGTGGGGGGAAGATACCAAACGGTTGGACAATTTAGACCACCCG
GTCATTGTGGTAAAGGGGGCCATCGTTAAGGAGTTTTTTGGGAAAACAGT
TTCATGCGGCAATAATTCCACAATTCTCATAAATCCAAGCAATATCCCGG
AAGCAATGGCTCTCGTGGGGTGGTATGATGAGTGTGGCAGCACACTTTCC
TTCCAAGGTCAACAAAGTACATTGGGAGGTCTGCAAGTACCAACTAAAAT
GGGAACAATTTCCGAATTGGTTTGCAGTGGAAATGCAGAGAAACCCGATT
ATTTCTCCATTTCAGCCGCGGTTTGTCAGTTCCGACGAGATAGGGTTGTC
TACAAGGCTTGCCCAGTCGAGAAATGCAACAAAAAACTAATCGATTTGAC
CAATGGCCTTTATAAATGCGAGAAATGTGAAACGGAAAAGGCTGAATTCA
GTTTCAGAATGTTATTGAGTATGGAGATTGTCGATTTTTCCGGACCGGTC
TGGGCCACTGCATTTCAAGAAATCGGTCAACTGGTACTTGGGAACTCTGC
TGATGACGTGGGCAACATGTTCGAGCTTGAGAGAAAAGATGAAATCGCAA
ACATGTTCGAGGAAGCCCTTTACAAGGAGTTCAATTTCAAATTGAAAGTG
AAAAATGAATCTTTCAATGATGAAACACGAATGAAGGTGACAGTAATCGA
TGCCAAGGAGATAAATTATGTCGAAGAAATCAAGAGAATTATGAGTCTGA
TCTGAATAAGATTTATATTTTTTGCATTTATAGATTTGTGTTAAAAATAA
ATTGTTTTGTGTTTTAAAAAAA
back to top

protein sequence of SMED30012234-orf-1

>SMED30012234-orf-1 ID=SMED30012234-orf-1|Name=SMED30012234-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=562bp
MVLTKGSLESIINGVQVPDPIFKILAFKGMASNSGEPRYRLHVTDGVTDH
TYVMLATQLNKYIDSNRIQPGAIIKLDKYMVNFKDEKKIIVLLDISFIDE
QNNITNSSSIPKLVVESVPTVPVITPQTTTRINPANITPISHINPYQNRW
TIQGRVSQKSAIKTWTNARGDGKLFSFVLCDNSCDIKIAAFNNEVTQFFD
MVQLGKTYSISKGSVKAANVKFNNTKCEFEIHLNAESDVHEIEDRKEYSE
MQYDFVSILEISNVPVDTFIDIVGIAQEVMDISTITNKTTNKETMKRDVV
LVDRSGSSIRMTLWGEDTKRLDNLDHPVIVVKGAIVKEFFGKTVSCGNNS
TILINPSNIPEAMALVGWYDECGSTLSFQGQQSTLGGLQVPTKMGTISEL
VCSGNAEKPDYFSISAAVCQFRRDRVVYKACPVEKCNKKLIDLTNGLYKC
EKCETEKAEFSFRMLLSMEIVDFSGPVWATAFQEIGQLVLGNSADDVGNM
FELERKDEIANMFEEALYKEFNFKLKVKNESFNDETRMKVTVIDAKEINY
VEEIKRIMSLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003676nucleic acid binding
GO:0003677DNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR004591Rfa1
IPR004365NA-bd_OB_tRNA
IPR031657REPA_OB_2
IPR007199Rep_factor-A_N
IPR013955Rep_factor-A_C
IPR012340NA-bd_OB-fold
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006281DNA repair
GO:0006310DNA recombination
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 135..245
e-value: 2.5E-35
score: 122.8
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 382..561
e-value: 3.3E-51
score: 175.3
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 247..381
e-value: 7.4E-34
score: 118.3
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 2..114
e-value: 2.0E-24
score: 87.6
NoneNo IPR availablePANTHERPTHR23273:SF4REPLICATION PROTEIN A 70 KDA DNA-BINDING SUBUNITcoord: 21..556
NoneNo IPR availablePANTHERPTHR23273REPLICATION FACTOR A 1, RFA1coord: 21..556
NoneNo IPR availableCDDcd04475RPA1_DBD_Bcoord: 270..370
e-value: 1.12654E-31
score: 115.759
NoneNo IPR availableCDDcd04474RPA1_DBD_Acoord: 139..241
e-value: 1.43226E-38
score: 135.067
IPR013955Replication factor A, C-terminalPFAMPF08646Rep_fac-A_Ccoord: 411..556
e-value: 4.7E-43
score: 146.4
IPR013955Replication factor A, C-terminalCDDcd04476RPA1_DBD_Ccoord: 397..561
e-value: 9.02079E-41
score: 143.217
IPR007199Replication factor-A protein 1, N-terminalPFAMPF04057Rep-A_Ncoord: 3..98
e-value: 7.6E-16
score: 58.0
IPR031657Replication protein A, OB domainPFAMPF16900REPA_OB_2coord: 259..355
e-value: 6.2E-26
score: 90.2
IPR004365OB-fold nucleic acid binding domain, AA-tRNA synthetase-typePFAMPF01336tRNA_anti-codoncoord: 150..234
e-value: 4.0E-9
score: 36.3
IPR004591Replication factor A protein 1TIGRFAMTIGR00617TIGR00617coord: 129..560
e-value: 2.8E-141
score: 469.9
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 252..376
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 404..561
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 135..247
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 3..104