Protein disulfide-isomerase

Overview
NameProtein disulfide-isomerase
Smed IDSMED30012219
Length (bp)2291
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein disulfide-isomerase (SMED30012219) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein disulfide-isomerase (SMED30012219) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein disulfide-isomerase (SMED30012219) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein disulfide-isomerase (SMED30012219) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012219

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30012219SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000048922.1 SMESG000026530.1 SMESG000022236.1 SMESG000021499.1 SMESG000008351.1 SMESG000006220.1 Contig100GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30012219SMESG000076091.1 SMESG000076042.1 SMESG000074857.1 SMESG000069936.1 SMESG000048922.1 SMESG000026530.1 SMESG000022236.1 SMESG000021499.1 SMESG000008351.1 SMESG000006220.1 Contig100GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30012219SMESG000041085.1 Contig100GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30012219SMESG000041085.1 Contig100GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30012219SMESG000041085.1 dd_Smed_v4_426_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30012219SMESG000041085.1 dd_Smed_v4_426_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012219SMESG000041085.1 dd_Smed_v6_426_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30012219SMESG000041085.1 dd_Smed_v6_426_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: PDIA3 (protein disulfide isomerase family A member 3 [Source:HGNC Symbol;Acc:HGNC:4606])

HSP 1 Score: 287.73 bits (735), Expect = 5.893e-88
Identity = 135/247 (54.66%), Postives = 178/247 (72.06%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSP 2148
             G+  H T  N      + L++A Y+VDYEKN KG+NYWRNR++ VAKKF+D+G  ++FA+++ +  + ELS++G+ES       +  R  + +KF M  +FS +   LE+F+ D+    +  YLKSE IPE ND PVKVVVA+NFDEIVN+  KDVLIEFYAPWCGHCK+L PKY+EL +KLS + +IVIAKMDATANDVPSPYEV GFPTIYF+P N K +PK Y  GRE+ D + Y+  EA++P
Sbjct:  241 FGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNP 487          

HSP 2 Score: 191.045 bits (484), Expect = 3.942e-52
Identity = 95/200 (47.50%), Postives = 134/200 (67.00%), Query Frame = 3
Query:    9 SVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNN---IVIFHSKKMANKFEDTQVKY-KGDASEHQIRTWVEENM 596
             ++LVEF+APWCGHCK+LAPEYE AAT LK   P   +AKVDCTA T TC K+GVSGYPTLK+F++G+ A  Y G R+ADGI+ ++  ++GP+S  L+TEE F KF +  D  +VGFF    S+ +  FL  A  L +++RFAHT  E+L  +  Y +N   I++F    + NKFED  V Y +   +  +I+ +++EN+
Sbjct:   46 GLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNE--YDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENI 240          

HSP 3 Score: 70.4774 bits (171), Expect = 5.305e-12
Identity = 41/111 (36.94%), Postives = 64/111 (57.66%), Query Frame = 1
Query: 1840 NFDEIVNDPTKD--VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI---ASEASSPLK 2154
            NF+  ++D      +L+EF+APWCGHCK LAP+YE  A +L  +  + +AK+D TAN +  + Y VSG+PT+       +    +Y   R  D ++ ++   A  AS PL+
Sbjct:   34 NFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRL--KGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAG--AYDGPRTADGIVSHLKKQAGPASVPLR 140          

HSP 4 Score: 65.0846 bits (157), Expect = 2.857e-10
Identity = 31/63 (49.21%), Postives = 40/63 (63.49%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            E+  +L+EFYAPWCGHCK L P+Y+     L K DP I IAK+D TA       + V G+PT+
Sbjct:  393 ENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSK-DPNIVIAKMDATA-NDVPSPYEVRGFPTI 453          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: PDIA4 (protein disulfide isomerase family A member 4 [Source:HGNC Symbol;Acc:HGNC:30167])

HSP 1 Score: 199.519 bits (506), Expect = 4.043e-54
Identity = 111/249 (44.58%), Postives = 155/249 (62.25%), Query Frame = 1
Query: 1411 SMGLAGHRTHSN-VKYFAKRPLIVALYNVDYEKNPKG-TNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKM-IADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSP-YEVSGFPTIYFAPKNSKHSPKSYSSG-REVDDMLKYIASEAS 2142
            ++ L GHR  SN  K + +RPL+V  Y+VD+  + +  T +WR+++L+VAK F +      FAI++ ++   E+ + G+ S     V     DE  +KF M   +F  + L +F+  F + K+   +KS+ +P+ N  PVKVVV K FD IV DP KDVLIEFYAPWCGHCK L P Y  LAKK   +  +VIAKMDATANDVPS  Y+V GFPTIYFAP   K +P  +  G R+++ + K+I   A+
Sbjct:  394 ALPLVGHRKVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPE----YTFAIADEEDYAGEVKDLGL-SESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHAT 637          

HSP 2 Score: 169.859 bits (429), Expect = 7.598e-44
Identity = 82/174 (47.13%), Postives = 112/174 (64.37%), Query Frame = 3
Query:   12 VILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPV-VVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNY-KNNIVIFHSKKMANKFE 527
            +ILVEFYAPWCGHCKKLAPEYE AA  L K+ PPI +AKVD TAET   ++  VSGYPTLK+F+ G+  +DY+G R   GI+ YM+ +SGP SKE+ T +   +F    D V ++G F  ES   Y+ +   A  L ED++F HTF   ++  L   +  +V+   +K  +K+E
Sbjct:  196 IILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGR-PYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFLKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQGQLVVMQPEKFQSKYE 368          

HSP 3 Score: 112.079 bits (279), Expect = 6.001e-25
Identity = 54/126 (42.86%), Postives = 77/126 (61.11%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKE------LKTEENFNKFTASADPVVVGFF 362
            +   +L+EFYAPWCGHCK+ APEYE  A  LK +DPPI +AK+D T+ +    +  VSGYPT+K+ K GQ A DY G R+ + I+  +   S P          + T+ENF++    AD ++V F+
Sbjct:   78 DKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQ-AVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFY 202          

HSP 4 Score: 93.2041 bits (230), Expect = 5.806e-19
Identity = 58/136 (42.65%), Postives = 84/136 (61.76%), Query Frame = 1
Query: 1759 QEKVPVYLKSESIPEKNDEP-VKVVVAK-NFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLK 2154
            QE++   ++  S P+    P V +V+ K NFDE+VND    +L+EFYAPWCGHCK LAP+YE+ AK+LS  S  I +AK+DATA  D+   ++VSG+PT+       K  P  Y+  RE   ++ Y+  ++  P K
Sbjct:  157 QEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVND-ADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIF---RKGRPYDYNGPREKYGIVDYMIEQSGPPSK 288          

HSP 5 Score: 73.1738 bits (178), Expect = 9.932e-13
Identity = 42/79 (53.16%), Postives = 54/79 (68.35%), Query Frame = 1
Query: 1819 VKVVVAKNFDEIVNDPTKD-VLIEFYAPWCGHCKSLAPKYEELAKKL-SAESDIVIAKMDATANDV-PSPYEVSGFPTI 2046
            V V+   NFD  V D  KD VL+EFYAPWCGHCK  AP+YE++A  L   +  I +AK+DAT+  V  S ++VSG+PTI
Sbjct:   64 VLVLNDANFDNFVAD--KDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTI 140          

HSP 6 Score: 63.929 bits (154), Expect = 8.984e-10
Identity = 28/59 (47.46%), Postives = 38/59 (64.41%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCK+L P Y   A   K Q   + IAK+D TA     +++ V G+PT+
Sbjct:  547 VLIEFYAPWCGHCKQLEPVYNSLAKKYKGQK-GLVIAKMDATANDVPSDRYKVEGFPTI 604          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: PDIA4 (protein disulfide isomerase family A member 4 [Source:HGNC Symbol;Acc:HGNC:30167])

HSP 1 Score: 199.519 bits (506), Expect = 4.099e-54
Identity = 111/249 (44.58%), Postives = 155/249 (62.25%), Query Frame = 1
Query: 1411 SMGLAGHRTHSN-VKYFAKRPLIVALYNVDYEKNPKG-TNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKM-IADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSP-YEVSGFPTIYFAPKNSKHSPKSYSSG-REVDDMLKYIASEAS 2142
            ++ L GHR  SN  K + +RPL+V  Y+VD+  + +  T +WR+++L+VAK F +      FAI++ ++   E+ + G+ S     V     DE  +KF M   +F  + L +F+  F + K+   +KS+ +P+ N  PVKVVV K FD IV DP KDVLIEFYAPWCGHCK L P Y  LAKK   +  +VIAKMDATANDVPS  Y+V GFPTIYFAP   K +P  +  G R+++ + K+I   A+
Sbjct:  393 ALPLVGHRKVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPE----YTFAIADEEDYAGEVKDLGL-SESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHAT 636          

HSP 2 Score: 169.859 bits (429), Expect = 8.818e-44
Identity = 85/195 (43.59%), Postives = 120/195 (61.54%), Query Frame = 3
Query:   12 VILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPV-VVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNY-KNNIVIFHSKKMANKFEDT--QVKYKGDASEHQIRTWV 584
            +ILVEFYAPWCGHCKKLAPEYE AA  L K+ PPI +AKVD TAET   ++  VSGYPTLK+F+ G+  +DY+G R   GI+ YM+ +SGP SKE+ T +   +F    D V ++G F  ES   Y+ +   A  L ED++F HTF   ++  L   +  +V+   +K  +K+E     +  +G   +  I+ +V
Sbjct:  196 IILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGR-PYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFLKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQGQLVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFV 389          

HSP 3 Score: 111.694 bits (278), Expect = 7.926e-25
Identity = 54/126 (42.86%), Postives = 77/126 (61.11%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKE------LKTEENFNKFTASADPVVVGFF 362
            +   +L+EFYAPWCGHCK+ APEYE  A  LK +DPPI +AK+D T+ +    +  VSGYPT+K+ K GQ A DY G R+ + I+  +   S P          + T+ENF++    AD ++V F+
Sbjct:   78 DKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQ-AVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFY 202          

HSP 4 Score: 93.2041 bits (230), Expect = 5.946e-19
Identity = 58/136 (42.65%), Postives = 84/136 (61.76%), Query Frame = 1
Query: 1759 QEKVPVYLKSESIPEKNDEP-VKVVVAK-NFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLK 2154
            QE++   ++  S P+    P V +V+ K NFDE+VND    +L+EFYAPWCGHCK LAP+YE+ AK+LS  S  I +AK+DATA  D+   ++VSG+PT+       K  P  Y+  RE   ++ Y+  ++  P K
Sbjct:  157 QEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVND-ADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIF---RKGRPYDYNGPREKYGIVDYMIEQSGPPSK 288          

HSP 5 Score: 73.1738 bits (178), Expect = 1.000e-12
Identity = 42/79 (53.16%), Postives = 54/79 (68.35%), Query Frame = 1
Query: 1819 VKVVVAKNFDEIVNDPTKD-VLIEFYAPWCGHCKSLAPKYEELAKKL-SAESDIVIAKMDATANDV-PSPYEVSGFPTI 2046
            V V+   NFD  V D  KD VL+EFYAPWCGHCK  AP+YE++A  L   +  I +AK+DAT+  V  S ++VSG+PTI
Sbjct:   64 VLVLNDANFDNFVAD--KDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTI 140          

HSP 6 Score: 63.5438 bits (153), Expect = 1.012e-9
Identity = 28/59 (47.46%), Postives = 38/59 (64.41%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCK+L P Y   A   K Q   + IAK+D TA     +++ V G+PT+
Sbjct:  546 VLIEFYAPWCGHCKQLEPVYNSLAKKYKGQK-GLVIAKMDATANDVPSDRYKVEGFPTI 603          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: P4HB (prolyl 4-hydroxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8548])

HSP 1 Score: 132.88 bits (333), Expect = 4.618e-32
Identity = 72/199 (36.18%), Postives = 113/199 (56.78%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAF--DYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNY-KNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEEN 593
            H  +LVEFYAPWCGHCK LAPEY  AA  LK +   I +AKVD T E+   +++GV GYPT+K F+NG  A   +Y+  R AD I+ ++  ++GP++  L           S++  V+GFF    SD  K FL  AE ++ D  F  T +  + +K    K+ +V+F       KF++ +  ++G+ ++  +  +++ N
Sbjct:   41 HKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAID-DIPFGITSNSDVFSKYQLDKDGVVLF------KKFDEGRNNFEGEVTKENLLDFIKHN 232          

HSP 2 Score: 124.79 bits (312), Expect = 1.993e-29
Identity = 69/190 (36.32%), Postives = 114/190 (60.00%), Query Frame = 1
Query: 1573 GKSIHFAISNVQEMNQELSEY-GIESPDFSKVYITARDERNQKFKMIAD-FSMENLEKFINDFLQEKVPVYLKSESIPEKND-EPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIAS 2133
            GK +   I +    NQ + E+ G++  +   V +   +E   K+K  ++  + E + +F + FL+ K+  +L S+ +PE  D +PVKV+V KNF+++  D  K+V +EFYAPWCGHCK LAP +++L +      +IVIAKMD+TAN+V +  +V  FPT+ F P ++  +   Y+  R +D   K++ S
Sbjct:  284 GKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEA-VKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLES 472          

HSP 3 Score: 100.138 bits (248), Expect = 2.200e-21
Identity = 54/112 (48.21%), Postives = 74/112 (66.07%), Query Frame = 1
Query: 1798 PEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAE-SDIVIAKMDAT-ANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI 2127
            PE+ D  V V+   NF E +    K +L+EFYAPWCGHCK+LAP+Y + A KL AE S+I +AK+DAT  +D+   Y V G+PTI F       SPK Y++GRE DD++ ++
Sbjct:   20 PEEEDH-VLVLRKSNFAEALA-AHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWL 129          

HSP 4 Score: 71.2478 bits (173), Expect = 3.611e-12
Identity = 39/88 (44.32%), Postives = 51/88 (57.95%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG--QFAFDYSGERSADGIIKYMVS 272
            + VEFYAPWCGHCK+LAP ++      K  +  I IAK+D TA     E   V  +PTLK F     +   DY+GER+ DG  K++ S
Sbjct:  388 VFVEFYAPWCGHCKQLAPIWDKLGETYKDHE-NIVIAKMDSTA--NEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLES 472          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: P4HB (prolyl 4-hydroxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8548])

HSP 1 Score: 124.79 bits (312), Expect = 3.422e-31
Identity = 69/190 (36.32%), Postives = 114/190 (60.00%), Query Frame = 1
Query: 1573 GKSIHFAISNVQEMNQELSEY-GIESPDFSKVYITARDERNQKFKMIAD-FSMENLEKFINDFLQEKVPVYLKSESIPEKND-EPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIAS 2133
            GK +   I +    NQ + E+ G++  +   V +   +E   K+K  ++  + E + +F + FL+ K+  +L S+ +PE  D +PVKV+V KNF+++  D  K+V +EFYAPWCGHCK LAP +++L +      +IVIAKMD+TAN+V +  +V  FPT+ F P ++  +   Y+  R +D   K++ S
Sbjct:   50 GKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEA-VKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLES 238          

HSP 2 Score: 72.0182 bits (175), Expect = 4.129e-13
Identity = 39/88 (44.32%), Postives = 51/88 (57.95%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG--QFAFDYSGERSADGIIKYMVS 272
            + VEFYAPWCGHCK+LAP ++      K  +  I IAK+D TA     E   V  +PTLK F     +   DY+GER+ DG  K++ S
Sbjct:  154 VFVEFYAPWCGHCKQLAPIWDKLGETYKDHE-NIVIAKMDSTA--NEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLES 238          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-3 (pep chromosome:WBcel235:I:7015912:7021743:-1 gene:WBGene00003964.1 transcript:H06O01.1.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pdi-3)

HSP 1 Score: 258.455 bits (659), Expect = 1.835e-77
Identity = 126/258 (48.84%), Postives = 179/258 (69.38%), Query Frame = 1
Query: 1411 SMGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRK 2184
            ++G AG RT  N+  F ++P+++  YNVDY K+PKG+NYWRNR+LKVA+ +    + + FA+SN +E + E+   G+     S   I A      K+ M  +FS++NL++F+++ L      Y+KSE IP++  + VKV V KNF E++ D  KDVLIEFYAPWCGHCKSLAPKYEELA+KL+ E D++IAKMDATANDVP  +EV GFPT+++ PKN+K +P  Y+ GREV D + +I+  ++  LK F R G+ +K
Sbjct:  232 TVGFAGIRTQGNLFQFEQKPIVIVYYNVDYVKDPKGSNYWRNRVLKVAQNY---KRKVQFAVSNKEEFSSEIETNGLGERKDSDKPIVAILTNEGKYPMDQEFSVDNLQQFVDEVLAGNAEPYMKSEPIPDEQGD-VKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKE-DVIIAKMDATANDVPPMFEVRGFPTLFWLPKNAKSNPIPYNGGREVKDFVSFISKHSTDGLKGFSRDGKKKK 484          

HSP 2 Score: 212.231 bits (539), Expect = 1.754e-60
Identity = 110/237 (46.41%), Postives = 148/237 (62.45%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM*VNYVQIRXXXXXXXXXXKP*TLI---GRHVLTNKGHHKW 707
            H + LV+FYAPWCGHCKK+APEYE AA  L   DPP+A+ KVDCT E   C+K GV G+PTLK+F+NG  A DY G R ADGI+K+M  +SGPSSKELKT   F KFT   + VV+GFF SES  L  ++L VA+   + F FAHT ++ +  K  Y +++V+F  KK+ NKF+  + KY G+    +I+ ++     V +  IR    L  F  KP  ++     +V   KG + W
Sbjct:   37 HDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGPSSKELKTVAEFEKFTGGDENVVIGFFESESK-LKDSYLKVADTERDRFSFAHTSNKDIIKKAGYSDDVVVFVPKKLHNKFDTNEFKYDGNYDTDKIKNFLVHET-VGFAGIRTQGNLFQFEQKPIVIVYYNVDYVKDPKGSNYW 271          

HSP 3 Score: 68.5514 bits (166), Expect = 9.538e-12
Identity = 36/104 (34.62%), Postives = 61/104 (58.65%), Query Frame = 1
Query: 1840 NFDEIVNDPTKDV-LIEFYAPWCGHCKSLAPKYEELAKKLSA-ESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            NFD+++   T D+ L++FYAPWCGHCK +AP+YE  A KL++ +  + + K+D T    V   + V GFPT+      +    + Y   R+ D ++K++  ++ 
Sbjct:   29 NFDDLIQ--THDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIF--RNGVPAQDYDGPRDADGIVKFMRGQSG 128          

HSP 4 Score: 66.2402 bits (160), Expect = 4.744e-11
Identity = 32/59 (54.24%), Postives = 39/59 (66.10%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCK LAP+YE  A  L K+D  + IAK+D TA         V G+PTL
Sbjct:  383 VLIEFYAPWCGHCKSLAPKYEELAEKLNKED--VIIAKMDATA-NDVPPMFEVRGFPTL 438          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-3 (pep chromosome:WBcel235:I:7015912:7020790:-1 gene:WBGene00003964.1 transcript:H06O01.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pdi-3)

HSP 1 Score: 258.455 bits (659), Expect = 1.835e-77
Identity = 126/258 (48.84%), Postives = 179/258 (69.38%), Query Frame = 1
Query: 1411 SMGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRK 2184
            ++G AG RT  N+  F ++P+++  YNVDY K+PKG+NYWRNR+LKVA+ +    + + FA+SN +E + E+   G+     S   I A      K+ M  +FS++NL++F+++ L      Y+KSE IP++  + VKV V KNF E++ D  KDVLIEFYAPWCGHCKSLAPKYEELA+KL+ E D++IAKMDATANDVP  +EV GFPT+++ PKN+K +P  Y+ GREV D + +I+  ++  LK F R G+ +K
Sbjct:  232 TVGFAGIRTQGNLFQFEQKPIVIVYYNVDYVKDPKGSNYWRNRVLKVAQNY---KRKVQFAVSNKEEFSSEIETNGLGERKDSDKPIVAILTNEGKYPMDQEFSVDNLQQFVDEVLAGNAEPYMKSEPIPDEQGD-VKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKE-DVIIAKMDATANDVPPMFEVRGFPTLFWLPKNAKSNPIPYNGGREVKDFVSFISKHSTDGLKGFSRDGKKKK 484          

HSP 2 Score: 212.231 bits (539), Expect = 1.754e-60
Identity = 110/237 (46.41%), Postives = 148/237 (62.45%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM*VNYVQIRXXXXXXXXXXKP*TLI---GRHVLTNKGHHKW 707
            H + LV+FYAPWCGHCKK+APEYE AA  L   DPP+A+ KVDCT E   C+K GV G+PTLK+F+NG  A DY G R ADGI+K+M  +SGPSSKELKT   F KFT   + VV+GFF SES  L  ++L VA+   + F FAHT ++ +  K  Y +++V+F  KK+ NKF+  + KY G+    +I+ ++     V +  IR    L  F  KP  ++     +V   KG + W
Sbjct:   37 HDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGPSSKELKTVAEFEKFTGGDENVVIGFFESESK-LKDSYLKVADTERDRFSFAHTSNKDIIKKAGYSDDVVVFVPKKLHNKFDTNEFKYDGNYDTDKIKNFLVHET-VGFAGIRTQGNLFQFEQKPIVIVYYNVDYVKDPKGSNYW 271          

HSP 3 Score: 68.5514 bits (166), Expect = 9.538e-12
Identity = 36/104 (34.62%), Postives = 61/104 (58.65%), Query Frame = 1
Query: 1840 NFDEIVNDPTKDV-LIEFYAPWCGHCKSLAPKYEELAKKLSA-ESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            NFD+++   T D+ L++FYAPWCGHCK +AP+YE  A KL++ +  + + K+D T    V   + V GFPT+      +    + Y   R+ D ++K++  ++ 
Sbjct:   29 NFDDLIQ--THDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIF--RNGVPAQDYDGPRDADGIVKFMRGQSG 128          

HSP 4 Score: 66.2402 bits (160), Expect = 4.744e-11
Identity = 32/59 (54.24%), Postives = 39/59 (66.10%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCK LAP+YE  A  L K+D  + IAK+D TA         V G+PTL
Sbjct:  383 VLIEFYAPWCGHCKSLAPKYEELAEKLNKED--VIIAKMDATA-NDVPPMFEVRGFPTL 438          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-3 (pep chromosome:WBcel235:I:7015912:7020797:-1 gene:WBGene00003964.1 transcript:H06O01.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pdi-3)

HSP 1 Score: 258.455 bits (659), Expect = 1.835e-77
Identity = 126/258 (48.84%), Postives = 179/258 (69.38%), Query Frame = 1
Query: 1411 SMGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRK 2184
            ++G AG RT  N+  F ++P+++  YNVDY K+PKG+NYWRNR+LKVA+ +    + + FA+SN +E + E+   G+     S   I A      K+ M  +FS++NL++F+++ L      Y+KSE IP++  + VKV V KNF E++ D  KDVLIEFYAPWCGHCKSLAPKYEELA+KL+ E D++IAKMDATANDVP  +EV GFPT+++ PKN+K +P  Y+ GREV D + +I+  ++  LK F R G+ +K
Sbjct:  232 TVGFAGIRTQGNLFQFEQKPIVIVYYNVDYVKDPKGSNYWRNRVLKVAQNY---KRKVQFAVSNKEEFSSEIETNGLGERKDSDKPIVAILTNEGKYPMDQEFSVDNLQQFVDEVLAGNAEPYMKSEPIPDEQGD-VKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKE-DVIIAKMDATANDVPPMFEVRGFPTLFWLPKNAKSNPIPYNGGREVKDFVSFISKHSTDGLKGFSRDGKKKK 484          

HSP 2 Score: 212.231 bits (539), Expect = 1.754e-60
Identity = 110/237 (46.41%), Postives = 148/237 (62.45%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM*VNYVQIRXXXXXXXXXXKP*TLI---GRHVLTNKGHHKW 707
            H + LV+FYAPWCGHCKK+APEYE AA  L   DPP+A+ KVDCT E   C+K GV G+PTLK+F+NG  A DY G R ADGI+K+M  +SGPSSKELKT   F KFT   + VV+GFF SES  L  ++L VA+   + F FAHT ++ +  K  Y +++V+F  KK+ NKF+  + KY G+    +I+ ++     V +  IR    L  F  KP  ++     +V   KG + W
Sbjct:   37 HDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGPSSKELKTVAEFEKFTGGDENVVIGFFESESK-LKDSYLKVADTERDRFSFAHTSNKDIIKKAGYSDDVVVFVPKKLHNKFDTNEFKYDGNYDTDKIKNFLVHET-VGFAGIRTQGNLFQFEQKPIVIVYYNVDYVKDPKGSNYW 271          

HSP 3 Score: 68.5514 bits (166), Expect = 9.538e-12
Identity = 36/104 (34.62%), Postives = 61/104 (58.65%), Query Frame = 1
Query: 1840 NFDEIVNDPTKDV-LIEFYAPWCGHCKSLAPKYEELAKKLSA-ESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            NFD+++   T D+ L++FYAPWCGHCK +AP+YE  A KL++ +  + + K+D T    V   + V GFPT+      +    + Y   R+ D ++K++  ++ 
Sbjct:   29 NFDDLIQ--THDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIF--RNGVPAQDYDGPRDADGIVKFMRGQSG 128          

HSP 4 Score: 66.2402 bits (160), Expect = 4.744e-11
Identity = 32/59 (54.24%), Postives = 39/59 (66.10%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCK LAP+YE  A  L K+D  + IAK+D TA         V G+PTL
Sbjct:  383 VLIEFYAPWCGHCKSLAPKYEELAEKLNKED--VIIAKMDATA-NDVPPMFEVRGFPTL 438          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: C14B9.2 (Probable protein disulfide-isomerase A4 [Source:UniProtKB/Swiss-Prot;Acc:P34329])

HSP 1 Score: 173.711 bits (439), Expect = 1.137e-45
Identity = 106/261 (40.61%), Postives = 151/261 (57.85%), Query Frame = 1
Query: 1411 SMGLAGHRTHSNV-KYFAKRPLIVALYNVDYE-KNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFS-KVYITARDERNQKFKMIAD-FSME---NLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKL-SAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQ 2169
            S  L G  T  N    + K+PL+V  YN D+  +  +G+ YWR+++L +A+K+        FA+++ +E  +EL E G+        V +   D   +K+ M  D F  E   NLE F+      K   ++KS   P+ +  PVK VV  NFD+IVND +KDVLIEFYAPWCGHCKS   KY ELA+ L   + ++V+AKMDAT ND PS + V GFPTIYFAP   K  P  YS  R+++D+ K++       +K+F ++
Sbjct:  362 SAPLVGKMTKKNAATRYTKKPLVVVYYNADFSVQYREGSEYWRSKVLNIAQKY--QKDKYKFAVADEEEFAKELEELGLGDSGLEHNVVVFGYD--GKKYPMNPDEFDGELDENLEAFMKQISSGKAKAHVKSAPAPKDDKGPVKTVVGSNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQALKKTQPNVVLAKMDATINDAPSQFAVEGFPTIYFAPAGKKSEPIKYSGNRDLEDLKKFMTKHG---VKSFQKK 615          

HSP 2 Score: 163.696 bits (413), Expect = 2.878e-42
Identity = 84/182 (46.15%), Postives = 115/182 (63.19%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFR-FAHTFDETLSTKLNYK-NNIVIFHSKKMANKFEDTQVKY 545
            + ++LVEFYAPWCGHCKKLAPEYE AA  LK Q   + + KVD T E     K+GVSGYPT+K+ +NG+  FDY+G R A GIIKYM  +S P++K+L   ++  +F +  D  ++GFF +E S  ++AF   AE L E+F+   HT D     K + K N+I+IF+     +KFE     Y
Sbjct:  164 NELVLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDATIEKDLGTKYGVSGYPTMKIIRNGR-RFDYNGPREAAGIIKYMTDQSKPAAKKLPKLKDVERFMSKDDVTIIGFFATEDSTAFEAFSDSAEMLREEFKTMGHTSDPAAFKKWDAKPNDIIIFYPSLFHSKFEPKSRTY 344          

HSP 3 Score: 102.064 bits (253), Expect = 3.747e-22
Identity = 52/122 (42.62%), Postives = 77/122 (63.11%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTE------ENFNKFTASADPVVVGFF 362
            +LV+FYAPWCGHCK LAPEYE A++ +      I +AKVD T ET+  ++  + GYPTLK +K+G+   DY G R   GI++++ S+  P+ K    E      ENF+ F ++ + V+V F+
Sbjct:   56 VLVKFYAPWCGHCKHLAPEYEKASSKVS-----IPLAKVDATVETELGKRFEIQGYPTLKFWKDGKGPNDYDGGRDEAGIVEWVESRVDPNYKPPPEEVVTLTTENFDDFISNNELVLVEFY 172          

HSP 4 Score: 83.5741 bits (205), Expect = 2.040e-16
Identity = 44/111 (39.64%), Postives = 70/111 (63.06%), Query Frame = 1
Query: 1813 EPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAE-SDIVIAKMDAT-ANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEA 2139
            E V  +  +NFD+ +++  + VL+EFYAPWCGHCK LAP+YE+ A+KL A+ S + + K+DAT   D+ + Y VSG+PT+       +     Y+  RE   ++KY+  ++
Sbjct:  147 EEVVTLTTENFDDFISN-NELVLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDATIEKDLGTKYGVSGYPTMKIIRNGRRF---DYNGPREAAGIIKYMTDQS 253          

HSP 5 Score: 81.2629 bits (199), Expect = 1.273e-15
Identity = 46/110 (41.82%), Postives = 71/110 (64.55%), Query Frame = 1
Query: 1810 DEPVKVVVAKNFDEIVN-DPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIAS 2133
            DE V V+  KNFD  +  +P+  VL++FYAPWCGHCK LAP+YE+ + K+S    I +AK+DAT   ++   +E+ G+PT+ F  K+ K  P  Y  GR+   +++++ S
Sbjct:   35 DEGVVVLTDKNFDAFLKKNPS--VLVKFYAPWCGHCKHLAPEYEKASSKVS----IPLAKVDATVETELGKRFEIQGYPTLKFW-KDGK-GPNDYDGGRDEAGIVEWVES 136          

HSP 6 Score: 67.781 bits (164), Expect = 1.668e-11
Identity = 40/104 (38.46%), Postives = 56/104 (53.85%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFA--FDYSGERSADGIIKYMVSKSGPSSKELKTE 308
            E   +L+EFYAPWCGHCK    +Y   A ALKK  P + +AK+D T      +   V G+PT+     G+ +    YSG R  + + K+M +K G  S + K E
Sbjct:  516 ESKDVLIEFYAPWCGHCKSFESKYVELAQALKKTQPNVVLAKMDATINDAPSQ-FAVEGFPTIYFAPAGKKSEPIKYSGNRDLEDLKKFM-TKHGVKSFQKKDE 617          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 143.665 bits (361), Expect = 3.165e-36
Identity = 77/194 (39.69%), Postives = 115/194 (59.28%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEEN 593
            ILVEFYAPWCGHCK LAPEY  AAT LK++   I + K+D T   +   K  V GYPTLK+F+NG+   +Y+G R  D II ++  K+GP +K L   +   +   SAD VV+G+F   +SD  K FL VA  ++ D  F  + ++ + +++  K   IV+F       KF+D +V +    ++  ++TW++ N
Sbjct:   43 ILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLFRNGK-PQEYNGGRDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDTTSDDAKTFLEVAAGID-DVPFGISTEDAVKSEIELKGEGIVLFK------KFDDGRVAFDEKLTQDGLKTWIQAN 228          

HSP 2 Score: 132.494 bits (332), Expect = 1.866e-32
Identity = 75/197 (38.07%), Postives = 118/197 (59.90%), Query Frame = 1
Query: 1552 AKKFIDSGKSIHFAISNVQEMNQELSEY-GIESPDFSKVYITARDERNQKFK-MIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDE-PVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIAS 2133
            AK+F   GK +   I+   E N  + E+ G++  +   + + + +E   KFK    + + EN+ KF  ++L   V  +L SE IPE  D+ PVK++V KNF+++  D TK+VL+EFYAPWCGHCK LAP +++L +K + +  IVIAKMD+T N+V    ++  FPTI F P  S +    Y+  R ++   K++ +
Sbjct:  275 AKQF--KGKVLFVYINTDVEENARIMEFFGLKKDELPAIRLISLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGHCKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVED-VKIQSFPTIKFFPAGS-NKVVDYTGDRTIEGFTKFLET 467          

HSP 3 Score: 95.1301 bits (235), Expect = 3.157e-20
Identity = 52/123 (42.28%), Postives = 78/123 (63.41%), Query Frame = 1
Query: 1810 DEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAE-SDIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI---ASEASSPLKNFD 2163
            +E V V+   NFDE++N   + +L+EFYAPWCGHCKSLAP+Y + A +L  E SDI + K+DAT   +V S +EV G+PT+    +N K  P+ Y+ GR+ D ++ ++       + PL + D
Sbjct:   22 EENVIVLTKDNFDEVING-NEFILVEFYAPWCGHCKSLAPEYAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRGYPTLKLF-RNGK--PQEYNGGRDHDSIIAWLKKKTGPVAKPLADAD 140          

HSP 4 Score: 71.2478 bits (173), Expect = 1.310e-12
Identity = 35/85 (41.18%), Postives = 49/85 (57.65%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQF-AFDYSGERSADGIIKYM 266
            +LVEFYAPWCGHCK+LAP ++         D  I IAK+D T      E   +  +PT+K F  G     DY+G+R+ +G  K++
Sbjct:  384 VLVEFYAPWCGHCKQLAPTWDKLGEKF-ADDESIVIAKMDST--LNEVEDVKIQSFPTIKFFPAGSNKVVDYTGDRTIEGFTKFL 465          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: ERp60 (gene:FBgn0033663 transcript:FBtr0088058)

HSP 1 Score: 296.975 bits (759), Expect = 5.952e-92
Identity = 149/261 (57.09%), Postives = 192/261 (73.56%), Query Frame = 1
Query: 1417 GLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDF--SKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRKSDL 2193
            GL GHRT  +VK F + PLI A Y+VDY+KNPKGTNYWRNR+LKVAK+F+     I+FAI++  +   EL+EYG    DF   K  + ARDE+N K+ +  +FS+ENL+ F+   L  ++  Y+KSE IPE ND PVKV VAKNFD++V +  KD LIEFYAPWCGHCK L+P YEELA+KL  E D+ I KMDATANDVP  + V GFPT+++ PK++K+ P SY+ GREVDD LKYIA EA++ LK FDR G+ +K++L
Sbjct:  237 GLVGHRTQDSVKDF-QNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQ---INFAIASKDDFQHELNEYGY---DFVGDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIPESNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDE-DVAIVKMDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEATTELKGFDRSGKPKKTEL 489          

HSP 2 Score: 184.111 bits (466), Expect = 3.342e-50
Identity = 89/198 (44.95%), Postives = 128/198 (64.65%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCT-AETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEEN 593
            +H   LV FYAPWCGHCK+L PEY  AA  +K  DPPI +AKVDCT A  +TC K+ VSGYPTLK+F+  + + DY+G R A GI KYM ++ GP+SK ++T     KF  + D  + G+F+   S L K FL  A+K  E +RF H+ ++ +  K    + IV+  +  ++NKFE + +K++G +SE  + T+V+EN
Sbjct:   38 QHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHSSEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFEG-SSESDLSTFVKEN 234          

HSP 3 Score: 71.2478 bits (173), Expect = 1.344e-12
Identity = 42/91 (46.15%), Postives = 53/91 (58.24%), Query Frame = 3
Query:   18 LVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL----KVFKNGQFAFDYSGERSADGIIKYMVSKS 278
            L+EFYAPWCGHCKKL+P YE  A  L  QD  +AI K+D TA     E   V G+PTL    K  KN   +  Y+G R  D  +KY+  ++
Sbjct:  386 LIEFYAPWCGHCKKLSPIYEELAEKL--QDEDVAIVKMDATANDVPPE-FNVRGFPTLFWLPKDAKNKPVS--YNGGREVDDFLKYIAKEA 471          

HSP 4 Score: 60.077 bits (144), Expect = 4.786e-9
Identity = 32/92 (34.78%), Postives = 51/92 (55.43%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDAT--ANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
             L+ FYAPWCGHCK L P+Y + A+ +  +   I +AK+D T    +  S Y VSG+PT+    ++     + Y+  RE   + KY+ ++  
Sbjct:   42 TLVMFYAPWCGHCKRLKPEYAKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQD--EVSQDYNGPREASGIAKYMRAQVG 131          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0346644)

HSP 1 Score: 132.88 bits (333), Expect = 1.729e-32
Identity = 71/195 (36.41%), Postives = 113/195 (57.95%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVE 587
            ++  +LVEFYAPWCGHCK LAPEY  AA  L +++ PI +AKVD T E +  E++ V GYPTLK F++G    +YSG R A  II ++  K+GP +K+L +  +  +F    +  ++GFF    S+  K F  VA  L+  F F  + +  +  K   K+N V+     +   F+D +  ++G+ +E  ++ + +
Sbjct:   43 DNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGS-PVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDS-FVFGVSSNADVIAKYEAKDNGVV-----LFKPFDDKKSVFEGELNEENLKKFAQ 230          

HSP 2 Score: 126.331 bits (316), Expect = 2.478e-30
Identity = 78/198 (39.39%), Postives = 124/198 (62.63%), Query Frame = 1
Query: 1546 KVAKKFIDSGKSIHFAISNVQEMNQELSEY-GIESPDFSKVYITARDERNQKFKMIAD-FSMENLEKFINDFLQEKVPVYLKSESIPEKNDE-PVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTI-YFAPKNSKHSPKSYSSGREVDDMLKYI 2127
            ++AKK+ D    +   IS+ +E +  + E+ G+   +   + +   +E   K+K  +D  S E +E F+  FL  K+  +L S+ +PE  D+ PVKV+V+ NF+ +  D +K VL+EFYAPWCGHCK LAP Y++LA+K     DIVIAKMD+TAN++ S  ++S FPTI YF  +++K     ++  R +DD +K++
Sbjct:  277 EIAKKYRDD--ILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELES-IKISSFPTIKYFRKEDNK--VIDFNLDRTLDDFVKFL 469          

HSP 3 Score: 92.8189 bits (229), Expect = 2.044e-19
Identity = 49/121 (40.50%), Postives = 74/121 (61.16%), Query Frame = 1
Query: 1804 KNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSA-ESDIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNF 2160
            K +E V V    NF +++ D  + VL+EFYAPWCGHCK+LAP+Y + A++L+  ES I +AK+DAT   ++   Y V G+PT+ F       SP  YS GR+  D++ ++  +   P K+ 
Sbjct:   24 KVEEGVLVATVDNFKQLIAD-NEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSG---SPVEYSGGRQAADIIAWVTKKTGPPAKDL 140          

HSP 4 Score: 71.633 bits (174), Expect = 1.301e-12
Identity = 37/85 (43.53%), Postives = 52/85 (61.18%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVF-KNGQFAFDYSGERSADGIIKYM 266
            +LVEFYAPWCGHCK+LAP Y+  A   K  +  I IAK+D TA     E   +S +PT+K F K      D++ +R+ D  +K++
Sbjct:  388 VLVEFYAPWCGHCKQLAPIYDQLAEKYKDNE-DIVIAKMDSTA--NELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 469          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0075648)

HSP 1 Score: 132.88 bits (333), Expect = 1.729e-32
Identity = 71/195 (36.41%), Postives = 113/195 (57.95%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVE 587
            ++  +LVEFYAPWCGHCK LAPEY  AA  L +++ PI +AKVD T E +  E++ V GYPTLK F++G    +YSG R A  II ++  K+GP +K+L +  +  +F    +  ++GFF    S+  K F  VA  L+  F F  + +  +  K   K+N V+     +   F+D +  ++G+ +E  ++ + +
Sbjct:   43 DNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGS-PVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDS-FVFGVSSNADVIAKYEAKDNGVV-----LFKPFDDKKSVFEGELNEENLKKFAQ 230          

HSP 2 Score: 126.331 bits (316), Expect = 2.478e-30
Identity = 78/198 (39.39%), Postives = 124/198 (62.63%), Query Frame = 1
Query: 1546 KVAKKFIDSGKSIHFAISNVQEMNQELSEY-GIESPDFSKVYITARDERNQKFKMIAD-FSMENLEKFINDFLQEKVPVYLKSESIPEKNDE-PVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTI-YFAPKNSKHSPKSYSSGREVDDMLKYI 2127
            ++AKK+ D    +   IS+ +E +  + E+ G+   +   + +   +E   K+K  +D  S E +E F+  FL  K+  +L S+ +PE  D+ PVKV+V+ NF+ +  D +K VL+EFYAPWCGHCK LAP Y++LA+K     DIVIAKMD+TAN++ S  ++S FPTI YF  +++K     ++  R +DD +K++
Sbjct:  277 EIAKKYRDD--ILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELES-IKISSFPTIKYFRKEDNK--VIDFNLDRTLDDFVKFL 469          

HSP 3 Score: 92.8189 bits (229), Expect = 2.044e-19
Identity = 49/121 (40.50%), Postives = 74/121 (61.16%), Query Frame = 1
Query: 1804 KNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSA-ESDIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNF 2160
            K +E V V    NF +++ D  + VL+EFYAPWCGHCK+LAP+Y + A++L+  ES I +AK+DAT   ++   Y V G+PT+ F       SP  YS GR+  D++ ++  +   P K+ 
Sbjct:   24 KVEEGVLVATVDNFKQLIAD-NEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSG---SPVEYSGGRQAADIIAWVTKKTGPPAKDL 140          

HSP 4 Score: 71.633 bits (174), Expect = 1.301e-12
Identity = 37/85 (43.53%), Postives = 52/85 (61.18%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVF-KNGQFAFDYSGERSADGIIKYM 266
            +LVEFYAPWCGHCK+LAP Y+  A   K  +  I IAK+D TA     E   +S +PT+K F K      D++ +R+ D  +K++
Sbjct:  388 VLVEFYAPWCGHCKQLAPIYDQLAEKYKDNE-DIVIAKMDSTA--NELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 469          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: CG9302 (gene:FBgn0032514 transcript:FBtr0080470)

HSP 1 Score: 88.5817 bits (218), Expect = 6.037e-18
Identity = 41/83 (49.40%), Postives = 55/83 (66.27%), Query Frame = 3
Query:   18 LVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYM 266
            LV FYAPWCGHCK++ PEYE AA  +K++  P  +A +D T E    EK+ V GYPT+K F NG F F+ +  R A  I+++M
Sbjct:  292 LVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFEVN-VREASKIVEFM 373          

HSP 2 Score: 88.1965 bits (217), Expect = 7.731e-18
Identity = 44/97 (45.36%), Postives = 56/97 (57.73%), Query Frame = 3
Query:   18 LVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTE 308
            LV FYAPWCGHCK   PE+  AATAL+  DP IA   +DCT     C K+ V GYPT+  F   +   DY+G R++   I YM   + P +   +TE
Sbjct:  417 LVMFYAPWCGHCKHTKPEFTAAATALQ-DDPRIAFVAIDCTKLAALCAKYNVRGYPTILYFSYLKTKLDYNGGRTSKDFIAYM---NNPPTSADRTE 509          

HSP 3 Score: 71.633 bits (174), Expect = 1.315e-12
Identity = 37/98 (37.76%), Postives = 55/98 (56.12%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPI-AIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMV---SKSGPSSKE 296
            +LV FY PWCG CKK+ PEY  A+T LK +   I A   V+        +   ++G+PTL  F+NG+  F Y GE + + ++ +M+   +K  P  KE
Sbjct:  165 MLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGENNKEALVSFMLNPNAKPTPKPKE 262          

HSP 4 Score: 58.9214 bits (141), Expect = 1.074e-8
Identity = 33/94 (35.11%), Postives = 48/94 (51.06%), Query Frame = 1
Query: 1870 KDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDAT-ANDVPSPYEVSGFPTI-YFAPKNSKHSPKSYSSGREVDDMLKYIASEASS 2145
            K  L+ FYAPWCGHCK   P++   A  L  +  I    +D T    + + Y V G+PTI YF+   +K     Y+ GR   D + Y+ +  +S
Sbjct:  414 KHALVMFYAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDCTKLAALCAKYNVRGYPTILYFSYLKTKL---DYNGGRTSKDFIAYMNNPPTS 504          

HSP 5 Score: 58.9214 bits (141), Expect = 1.300e-8
Identity = 28/77 (36.36%), Postives = 47/77 (61.04%), Query Frame = 1
Query: 1828 VVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATAN-DVPSPYEVSGFPTIYF 2052
            + ++ F+  + D  K  L+ FYAPWCGHCK + P+YE+ A ++  +    ++A +DAT    +   Y+V G+PT+ F
Sbjct:  276 LTSQGFEPALKD-EKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKVKGYPTVKF 351          

HSP 6 Score: 52.373 bits (124), Expect = 1.420e-6
Identity = 28/97 (28.87%), Postives = 51/97 (52.58%), Query Frame = 1
Query: 1786 SESIPEKNDEPVKVVV----AKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAND---VPSPYEVSGFPT-IYF 2052
            S  +P + D   K V+    A +F + +    + +L+ FY PWCG CK + P+Y + + +L  +   ++A M+    +   +   + ++GFPT IYF
Sbjct:  131 SGDLPWEEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYILAAMNVERQENAPIRKMFNITGFPTLIYF 227          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: prtp (gene:FBgn0030329 transcript:FBtr0332954)

HSP 1 Score: 84.7297 bits (208), Expect = 2.908e-17
Identity = 40/88 (45.45%), Postives = 52/88 (59.09%), Query Frame = 3
Query:    9 SVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTA--ETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYM 266
             V  ++FYAPWCGHC+KL P +E  AT   +    + IAKVDCTA    + C    V GYPTL ++KNGQ   +Y G RS   +  Y+
Sbjct:  257 GVAFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQNEYEGSRSLPELQAYL 344          

HSP 2 Score: 73.1738 bits (178), Expect = 1.655e-13
Identity = 35/107 (32.71%), Postives = 58/107 (54.21%), Query Frame = 1
Query: 1867 TKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRK 2184
            T +  ++F+APWC HC+ LAP +E+LAK+L  E  + I+K+D T    +   +EV G+PT+ +     K   + YS  R++  +  Y+      PL+    +  D K
Sbjct:  119 TGNHFVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCTQFRSICQDFEVKGYPTLLWIEDGKK--IEKYSGARDLSTLKTYVEKMVGVPLEKTAGEAGDEK 223          

HSP 3 Score: 72.7886 bits (177), Expect = 2.420e-13
Identity = 35/87 (40.23%), Postives = 50/87 (57.47%), Query Frame = 3
Query:   21 VEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSG 281
            V+F+APWC HC++LAP +E  A  L K +P + I+K+DCT     C+   V GYPTL   ++G+    YSG R    +  Y+    G
Sbjct:  124 VKFFAPWCSHCQRLAPTWEDLAKELIK-EPTVTISKIDCTQFRSICQDFEVKGYPTLLWIEDGKKIEKYSGARDLSTLKTYVEKMVG 209          

HSP 4 Score: 67.781 bits (164), Expect = 1.127e-11
Identity = 33/88 (37.50%), Postives = 50/88 (56.82%), Query Frame = 3
Query:   42 CGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG-QFAFDYSGERSADGIIKYMVSK-SGPSSKEL 299
            CGHCK++ P +E  A  +   +P + IAKVDCT     C  H V+GYPTL++FK G + +  + G R    I  ++  + S P+  +L
Sbjct:    2 CGHCKRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPAEADL 89          

HSP 5 Score: 67.0106 bits (162), Expect = 1.688e-11
Identity = 42/137 (30.66%), Postives = 68/137 (49.64%), Query Frame = 1
Query: 1732 LEKFINDFLQEKVPVY-LKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKL-SAESDIVIAKMDATA---NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI 2127
            LEK   +   EKV +  +  E    K   P ++     FD+ + +      I+FYAPWCGHC+ L P +E+LA +   A+S + IAK+D TA     V    +V G+PT++      + +   Y   R + ++  Y+
Sbjct:  212 LEKTAGEAGDEKVVIEEVAGEEDAAKKLTPQQLTGEDEFDQAIAEGV--AFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDCTAPENKQVCIDQQVEGYPTLFLYKNGQRQN--EYEGSRSLPELQAYL 344          

HSP 6 Score: 49.6766 bits (117), Expect = 7.530e-6
Identity = 25/84 (29.76%), Postives = 51/84 (60.71%), Query Frame = 1
Query: 1903 CGHCKSLAPKYEELAKKLSAES-DIVIAKMDATAND-VPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSP 2148
            CGHCK + P +E+LA+ ++ ++  ++IAK+D T +  + + ++V+G+PT+       + S K +   R++  +  +I  E S+P
Sbjct:    2 CGHCKRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVK-FKGTRDLPAITDFINKELSAP 84          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia3 (protein disulfide isomerase family A, member 3 [Source:ZFIN;Acc:ZDB-GENE-031002-9])

HSP 1 Score: 286.96 bits (733), Expect = 1.985e-88
Identity = 134/248 (54.03%), Postives = 174/248 (70.16%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
             G+  H T  N      + L+VA Y+VDYEKNPKG+NYWRNR++KVAK F+D GK + FA++N    + ++SE G++        +  R  +  K+ M  +FS +   LE+F+ D+    +  YLKSE +PE ND PVKV+VA+NFD IVND +KDVLIEFYAPWCGHCKSL PKY+EL +KLS + +IVIAKMDATANDVPSPYEVSGFPTIYF+P   K +PK Y  GREV D + Y+  EA++ +
Sbjct:  196 FGICAHMTEDNKDQLKGKDLLVAYYDVDYEKNPKGSNYWRNRVMKVAKGFLDQGKKLSFAVANKNRFSHDVSELGLDGSSGELPLVGIRTAKGDKYVMKEEFSRDGKALERFLQDYFDGNLKRYLKSEPVPENNDGPVKVLVAENFDSIVNDDSKDVLIEFYAPWCGHCKSLEPKYKELGEKLSEDPNIVIAKMDATANDVPSPYEVSGFPTIYFSPAGRKQNPKKYEGGREVSDFISYLKREATNTV 443          

HSP 2 Score: 190.274 bits (482), Expect = 1.390e-52
Identity = 94/197 (47.72%), Postives = 131/197 (66.50%), Query Frame = 3
Query:   12 VILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKYKGDA-SEHQIRTWVEENM 596
            +ILVEF+APWCGHCK+LAPEYE AAT LK   P   +AKVDCTA +K C K+GVSGYPTLK+F++G+ +  Y G R+ADGI+ ++  ++GP+S ELK E +F K+    D  VVGFF    S     FL  A  L E +RFAHT +E L  K       I++F S +++NKFED+ V +  D  +  +I+ ++++N+
Sbjct:    2 LILVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LAKVDCTANSKVCGKYGVSGYPTLKIFRDGEDSGGYDGPRTADGIVSHLKKQAGPASVELKNEADFEKYIGDRDASVVGFFADGGSAAQGEFLKAASALRESYRFAHTNNEDLLKKHGIDGEGIILFRSPQLSNKFEDSSVLFTEDKFTSAKIKKFIQDNI 195          

HSP 3 Score: 71.633 bits (174), Expect = 1.347e-12
Identity = 47/127 (37.01%), Postives = 68/127 (53.54%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAND-VPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI---ASEASSPLKN---FDRQGRDRKSDL*KF*FIEIKSSLTG 2235
            +L+EF+APWCGHCK LAP+YE  A +L  +  + +AK+D TAN  V   Y VSG+PT+             Y   R  D ++ ++   A  AS  LKN   F++   DR + +  F F +  S+  G
Sbjct:    3 ILVEFFAPWCGHCKRLAPEYEAAATRL--KGIVPLAKVDCTANSKVCGKYGVSGYPTLKIF--RDGEDSGGYDGPRTADGIVSHLKKQAGPASVELKNEADFEKYIGDRDASVVGF-FADGGSAAQG 124          

HSP 4 Score: 67.3958 bits (163), Expect = 2.926e-11
Identity = 37/86 (43.02%), Postives = 47/86 (54.65%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG--QFAFDYSGERSADGIIKYM 266
            +L+EFYAPWCGHCK L P+Y+     L  +DP I IAK+D TA       + VSG+PT+     G  Q    Y G R     I Y+
Sbjct:  352 VLIEFYAPWCGHCKSLEPKYKELGEKL-SEDPNIVIAKMDATA-NDVPSPYEVSGFPTIYFSPAGRKQNPKKYEGGREVSDFISYL 435          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia7 (protein disulfide isomerase family A, member 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2238])

HSP 1 Score: 273.863 bits (699), Expect = 5.200e-83
Identity = 133/250 (53.20%), Postives = 171/250 (68.40%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSE-YGIESPDFSKV-YITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
            +GL  H T  N     +  L+ A +NVDY +NPKGTNYWRNRI+KVA +F D G  + FA+++ QE   EL E +G+ S +   V  +T R    QK+ M  +F+ +   LEKF+ D+  +++  Y+KSE IPE ND PVKV+VA  FD IVNDP KDVL+EFYAPWCGHCK+L PKY+EL +KLS   +IVIAKMDATANDVP  Y+V GFPTIYF P   K  P+ Y  GREV+D + Y+  EA++PL
Sbjct:  232 LGLCPHMTMENRDTVRESDLLTAFFNVDYLRNPKGTNYWRNRIMKVATQFQDRG--LTFAVADRQEFQDELEEEFGVSSSEGGDVPLVTIRTRAGQKYSMQEEFTRDGKSLEKFLEDYFAKRLKRYVKSEPIPESNDGPVKVLVADTFDAIVNDPEKDVLVEFYAPWCGHCKNLEPKYKELGEKLSGNPNIVIAKMDATANDVPPNYDVQGFPTIYFVPSGQKDQPRRYEGGREVNDFITYLKKEATNPL 479          

HSP 2 Score: 181.415 bits (459), Expect = 3.973e-49
Identity = 87/198 (43.94%), Postives = 126/198 (63.64%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNN-IVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            H  +LVEF+APWCGHC++LAPEYE AAT LK     +A+AKVDCT  ++TCE+ GV+GYPTLK+F+NG+ +  Y G R+ADGI+ YM  ++GPSS  L  E + + F  + +  VVGFF+ E S     FL  +  L + +RFAH+ D     K       +++F   ++++KFED  VKY    S   +  +V++N+
Sbjct:   37 HDTLLVEFFAPWCGHCQRLAPEYEAAATKLKGT---LALAKVDCTVNSETCERFGVNGYPTLKIFRNGEESGAYDGPRTADGIVSYMKKQAGPSSVALLKEADLDGFVDNYEASVVGFFSGEDSAQLAEFLKASSALRDSYRFAHSTDVGAGLKYGVDGECVLLFRPPRLSSKFEDNVVKYTEHLSVSSLHKFVKDNI 231          

HSP 3 Score: 68.5514 bits (166), Expect = 1.525e-11
Identity = 34/90 (37.78%), Postives = 54/90 (60.00%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            +L+EF+APWCGHC+ LAP+YE  A KL     + +AK+D T N +    + V+G+PT+    +N + S  +Y   R  D ++ Y+  +A 
Sbjct:   40 LLVEFFAPWCGHCQRLAPEYEAAATKLKGT--LALAKVDCTVNSETCERFGVNGYPTLKIF-RNGEES-GAYDGPRTADGIVSYMKKQAG 125          

HSP 4 Score: 66.6254 bits (161), Expect = 6.263e-11
Identity = 36/86 (41.86%), Postives = 47/86 (54.65%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQ--FAFDYSGERSADGIIKYM 266
            +LVEFYAPWCGHCK L P+Y+     L   +P I IAK+D TA       + V G+PT+    +GQ      Y G R  +  I Y+
Sbjct:  388 VLVEFYAPWCGHCKNLEPKYKELGEKLSG-NPNIVIAKMDATA-NDVPPNYDVQGFPTIYFVPSGQKDQPRRYEGGREVNDFITYL 471          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia8 (protein disulfide isomerase family A, member 8 [Source:ZFIN;Acc:ZDB-GENE-040801-20])

HSP 1 Score: 244.973 bits (624), Expect = 3.123e-72
Identity = 121/250 (48.40%), Postives = 164/250 (65.60%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSE-YGIESPDFSKV-YITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
             GL  H T  N +   KR L+ A Y++DY  NPKG+NYWRNR+LKVA KF  S + + F+++N  +  +EL E +G+ + D +++ ++T R     K+ M  +F+ +   LE F+ D+   ++  Y+KSE +P  N+  VKVVVA  F+EIVNDP KDVLIEFYAPWCGHCK L PKY  L + L ++ +IVIAKMDAT NDVP+ Y+V GFPTIYFA    K  PK Y   REV D + ++  EA+ PL
Sbjct:  238 FGLCPHMTKDNKEVLRKRDLLTAYYDLDYLHNPKGSNYWRNRVLKVATKF--SSQGMLFSVANRNDFMEELEEEFGLSASDGNELPFVTIRTRTGDKYSMREEFTRDGKSLESFLEDYFAGRLKRYVKSEPVPAINNGVVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTALGEMLYSDPNIVIAKMDATVNDVPAGYDVQGFPTIYFAAAGRKSEPKRYEGAREVKDFVNFLKREATKPL 485          

HSP 2 Score: 184.496 bits (467), Expect = 3.795e-50
Identity = 90/199 (45.23%), Postives = 127/199 (63.82%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            EH  +LV+FYAPWCGHCKKLAPE+E AA+ LK     + +AKVDCTA T+ C+ +GV+GYPTLK+F+NG  +  Y G RSADGI+ YM  ++GP S  L +E +  KF    D  VVG F+   S     FL  A  + E FRFAHT D  L  K    + +I++F + ++++KFE++ V + G  S   +R ++ +N+
Sbjct:   42 EHETLLVKFYAPWCGHCKKLAPEFESAASRLKGT---VTLAKVDCTANTEICKHYGVNGYPTLKIFRNGHESSSYDGPRSADGIVDYMKKQAGPDSVLLHSELDLEKFINHFDASVVGLFSGTDSSQLAEFLKGASLMRESFRFAHTTDLQLGQKYGVTHESILLFRAPRLSSKFEESVVPHTGSLSVTGLRRFIRDNI 237          

HSP 3 Score: 74.3294 bits (181), Expect = 2.199e-13
Identity = 35/90 (38.89%), Postives = 55/90 (61.11%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            +L++FYAPWCGHCK LAP++E  A +L  +  + +AK+D TAN ++   Y V+G+PT+      + H   SY   R  D ++ Y+  +A 
Sbjct:   46 LLVKFYAPWCGHCKKLAPEFESAASRL--KGTVTLAKVDCTANTEICKHYGVNGYPTLKIF--RNGHESSSYDGPRSADGIVDYMKKQAG 131          

HSP 4 Score: 62.7734 bits (151), Expect = 9.257e-10
Identity = 29/59 (49.15%), Postives = 37/59 (62.71%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCKKL P+Y  A   +   DP I IAK+D T        + V G+PT+
Sbjct:  394 VLIEFYAPWCGHCKKLEPKY-TALGEMLYSDPNIVIAKMDATV-NDVPAGYDVQGFPTI 450          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia8 (protein disulfide isomerase family A, member 8 [Source:ZFIN;Acc:ZDB-GENE-040801-20])

HSP 1 Score: 244.973 bits (624), Expect = 3.123e-72
Identity = 121/250 (48.40%), Postives = 164/250 (65.60%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSE-YGIESPDFSKV-YITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
             GL  H T  N +   KR L+ A Y++DY  NPKG+NYWRNR+LKVA KF  S + + F+++N  +  +EL E +G+ + D +++ ++T R     K+ M  +F+ +   LE F+ D+   ++  Y+KSE +P  N+  VKVVVA  F+EIVNDP KDVLIEFYAPWCGHCK L PKY  L + L ++ +IVIAKMDAT NDVP+ Y+V GFPTIYFA    K  PK Y   REV D + ++  EA+ PL
Sbjct:  238 FGLCPHMTKDNKEVLRKRDLLTAYYDLDYLHNPKGSNYWRNRVLKVATKF--SSQGMLFSVANRNDFMEELEEEFGLSASDGNELPFVTIRTRTGDKYSMREEFTRDGKSLESFLEDYFAGRLKRYVKSEPVPAINNGVVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTALGEMLYSDPNIVIAKMDATVNDVPAGYDVQGFPTIYFAAAGRKSEPKRYEGAREVKDFVNFLKREATKPL 485          

HSP 2 Score: 184.496 bits (467), Expect = 3.795e-50
Identity = 90/199 (45.23%), Postives = 127/199 (63.82%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            EH  +LV+FYAPWCGHCKKLAPE+E AA+ LK     + +AKVDCTA T+ C+ +GV+GYPTLK+F+NG  +  Y G RSADGI+ YM  ++GP S  L +E +  KF    D  VVG F+   S     FL  A  + E FRFAHT D  L  K    + +I++F + ++++KFE++ V + G  S   +R ++ +N+
Sbjct:   42 EHETLLVKFYAPWCGHCKKLAPEFESAASRLKGT---VTLAKVDCTANTEICKHYGVNGYPTLKIFRNGHESSSYDGPRSADGIVDYMKKQAGPDSVLLHSELDLEKFINHFDASVVGLFSGTDSSQLAEFLKGASLMRESFRFAHTTDLQLGQKYGVTHESILLFRAPRLSSKFEESVVPHTGSLSVTGLRRFIRDNI 237          

HSP 3 Score: 74.3294 bits (181), Expect = 2.199e-13
Identity = 35/90 (38.89%), Postives = 55/90 (61.11%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            +L++FYAPWCGHCK LAP++E  A +L  +  + +AK+D TAN ++   Y V+G+PT+      + H   SY   R  D ++ Y+  +A 
Sbjct:   46 LLVKFYAPWCGHCKKLAPEFESAASRL--KGTVTLAKVDCTANTEICKHYGVNGYPTLKIF--RNGHESSSYDGPRSADGIVDYMKKQAG 131          

HSP 4 Score: 62.7734 bits (151), Expect = 9.257e-10
Identity = 29/59 (49.15%), Postives = 37/59 (62.71%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCKKL P+Y  A   +   DP I IAK+D T        + V G+PT+
Sbjct:  394 VLIEFYAPWCGHCKKLEPKY-TALGEMLYSDPNIVIAKMDATV-NDVPAGYDVQGFPTI 450          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 195.282 bits (495), Expect = 7.080e-53
Identity = 111/248 (44.76%), Postives = 153/248 (61.69%), Query Frame = 1
Query: 1414 MGLAGHRTHSN-VKYFAKRPLIVALYNVDYEKNPK-GTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKM-IADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVP-SPYEVSGFPTIYFAPKNSKHSPKSYSSG-REVDDMLKYIASEAS 2142
            + L GHR  SN  K + KRPL+V  Y VD+  + +  T +WR+++L+VAK F +      FAI++ ++   EL   G+ S    +V +    E  +K+ M   +F  + L  F+  F + K+   +KS+ +P+ N  PVKVVV K FDEIV D  KDVLIEFYAPWCGHCK L P Y  L KK   E ++VIAKMDATANDVP   Y+V GFPTIYFAP N+K +P  +  G R+V++  K++   A+
Sbjct:  391 LPLVGHRKQSNDAKRYTKRPLVVVYYGVDFSFDYRVATQFWRSKVLEVAKDFPE----YTFAIADEEDYADELKSLGL-SESGEEVNVGIVGEGGKKYAMEPEEFDSDVLRSFVMAFKKGKLKPIVKSQPLPKNNKGPVKVVVGKTFDEIVMDSKKDVLIEFYAPWCGHCKKLEPDYISLGKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTIYFAPSNNKQNPIKFEGGKRDVEEFSKFVEKHAT 633          

HSP 2 Score: 162.155 bits (409), Expect = 2.067e-41
Identity = 78/174 (44.83%), Postives = 111/174 (63.79%), Query Frame = 3
Query:   12 VILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASA-DPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYK-NNIVIFHSKKMANKFE 527
            +ILVEFYAPWCGHCK+LAPEYE AA  L  + PPI +AKVD TAE+    + GVSGYPTLK+F+ G+ AFDY+G R   GI+ YM  ++GP SK+++T +   +      D V+VG F+S+    Y+ +      L ED++F HTF+  ++  L      +V+   +K  +K+E
Sbjct:  193 IILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPIPLAKVDATAESDLATRFGVSGYPTLKIFRKGK-AFDYNGPREKFGIVDYMSDQAGPPSKQVQTLKQVQELLRDGDDAVIVGVFSSDEDAAYEIYQEACNSLREDYKFMHTFNNDVTKFLKASPGQVVMLQPEKFRSKYE 365          

HSP 3 Score: 112.079 bits (279), Expect = 4.606e-25
Identity = 54/122 (44.26%), Postives = 76/122 (62.30%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVS------KSGPSSKELKTEENFNKFTASADPVVVGFF 362
            +LVEFYAPWCGHCK+ APEYE  A  LK+ DPPI +AKVD T  +    +  VSGYPT+K+ K G+   DY G+RS   I++ +        K  P +  + T++NF+    +AD ++V F+
Sbjct:   79 VLVEFYAPWCGHCKQFAPEYEKIAQTLKENDPPIPVAKVDATKASGLGSRFEVSGYPTIKILKKGE-PLDYDGDRSEHAIVERVKEVAQPDWKPPPEATLVLTKDNFDDVVNNADIILVEFY 199          

HSP 4 Score: 86.6557 bits (213), Expect = 4.524e-17
Identity = 49/117 (41.88%), Postives = 73/117 (62.39%), Query Frame = 1
Query: 1813 EPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKN 2157
            E   V+   NFD++VN+    +L+EFYAPWCGHCK LAP+YE+ AK+LS  +  I +AK+DATA +D+ + + VSG+PT+    K        Y+  RE   ++ Y++ +A  P K 
Sbjct:  174 EATLVLTKDNFDDVVNN-ADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPIPLAKVDATAESDLATRFGVSGYPTLKIFRKGKAF---DYNGPREKFGIVDYMSDQAGPPSKQ 286          

HSP 5 Score: 76.6406 bits (187), Expect = 5.693e-14
Identity = 48/103 (46.60%), Postives = 63/103 (61.17%), Query Frame = 1
Query: 1804 KNDEPVKVVVAKNFDEIVNDPTKD-VLIEFYAPWCGHCKSLAPKYEELAKKLSAESD--IVIAKMDAT-ANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGR 2100
            K +  V V+   NFD  +    KD VL+EFYAPWCGHCK  AP+YE++A+ L  E+D  I +AK+DAT A+ + S +EVSG+PTI    K     P  Y   R
Sbjct:   56 KEENGVLVLTDANFDTFIE--GKDTVLVEFYAPWCGHCKQFAPEYEKIAQTLK-ENDPPIPVAKVDATKASGLGSRFEVSGYPTIKILKKG---EPLDYDGDR 152          

HSP 6 Score: 62.7734 bits (151), Expect = 1.203e-9
Identity = 28/59 (47.46%), Postives = 39/59 (66.10%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCKKL P+Y I+     K +  + IAK+D TA     + + V G+PT+
Sbjct:  543 VLIEFYAPWCGHCKKLEPDY-ISLGKKYKNEKNLVIAKMDATANDVPHDSYKVEGFPTI 600          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: pdia3 (protein disulfide isomerase family A member 3 [Source:NCBI gene;Acc:394954])

HSP 1 Score: 291.197 bits (744), Expect = 2.996e-89
Identity = 136/247 (55.06%), Postives = 177/247 (71.66%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSP 2148
             GL  H T  N      + L+VA Y+VDYEKN KGTNYWRNR++KVAK F+D+GK ++FA++N +    E++E+G+++       +  +  + +K+ M  +FS +   LE+F+ D+   K+  Y+KSE+IPE ND PVKVVVA+NFDEIVND +KDVLIEFYAPWCGHCK+L PKY+EL +KL  + +IVIAKMDATANDVPS YEV GFPTIYF P  SK  PK Y  GREV D L Y+  EA++P
Sbjct:  237 FGLCPHLTEDNKDLIQGKDLLVAYYDVDYEKNVKGTNYWRNRVMKVAKSFVDAGKKLNFAVANRKAFGHEVTEFGLDAGTGELPVVGIKTAKGEKYAMQEEFSRDGKALERFLQDYFDGKLKRYMKSEAIPESNDGPVKVVVAENFDEIVNDDSKDVLIEFYAPWCGHCKNLEPKYKELGEKLGDDPNIVIAKMDATANDVPSQYEVRGFPTIYFTPAGSKQKPKRYEGGREVSDFLSYLKKEATNP 483          

HSP 2 Score: 192.971 bits (489), Expect = 5.273e-53
Identity = 93/201 (46.27%), Postives = 136/201 (67.66%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKYKGD--ASEHQIRTWVEENM 596
            +HS++LVEF+APWCGHCKKLAPEYEIAAT LK     +++AKVDCTA + TC K+GVSGYPTLK+F++G+ +  Y G R+ADGI+  M  ++GP+S +L++   F KF +  D  VVGFF    S  +  FL  A  L +++RFAHT ++ L  K +      V+F  + +ANKFED+ V +  D   +  +I+ ++++N+
Sbjct:   39 QHSILLVEFFAPWCGHCKKLAPEYEIAATKLKGT---LSLAKVDCTANSNTCNKYGVSGYPTLKIFRDGEDSGSYDGPRTADGIVSTMKKQAGPASVDLRSVGEFEKFISDKDASVVGFFRDLYSGPHSEFLKAANTLRDNYRFAHTDEKELVDKYDSNGEGFVLFRPQHLANKFEDSSVTFPADEKITSSKIKKFIQDNI 236          

HSP 3 Score: 68.9366 bits (167), Expect = 1.453e-11
Identity = 39/102 (38.24%), Postives = 58/102 (56.86%), Query Frame = 1
Query: 1840 NFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            NF+  V+  +  +L+EF+APWCGHCK LAP+YE  A KL  +  + +AK+D TAN +  + Y VSG+PT+            SY   R  D ++  +  +A 
Sbjct:   32 NFESTVSQHSI-LLVEFFAPWCGHCKKLAPEYEIAATKL--KGTLSLAKVDCTANSNTCNKYGVSGYPTLKIF--RDGEDSGSYDGPRTADGIVSTMKKQAG 128          

HSP 4 Score: 65.0846 bits (157), Expect = 2.729e-10
Identity = 35/86 (40.70%), Postives = 46/86 (53.49%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG--QFAFDYSGERSADGIIKYM 266
            +L+EFYAPWCGHCK L P+Y+     L   DP I IAK+D TA      ++ V G+PT+     G  Q    Y G R     + Y+
Sbjct:  393 VLIEFYAPWCGHCKNLEPKYKELGEKL-GDDPNIVIAKMDATA-NDVPSQYEVRGFPTIYFTPAGSKQKPKRYEGGREVSDFLSYL 476          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: pdia3 (protein disulfide isomerase family A member 3 [Source:NCBI gene;Acc:394954])

HSP 1 Score: 271.166 bits (692), Expect = 5.384e-83
Identity = 127/230 (55.22%), Postives = 165/230 (71.74%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSG 2097
             GL  H T  N      + L+VA Y+VDYEKN KGTNYWRNR++KVAK F+D+GK ++FA++N +    E++E+G+++       +  +  + +K+ M  +FS +   LE+F+ D+   K+  Y+KSE+IPE ND PVKVVVA+NFDEIVND +KDVLIEFYAPWCGHCK+L PKY+EL +KL  + +IVIAKMDATANDVPS YEV GFPTIYF P  SK  PK Y  G
Sbjct:  163 FGLCPHLTEDNKDLIQGKDLLVAYYDVDYEKNVKGTNYWRNRVMKVAKSFVDAGKKLNFAVANRKAFGHEVTEFGLDAGTGELPVVGIKTAKGEKYAMQEEFSRDGKALERFLQDYFDGKLKRYMKSEAIPESNDGPVKVVVAENFDEIVNDDSKDVLIEFYAPWCGHCKNLEPKYKELGEKLGDDPNIVIAKMDATANDVPSQYEVRGFPTIYFTPAGSKQKPKRYEVG 392          

HSP 2 Score: 147.132 bits (370), Expect = 1.082e-37
Identity = 72/144 (50.00%), Postives = 98/144 (68.06%), Query Frame = 3
Query:   42 CGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLN 473
            CGHCKKLAPEYEIAAT LK     +++AKVDCTA + TC K+GVSGYPTLK+F++G+ +  Y G R+ADGI+  M  ++GP+S +L++   F KF +  D  VVGFF    S  +  FL  A  L +++RFAHT ++ L  K +
Sbjct:   18 CGHCKKLAPEYEIAATKLKGT---LSLAKVDCTANSNTCNKYGVSGYPTLKIFRDGEDSGSYDGPRTADGIVSTMKKQAGPASVDLRSVGEFEKFISDKDASVVGFFRDLYSGPHSEFLKAANTLRDNYRFAHTDEKELVDKYD 158          

HSP 3 Score: 62.3882 bits (150), Expect = 1.410e-9
Identity = 29/59 (49.15%), Postives = 38/59 (64.41%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCK L P+Y+     L   DP I IAK+D TA      ++ V G+PT+
Sbjct:  319 VLIEFYAPWCGHCKNLEPKYKELGEKL-GDDPNIVIAKMDATA-NDVPSQYEVRGFPTI 375          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: pdia3 (protein disulfide isomerase family A member 3 [Source:NCBI gene;Acc:394954])

HSP 1 Score: 271.166 bits (692), Expect = 1.566e-82
Identity = 127/230 (55.22%), Postives = 165/230 (71.74%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSG 2097
             GL  H T  N      + L+VA Y+VDYEKN KGTNYWRNR++KVAK F+D+GK ++FA++N +    E++E+G+++       +  +  + +K+ M  +FS +   LE+F+ D+   K+  Y+KSE+IPE ND PVKVVVA+NFDEIVND +KDVLIEFYAPWCGHCK+L PKY+EL +KL  + +IVIAKMDATANDVPS YEV GFPTIYF P  SK  PK Y  G
Sbjct:  191 FGLCPHLTEDNKDLIQGKDLLVAYYDVDYEKNVKGTNYWRNRVMKVAKSFVDAGKKLNFAVANRKAFGHEVTEFGLDAGTGELPVVGIKTAKGEKYAMQEEFSRDGKALERFLQDYFDGKLKRYMKSEAIPESNDGPVKVVVAENFDEIVNDDSKDVLIEFYAPWCGHCKNLEPKYKELGEKLGDDPNIVIAKMDATANDVPSQYEVRGFPTIYFTPAGSKQKPKRYEVG 420          

HSP 2 Score: 167.162 bits (422), Expect = 2.295e-44
Identity = 84/188 (44.68%), Postives = 123/188 (65.43%), Query Frame = 3
Query:   42 CGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKYKGD--ASEHQIRTWVEENM 596
            CGHCKKLAPEYEIAAT LK     +++AKVDCTA + TC K+GVSGYPTLK+F++G+ +  Y G R+ADGI+  M  ++GP+S +L++   F KF +  D  VVGFF    S  +  FL  A  L +++RFAHT ++ L  K +      V+F  + +ANKFED+ V +  D   +  +I+ ++++N+
Sbjct:    6 CGHCKKLAPEYEIAATKLKGT---LSLAKVDCTANSNTCNKYGVSGYPTLKIFRDGEDSGSYDGPRTADGIVSTMKKQAGPASVDLRSVGEFEKFISDKDASVVGFFRDLYSGPHSEFLKAANTLRDNYRFAHTDEKELVDKYDSNGEGFVLFRPQHLANKFEDSSVTFPADEKITSSKIKKFIQDNI 190          

HSP 3 Score: 62.7734 bits (151), Expect = 1.181e-9
Identity = 29/59 (49.15%), Postives = 38/59 (64.41%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCK L P+Y+     L   DP I IAK+D TA      ++ V G+PT+
Sbjct:  347 VLIEFYAPWCGHCKNLEPKYKELGEKL-GDDPNIVIAKMDATA-NDVPSQYEVRGFPTI 403          

HSP 4 Score: 50.447 bits (119), Expect = 8.379e-6
Identity = 30/81 (37.04%), Postives = 42/81 (51.85%), Query Frame = 1
Query: 1903 CGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            CGHCK LAP+YE  A KL     + +AK+D TAN +  + Y VSG+PT+            SY   R  D ++  +  +A 
Sbjct:    6 CGHCKKLAPEYEIAATKLKGT--LSLAKVDCTANSNTCNKYGVSGYPTLKIF--RDGEDSGSYDGPRTADGIVSTMKKQAG 82          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: pdia3 (protein disulfide isomerase family A member 3 [Source:NCBI gene;Acc:394954])

HSP 1 Score: 248.825 bits (634), Expect = 1.441e-73
Identity = 122/247 (49.39%), Postives = 163/247 (65.99%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSP 2148
             GL  H T  N      + L+VA Y+VDYEKN KGTNYWRNR++KVAK F+D+GK ++FA++N +    E++E+G+++       +  +  + +K+ M  +FS +   LE+F+ D+   K+  Y+KSE+IPE ND PVKVVVA+NFDEIVND +KDVLIEFYAPWCGHCK+L PKY+EL +KL  + +IVIAKMDATANDVPS YE                       GREV D L Y+  EA++P
Sbjct:  237 FGLCPHLTEDNKDLIQGKDLLVAYYDVDYEKNVKGTNYWRNRVMKVAKSFVDAGKKLNFAVANRKAFGHEVTEFGLDAGTGELPVVGIKTAKGEKYAMQEEFSRDGKALERFLQDYFDGKLKRYMKSEAIPESNDGPVKVVVAENFDEIVNDDSKDVLIEFYAPWCGHCKNLEPKYKELGEKLGDDPNIVIAKMDATANDVPSQYE----------------------GGREVSDFLSYLKKEATNP 461          

HSP 2 Score: 192.971 bits (489), Expect = 3.861e-53
Identity = 93/201 (46.27%), Postives = 136/201 (67.66%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKYKGD--ASEHQIRTWVEENM 596
            +HS++LVEF+APWCGHCKKLAPEYEIAAT LK     +++AKVDCTA + TC K+GVSGYPTLK+F++G+ +  Y G R+ADGI+  M  ++GP+S +L++   F KF +  D  VVGFF    S  +  FL  A  L +++RFAHT ++ L  K +      V+F  + +ANKFED+ V +  D   +  +I+ ++++N+
Sbjct:   39 QHSILLVEFFAPWCGHCKKLAPEYEIAATKLKGT---LSLAKVDCTANSNTCNKYGVSGYPTLKIFRDGEDSGSYDGPRTADGIVSTMKKQAGPASVDLRSVGEFEKFISDKDASVVGFFRDLYSGPHSEFLKAANTLRDNYRFAHTDEKELVDKYDSNGEGFVLFRPQHLANKFEDSSVTFPADEKITSSKIKKFIQDNI 236          

HSP 3 Score: 69.3218 bits (168), Expect = 1.223e-11
Identity = 39/102 (38.24%), Postives = 57/102 (55.88%), Query Frame = 1
Query: 1840 NFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            NF+  V+  +  +L+EF+APWCGHCK LAP+YE  A KL     + +AK+D TAN +  + Y VSG+PT+            SY   R  D ++  +  +A 
Sbjct:   32 NFESTVSQHSI-LLVEFFAPWCGHCKKLAPEYEIAATKLKGT--LSLAKVDCTANSNTCNKYGVSGYPTLKIF--RDGEDSGSYDGPRTADGIVSTMKKQAG 128          

HSP 4 Score: 58.5362 bits (140), Expect = 2.561e-8
Identity = 25/43 (58.14%), Postives = 30/43 (69.77%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTA 143
            +L+EFYAPWCGHCK L P+Y+     L   DP I IAK+D TA
Sbjct:  393 VLIEFYAPWCGHCKNLEPKYKELGEKL-GDDPNIVIAKMDATA 434          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: pdia3 (protein disulfide isomerase family A member 3 [Source:NCBI gene;Acc:394954])

HSP 1 Score: 243.047 bits (619), Expect = 5.098e-72
Identity = 114/209 (54.55%), Postives = 152/209 (72.73%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSG 2034
             GL  H T  N      + L+VA Y+VDYEKN KGTNYWRNR++KVAK F+D+GK ++FA++N +    E++E+G+++       +  +  + +K+ M  +FS +   LE+F+ D+   K+  Y+KSE+IPE ND PVKVVVA+NFDEIVND +KDVLIEFYAPWCGHCK+L PKY+EL +KL  + +IVIAKMDATANDVPS YEV G
Sbjct:  227 FGLCPHLTEDNKDLIQGKDLLVAYYDVDYEKNVKGTNYWRNRVMKVAKSFVDAGKKLNFAVANRKAFGHEVTEFGLDAGTGELPVVGIKTAKGEKYAMQEEFSRDGKALERFLQDYFDGKLKRYMKSEAIPESNDGPVKVVVAENFDEIVNDDSKDVLIEFYAPWCGHCKNLEPKYKELGEKLGDDPNIVIAKMDATANDVPSQYEVRG 435          

HSP 2 Score: 192.971 bits (489), Expect = 1.537e-53
Identity = 93/201 (46.27%), Postives = 136/201 (67.66%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKYKGD--ASEHQIRTWVEENM 596
            +HS++LVEF+APWCGHCKKLAPEYEIAAT LK     +++AKVDCTA + TC K+GVSGYPTLK+F++G+ +  Y G R+ADGI+  M  ++GP+S +L++   F KF +  D  VVGFF    S  +  FL  A  L +++RFAHT ++ L  K +      V+F  + +ANKFED+ V +  D   +  +I+ ++++N+
Sbjct:   29 QHSILLVEFFAPWCGHCKKLAPEYEIAATKLKGT---LSLAKVDCTANSNTCNKYGVSGYPTLKIFRDGEDSGSYDGPRTADGIVSTMKKQAGPASVDLRSVGEFEKFISDKDASVVGFFRDLYSGPHSEFLKAANTLRDNYRFAHTDEKELVDKYDSNGEGFVLFRPQHLANKFEDSSVTFPADEKITSSKIKKFIQDNI 226          

HSP 3 Score: 70.8626 bits (172), Expect = 3.237e-12
Identity = 43/118 (36.44%), Postives = 65/118 (55.08%), Query Frame = 1
Query: 1792 SIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            S+P ++D  V  +   NF+  V+  +  +L+EF+APWCGHCK LAP+YE  A KL     + +AK+D TAN +  + Y VSG+PT+            SY   R  D ++  +  +A 
Sbjct:    8 SLPARSD--VLDLTDDNFESTVSQHSI-LLVEFFAPWCGHCKKLAPEYEIAATKLKGT--LSLAKVDCTANSNTCNKYGVSGYPTLKIF--RDGEDSGSYDGPRTADGIVSTMKKQAG 118          

HSP 4 Score: 58.5362 bits (140), Expect = 2.243e-8
Identity = 25/43 (58.14%), Postives = 30/43 (69.77%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTA 143
            +L+EFYAPWCGHCK L P+Y+     L   DP I IAK+D TA
Sbjct:  383 VLIEFYAPWCGHCKNLEPKYKELGEKL-GDDPNIVIAKMDATA 424          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia3 (protein disulfide isomerase associated 3 [Source:MGI Symbol;Acc:MGI:95834])

HSP 1 Score: 283.878 bits (725), Expect = 1.312e-86
Identity = 133/247 (53.85%), Postives = 178/247 (72.06%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSP 2148
             GL  H T  N      + L+ A Y+VDYEKN KG+NYWRNR++ VAKKF+D+G  ++FA+++ +  + ELS++G+ES       +  R  + +KF M  +FS +   LE+F+ ++    +  YLKSE IPE N+ PVKVVVA+NFD+IVN+  KDVLIEFYAPWCGHCK+L PKY+EL +KLS + +IVIAKMDATANDVPSPYEV GFPTIYF+P N K +PK Y  GRE++D + Y+  EA++P
Sbjct:  241 FGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTTGEVPVVAIRTAKGEKFVMQEEFSRDGKALEQFLQEYFDGNLKRYLKSEPIPESNEGPVKVVVAENFDDIVNEEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYLQREATNP 487          

HSP 2 Score: 188.348 bits (477), Expect = 2.219e-51
Identity = 96/182 (52.75%), Postives = 123/182 (67.58%), Query Frame = 3
Query:    9 SVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNN---IVIFHSKKMANKFEDTQVKY 545
             ++LVEF+APWCGHCK+LAPEYE AAT LK   P   +AKVDCTA T TC K+GVSGYPTLK+F++G+ A  Y G R+ADGI+ ++  ++GP+S  L+TEE F KF +  D  VVGFF    SD +  FL  A  L +++RFAHT  E+L  +  Y +N   I IF    +ANKFED  V Y
Sbjct:   46 GLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRDNYRFAHTNIESLVKE--YDDNGEGITIFRPLHLANKFEDKTVAY 222          

HSP 3 Score: 70.8626 bits (172), Expect = 2.684e-12
Identity = 42/113 (37.17%), Postives = 65/113 (57.52%), Query Frame = 1
Query: 1837 KNFDEIVNDPTKD--VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI---ASEASSPLKN 2157
            +NF+  V+D      +L+EF+APWCGHCK LAP+YE  A +L  +  + +AK+D TAN +  + Y VSG+PT+       +    +Y   R  D ++ ++   A  AS PL+ 
Sbjct:   33 ENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRL--KGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAG--AYDGPRTADGIVSHLKKQAGPASVPLRT 141          

HSP 4 Score: 63.929 bits (154), Expect = 4.515e-10
Identity = 31/63 (49.21%), Postives = 39/63 (61.90%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            E   +L+EFYAPWCGHCK L P+Y+     L K DP I IAK+D TA       + V G+PT+
Sbjct:  393 EDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSK-DPNIVIAKMDATA-NDVPSPYEVKGFPTI 453          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia4 (protein disulfide isomerase associated 4 [Source:MGI Symbol;Acc:MGI:104864])

HSP 1 Score: 198.749 bits (504), Expect = 4.947e-54
Identity = 110/249 (44.18%), Postives = 155/249 (62.25%), Query Frame = 1
Query: 1411 SMGLAGHRTHSN-VKYFAKRPLIVALYNVDYEKNPKG-TNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKM-IADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPS-PYEVSGFPTIYFAPKNSKHSPKSYSSG-REVDDMLKYIASEAS 2142
            ++ L GHR  SN  K ++KRPL+V  Y+VD+  + +  T +WRN++L+VAK F +      FAI++ ++   E+ + G+ S     V     DE  +KF M   +F  + L +F+  F + K+   +KS+ +P+ N  PVKVVV K FD IV DP KDVLIEFYAPWCGHCK L P Y  L KK   + D+VIAKMDATAND+ +  Y+V GFPTIYFAP   K +P  +  G R+++ + K+I   A+
Sbjct:  389 ALPLVGHRKTSNDAKRYSKRPLVVVYYSVDFSFDYRAATQFWRNKVLEVAKDFPE----YTFAIADEEDYATEVKDLGL-SESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFIDEHAT 632          

HSP 2 Score: 164.851 bits (416), Expect = 2.366e-42
Identity = 81/174 (46.55%), Postives = 109/174 (62.64%), Query Frame = 3
Query:   12 VILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVV-VGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYK-NNIVIFHSKKMANKFE 527
            +ILVEFYAPWCGHCKKLAPEYE AA  L K+ PPI +AKVD T +T   ++  VSGYPTLK+F+ G+  FDY+G R   GI+ YM+ +SGP SKE+ T +   +F    D VV +G F  +    Y  +   A  L ED++F HTF   ++  L      +V+ H +K  +K+E
Sbjct:  192 IILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIFRKGR-PFDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFLKDGDDVVIIGLFQGDGDPAYLQYQDAANNLREDYKFHHTFSPEIAKFLKVSLGKLVLTHPEKFQSKYE 364          

HSP 3 Score: 113.62 bits (283), Expect = 1.587e-25
Identity = 56/126 (44.44%), Postives = 79/126 (62.70%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPS---SKELK---TEENFNKFTASADPVVVGFF 362
            +   +L+EFYAPWCGHCK+ APEYE  A+ LK  DPPIA+AK+D T+ +    K  VSGYPT+K+ K GQ A DY G R+ + I+  +   S P      E+    T++NF+    +AD ++V F+
Sbjct:   74 DKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKGQ-AVDYDGSRTQEEIVAKVREVSQPDWTPPPEVTLSLTKDNFDDVVNNADIILVEFY 198          

HSP 4 Score: 85.5001 bits (210), Expect = 1.151e-16
Identity = 54/136 (39.71%), Postives = 82/136 (60.29%), Query Frame = 1
Query: 1759 QEKVPVYLKSESIPEKNDEP-VKVVVAK-NFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDAT-ANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLK 2154
            QE++   ++  S P+    P V + + K NFD++VN+    +L+EFYAPWCGHCK LAP+YE+ AK+LS  S  I +AK+DAT   D+   ++VSG+PT+       K  P  Y+  RE   ++ Y+  ++  P K
Sbjct:  153 QEEIVAKVREVSQPDWTPPPEVTLSLTKDNFDDVVNN-ADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIF---RKGRPFDYNGPREKYGIVDYMIEQSGPPSK 284          

HSP 5 Score: 74.7146 bits (182), Expect = 2.341e-13
Identity = 42/79 (53.16%), Postives = 55/79 (69.62%), Query Frame = 1
Query: 1819 VKVVVAKNFDEIVNDPTKD-VLIEFYAPWCGHCKSLAPKYEELAKKL-SAESDIVIAKMDAT-ANDVPSPYEVSGFPTI 2046
            V V+   NFD  V D  KD VL+EFYAPWCGHCK  AP+YE++A  L   +  I +AK+DAT A+ + S ++VSG+PTI
Sbjct:   60 VWVLNDGNFDNFVAD--KDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTI 136          

HSP 6 Score: 62.7734 bits (151), Expect = 1.180e-9
Identity = 28/59 (47.46%), Postives = 38/59 (64.41%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCK+L P Y       K Q   + IAK+D TA   T +++ V G+PT+
Sbjct:  542 VLIEFYAPWCGHCKQLEPIYTSLGKKYKGQK-DLVIAKMDATANDITNDQYKVEGFPTI 599          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: P4hb (prolyl 4-hydroxylase, beta polypeptide [Source:MGI Symbol;Acc:MGI:97464])

HSP 1 Score: 126.716 bits (317), Expect = 3.258e-30
Identity = 74/210 (35.24%), Postives = 118/210 (56.19%), Query Frame = 1
Query: 1573 GKSIHFAISNVQEMNQELSEY-GIESPDFSKVYITARDERNQKFKMIAD-FSMENLEKFINDFLQEKVPVYLKSESIPEKND-EPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRKSDL 2193
            GK +   I +    NQ + E+ G++  +   V +   +E   K+K  +D  + E + +F + FL+ K+  +L S+ +PE  D +PVKV+V  NF+E+  D  K+V +EFYAPWCGHCK LAP +++L +      +I+IAKMD+TAN+V +  +V  FPT+ F P ++  +   Y+  R +D   K++ S         D  G D   DL
Sbjct:  286 GKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQEVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIIIAKMDSTANEVEA-VKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ------DGAGDDEDLDL 488          

HSP 2 Score: 126.331 bits (316), Expect = 3.842e-30
Identity = 73/199 (36.68%), Postives = 114/199 (57.29%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAF--DYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNY-KNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEEN 593
            H  +LVEFYAPWCGHCK LAPEY  AA  LK +   I +AKVD T E+   +++GV GYPT+K FKNG  A   +Y+  R AD I+ ++  ++GP++  L           S++  V+GFF    SD  K FL  AE ++ D  F  T +  + +K    K+ +V+F       KF++ +  ++G+ ++ ++  +++ N
Sbjct:   43 HKYLLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDVESDSAKQFLLAAEAID-DIPFGITSNSGVFSKYQLDKDGVVLF------KKFDEGRNNFEGEITKEKLLDFIKHN 234          

HSP 3 Score: 91.2781 bits (225), Expect = 9.348e-19
Identity = 51/105 (48.57%), Postives = 71/105 (67.62%), Query Frame = 1
Query: 1819 VKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAE-SDIVIAKMDAT-ANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI 2127
            V V+   NF+E +    K +L+EFYAPWCGHCK+LAP+Y + A KL AE S+I +AK+DAT  +D+   Y V G+PTI F       SPK Y++GRE DD++ ++
Sbjct:   28 VLVLKKSNFEEALA-AHKYLLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWL 131          

HSP 4 Score: 70.8626 bits (172), Expect = 3.117e-12
Identity = 39/88 (44.32%), Postives = 51/88 (57.95%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG--QFAFDYSGERSADGIIKYMVS 272
            + VEFYAPWCGHCK+LAP ++      K  +  I IAK+D TA     E   V  +PTLK F     +   DY+GER+ DG  K++ S
Sbjct:  390 VFVEFYAPWCGHCKQLAPIWDKLGETYKDHE-NIIIAKMDSTA--NEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLES 474          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia3 (protein disulfide isomerase associated 3 [Source:MGI Symbol;Acc:MGI:95834])

HSP 1 Score: 114.005 bits (284), Expect = 2.303e-29
Identity = 52/81 (64.20%), Postives = 63/81 (77.78%), Query Frame = 3
Query:    9 SVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADG 251
             ++LVEF+APWCGHCK+LAPEYE AAT LK   P   +AKVDCTA T TC K+GVSGYPTLK+F++G+ A  Y G R+A G
Sbjct:   23 GLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTAGG 100          

HSP 2 Score: 68.9366 bits (167), Expect = 1.390e-13
Identity = 34/73 (46.58%), Postives = 50/73 (68.49%), Query Frame = 1
Query: 1837 KNFDEIVNDPTKD--VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTI 2046
            +NF+  V+D      +L+EF+APWCGHCK LAP+YE  A +L  +  + +AK+D TAN +  + Y VSG+PT+
Sbjct:   10 ENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRL--KGIVPLAKVDCTANTNTCNKYGVSGYPTL 80          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia2 (protein disulfide isomerase associated 2 [Source:MGI Symbol;Acc:MGI:1916441])

HSP 1 Score: 113.62 bits (283), Expect = 4.960e-28
Identity = 57/122 (46.72%), Postives = 79/122 (64.75%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAF--DYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFF 362
            EHS ++VEFYAPWCGHCK+LAPEY  AA  L  +   + +AKVD  AE +  ++  V GYPTLK F+NG      +Y+G ++A+GI +++  + GPS+  L+ EE      A  D VV+GFF
Sbjct:   53 EHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKFFQNGNRTNPEEYAGPKTAEGIAEWLRRRVGPSATHLEDEEGVQALMAKWDMVVIGFF 174          

HSP 2 Score: 69.707 bits (169), Expect = 7.690e-13
Identity = 33/86 (38.37%), Postives = 58/86 (67.44%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIV-IAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI 2127
            +++EFYAPWCGHCK LAP+Y + A  L+AES +V +AK+D  A  ++   +EV G+PT+ F    ++ +P+ Y+  +  + + +++
Sbjct:   57 LMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVGYPTLKFFQNGNRTNPEEYAGPKTAEGIAEWL 142          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|P38657|PDIA3_BOVIN (Protein disulfide-isomerase A3 OS=Bos taurus OX=9913 GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 7.268e-89
Identity = 135/247 (54.66%), Postives = 178/247 (72.06%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSP 2148
             G+  H T  N      + L++A Y+VDYEKN KG+NYWRNR++ VAKKF+D+G+ +HFA+++ +  + ELS++G+ES       +  R  + +KF M  +FS +   LE+F+ D+    +  YLKSE IPE ND PVKVVVA+NFDEIVN+  KDVLIEFYAPWCGHCK+L PKY+EL +KL  + +IVIAKMDATANDVPSPYEV GFPTIYF+P N K +PK Y  GRE+ D + Y+  EA++P
Sbjct:  241 FGICPHMTEDNKDLLQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGQKLHFAVASRKTFSHELSDFGLESTTGEIPVVAVRTAKGEKFVMQEEFSRDGKALERFLEDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLRKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKQNPKKYEGGRELSDFISYLKREATNP 487          

HSP 2 Score: 188.734 bits (478), Expect = 1.213e-50
Identity = 95/198 (47.98%), Postives = 131/198 (66.16%), Query Frame = 3
Query:    9 SVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKY-KGDASEHQIRTWVEENM 596
             ++LVEF+APWCGHCKKLAPEYE AAT LK   P   +AKVDCTA T TC K+GVSGYPTLK+F++G+ +  Y G R+ADGI+ ++  ++GP+S  LK+EE F KF +  D  VVGFF    S+ +  FL  A  L +++RFAHT  E+L  K +     I +F    + NKFED  V Y +   +  +I+ +++EN+
Sbjct:   46 GLMLVEFFAPWCGHCKKLAPEYEAAATRLKGIVP---LAKVDCTANTNTCNKYGVSGYPTLKIFRDGEESGAYDGPRTADGIVSHLKKQAGPASVPLKSEEEFEKFISDKDASVVGFFKDLFSEAHSEFLKAASNLRDNYRFAHTNVESLVNKYDDDGEGITLFRPSHLTNKFEDKTVAYTEQKMTSGKIKRFIQENI 240          

HSP 3 Score: 72.0182 bits (175), Expect = 8.789e-12
Identity = 42/112 (37.50%), Postives = 64/112 (57.14%), Query Frame = 1
Query: 1840 NFDEIVNDPTKD--VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI---ASEASSPLKN 2157
            NF+  + D      +L+EF+APWCGHCK LAP+YE  A +L  +  + +AK+D TAN +  + Y VSG+PT+       +    +Y   R  D ++ ++   A  AS PLK+
Sbjct:   34 NFESRITDTGSSGLMLVEFFAPWCGHCKKLAPEYEAAATRL--KGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEESG--AYDGPRTADGIVSHLKKQAGPASVPLKS 141          

HSP 4 Score: 67.0106 bits (162), Expect = 3.048e-10
Identity = 37/90 (41.11%), Postives = 48/90 (53.33%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL--KVFKNGQFAFDYSGERSADGIIKYM 266
            E+  +L+EFYAPWCGHCK L P+Y+     L+K DP I IAK+D TA       + V G+PT+        Q    Y G R     I Y+
Sbjct:  393 ENKDVLIEFYAPWCGHCKNLEPKYKELGEKLRK-DPNIVIAKMDATA-NDVPSPYEVRGFPTIYFSPANKKQNPKKYEGGRELSDFISYL 480          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|Q5RDG4|PDIA3_PONAB (Protein disulfide-isomerase A3 OS=Pongo abelii OX=9601 GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 2.830e-87
Identity = 135/247 (54.66%), Postives = 178/247 (72.06%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSP 2148
             G+  H T  N      + L++A Y+VDYEKN KG+NYWRNR++ VAKKF+D+G  ++FA+++ +  + ELS++G+ES       +  R  + +KF M  +FS +   LE+F+ D+    +  YLKSE IPE ND PVKVVVA+NFDEIVN+  KDVLIEFYAPWCGHCK+L PKY+EL +KLS + +IVIAKMDATANDVPSPYEV GFPTIYF+P N K +PK Y  GRE+ D + Y+  EA++P
Sbjct:  241 FGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNP 487          

HSP 2 Score: 191.045 bits (484), Expect = 1.893e-51
Identity = 95/200 (47.50%), Postives = 134/200 (67.00%), Query Frame = 3
Query:    9 SVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNN---IVIFHSKKMANKFEDTQVKY-KGDASEHQIRTWVEENM 596
             ++LVEF+APWCGHCK+LAPEYE AAT LK   P   +AKVDCTA T TC K+GVSGYPTLK+F++G+ A  Y G R+ADGI+ ++  ++GP+S  L+TEE F KF +  D  +VGFF    S+ +  FL  A  L +++RFAHT  E+L  +  Y +N   I++F    + NKFED  V Y +   +  +I+ +++EN+
Sbjct:   46 GLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNE--YDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENI 240          

HSP 3 Score: 70.4774 bits (171), Expect = 2.547e-11
Identity = 41/111 (36.94%), Postives = 64/111 (57.66%), Query Frame = 1
Query: 1840 NFDEIVNDPTKD--VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI---ASEASSPLK 2154
            NF+  ++D      +L+EF+APWCGHCK LAP+YE  A +L  +  + +AK+D TAN +  + Y VSG+PT+       +    +Y   R  D ++ ++   A  AS PL+
Sbjct:   34 NFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRL--KGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAG--AYDGPRTADGIVSHLKKQAGPASVPLR 140          

HSP 4 Score: 65.0846 bits (157), Expect = 1.372e-9
Identity = 31/63 (49.21%), Postives = 40/63 (63.49%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            E+  +L+EFYAPWCGHCK L P+Y+     L K DP I IAK+D TA       + V G+PT+
Sbjct:  393 ENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSK-DPNIVIAKMDATA-NDVPSPYEVRGFPTI 453          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|P30101|PDIA3_HUMAN (Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4)

HSP 1 Score: 287.73 bits (735), Expect = 2.830e-87
Identity = 135/247 (54.66%), Postives = 178/247 (72.06%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSP 2148
             G+  H T  N      + L++A Y+VDYEKN KG+NYWRNR++ VAKKF+D+G  ++FA+++ +  + ELS++G+ES       +  R  + +KF M  +FS +   LE+F+ D+    +  YLKSE IPE ND PVKVVVA+NFDEIVN+  KDVLIEFYAPWCGHCK+L PKY+EL +KLS + +IVIAKMDATANDVPSPYEV GFPTIYF+P N K +PK Y  GRE+ D + Y+  EA++P
Sbjct:  241 FGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNP 487          

HSP 2 Score: 191.045 bits (484), Expect = 1.893e-51
Identity = 95/200 (47.50%), Postives = 134/200 (67.00%), Query Frame = 3
Query:    9 SVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNN---IVIFHSKKMANKFEDTQVKY-KGDASEHQIRTWVEENM 596
             ++LVEF+APWCGHCK+LAPEYE AAT LK   P   +AKVDCTA T TC K+GVSGYPTLK+F++G+ A  Y G R+ADGI+ ++  ++GP+S  L+TEE F KF +  D  +VGFF    S+ +  FL  A  L +++RFAHT  E+L  +  Y +N   I++F    + NKFED  V Y +   +  +I+ +++EN+
Sbjct:   46 GLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNE--YDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENI 240          

HSP 3 Score: 70.4774 bits (171), Expect = 2.547e-11
Identity = 41/111 (36.94%), Postives = 64/111 (57.66%), Query Frame = 1
Query: 1840 NFDEIVNDPTKD--VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI---ASEASSPLK 2154
            NF+  ++D      +L+EF+APWCGHCK LAP+YE  A +L  +  + +AK+D TAN +  + Y VSG+PT+       +    +Y   R  D ++ ++   A  AS PL+
Sbjct:   34 NFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRL--KGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAG--AYDGPRTADGIVSHLKKQAGPASVPLR 140          

HSP 4 Score: 65.0846 bits (157), Expect = 1.372e-9
Identity = 31/63 (49.21%), Postives = 40/63 (63.49%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            E+  +L+EFYAPWCGHCK L P+Y+     L K DP I IAK+D TA       + V G+PT+
Sbjct:  393 ENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSK-DPNIVIAKMDATA-NDVPSPYEVRGFPTI 453          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|Q4VIT4|PDIA3_CHLAE (Protein disulfide-isomerase A3 OS=Chlorocebus aethiops OX=9534 GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 4.042e-87
Identity = 135/247 (54.66%), Postives = 178/247 (72.06%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSP 2148
             G+  H T  N      + L++A Y+VDYEKN KG+NYWRNR++ VAKKF+D+G  ++FA+++ +  + ELS++G+ES       +  R  + +KF M  +FS +   LE+F+ D+    +  YLKSE IPE ND PVKVVVA+NFDEIVN+  KDVLIEFYAPWCGHCK+L PKY+EL +KLS + +IVIAKMDATANDVPSPYEV GFPTIYF+P N K +PK Y  GRE+ D + Y+  EA++P
Sbjct:  241 FGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNP 487          

HSP 2 Score: 188.734 bits (478), Expect = 1.025e-50
Identity = 95/200 (47.50%), Postives = 134/200 (67.00%), Query Frame = 3
Query:    9 SVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNN---IVIFHSKKMANKFEDTQVKY-KGDASEHQIRTWVEENM 596
             ++LVEF+APWCGHCK+LAPEYE AAT LK   P   +AKVDCTA T TC K+GVSGYPTLK+F++G+ A  Y G R+ADGI+ ++  ++GP+S  L+TEE F KF +  D  VVGFF    S+ +  FL  A  L +++RFAHT  ++L  +  Y +N   I++F    + NKFED  V Y +   +  +I+ +++EN+
Sbjct:   46 GLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFDDLFSEAHSEFLKAASNLRDNYRFAHTNVKSLVNE--YDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENI 240          

HSP 3 Score: 71.2478 bits (173), Expect = 1.829e-11
Identity = 42/111 (37.84%), Postives = 64/111 (57.66%), Query Frame = 1
Query: 1840 NFDEIVNDPTKD--VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI---ASEASSPLK 2154
            NF+  V+D      +L+EF+APWCGHCK LAP+YE  A +L  +  + +AK+D TAN +  + Y VSG+PT+       +    +Y   R  D ++ ++   A  AS PL+
Sbjct:   34 NFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRL--KGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAG--AYDGPRTADGIVSHLKKQAGPASVPLR 140          

HSP 4 Score: 65.0846 bits (157), Expect = 1.325e-9
Identity = 31/63 (49.21%), Postives = 40/63 (63.49%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            E+  +L+EFYAPWCGHCK L P+Y+     L K DP I IAK+D TA       + V G+PT+
Sbjct:  393 ENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSK-DPNIVIAKMDATA-NDVPSPYEVRGFPTI 453          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|Q8JG64|PDIA3_CHICK (Protein disulfide-isomerase A3 OS=Gallus gallus OX=9031 GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 8.706e-86
Identity = 135/246 (54.88%), Postives = 172/246 (69.92%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASS 2145
             G+  H T  N      + L+VA Y+VDYEKN KG+NYWRNR++ +AKKF+D+G  + FA+++ +    ELSE+G+++       +  R  +  KF M  +FS +   LE+F+ D+    +  YLKSE +PE ND PVKVVVA+NFDEIVN   KDVLIEFYAPWCGHCK+L PKY+EL +KLS + +IVIAKMDATANDVPSPYEV GFPTIYFAP   K SPK Y  GREV D + Y+  EA+S
Sbjct:  239 FGICPHMTEDNKDLIQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMIAKKFLDAGHKLSFAVASRKTFGHELSEFGLDNSVGEAPVVAIRTAKGDKFVMQEEFSRDGKALERFLQDYFDGNLKKYLKSEPVPENNDGPVKVVVAENFDEIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFAPAGKKQSPKKYEGGREVSDFISYLKREATS 484          

HSP 2 Score: 192.971 bits (489), Expect = 3.517e-52
Identity = 92/198 (46.46%), Postives = 131/198 (66.16%), Query Frame = 3
Query:    9 SVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKYKGD-ASEHQIRTWVEENM 596
             ++LVEF+APWCGHCK+LAPEYE AAT LK   P   + KVDCTA + TC K+GVSGYPTLK+F++G+ +  Y G R+ADGI+ ++  ++GP+S  L +  +F KF    D  VVGFF   S D Y  F+  A  L +++RFAHT +E L  K       +V++   ++ANKFED+ VKY  D  +  +I+ +++EN+
Sbjct:   44 GLVLVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LVKVDCTANSNTCNKYGVSGYPTLKIFRDGEESGTYDGPRTADGIVSHLKKQAGPASVALSSVADFEKFIGDKDASVVGFFRDASGDAYSEFMKAANNLRDNYRFAHTSEEQLVQKYEEDGEGVVLYRPSRLANKFEDSTVKYTEDKITSAKIKKFIQENI 238          

HSP 3 Score: 68.1662 bits (165), Expect = 1.629e-10
Identity = 34/90 (37.78%), Postives = 53/90 (58.89%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            VL+EF+APWCGHCK LAP+YE  A +L  +  + + K+D TAN +  + Y VSG+PT+       +    +Y   R  D ++ ++  +A 
Sbjct:   46 VLVEFFAPWCGHCKRLAPEYEAAATRL--KGIVPLVKVDCTANSNTCNKYGVSGYPTLKIFRDGEESG--TYDGPRTADGIVSHLKKQAG 131          

HSP 4 Score: 67.3958 bits (163), Expect = 2.431e-10
Identity = 38/90 (42.22%), Postives = 47/90 (52.22%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG--QFAFDYSGERSADGIIKYM 266
            E   +L+EFYAPWCGHCK L P+Y+     L K DP I IAK+D TA       + V G+PT+     G  Q    Y G R     I Y+
Sbjct:  391 EDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSK-DPNIVIAKMDATA-NDVPSPYEVRGFPTIYFAPAGKKQSPKKYEGGREVSDFISYL 478          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A1I8IGN6 (Protein disulfide-isomerase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005470g3 PE=3 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 2.373e-109
Identity = 159/259 (61.39%), Postives = 201/259 (77.61%), Query Frame = 1
Query: 1417 GLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRKSDL 2193
            G+ GHRT  N KYF K+PL+ A Y VDYE+NPKGTNYWRNRI+KVAKK+  +G  +HF+++N + M+ ELSE+G++SPD  KVY+ A++++ QKFKM  DF+M+  + F+ D    ++  YLKSE  PE    PVK+ VAKNFD++VNDPTKDVLIEFYAPWCGHCKSLAPKY+ELA+KLS E+D+VIAKMDATANDVP PY+V GFPTIYFAPK  K  PK Y  GREV+D + Y+A EA+  L+ +DR G  +K DL
Sbjct:  235 GMVGHRTSGNSKYF-KQPLVTAYYGVDYERNPKGTNYWRNRIMKVAKKY--TGTGLHFSVANSKAMSFELSEFGVDSPDEQKVYVAAKNDKGQKFKMAEDFTMDAFDAFLTDLQAGRLTPYLKSEPEPESQSAPVKIAVAKNFDKLVNDPTKDVLIEFYAPWCGHCKSLAPKYDELAEKLSGETDLVIAKMDATANDVPPPYDVRGFPTIYFAPKGGKSQPKQYQGGREVNDFITYLAKEATDELRGYDRAGNRKKQDL 490          

HSP 2 Score: 229.18 bits (583), Expect = 5.643e-63
Identity = 101/195 (51.79%), Postives = 134/195 (68.72%), Query Frame = 3
Query:   12 VILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            + LVEFYAPWCGHCK+LAP+YE AAT LK  DPP+ + KVDCTAET  C K+GVSGYPTLK+FKNG+ + DY+G R ADGI+KYM SK+GPSS+ LK     +K  A  +P VV FF+SES+    AF   A+ L+EDF FAH+    +++K  + + +VI     + +KFED ++ Y G      +R W+E N+
Sbjct:   39 IALVEFYAPWCGHCKRLAPQYEEAATRLKSSDPPVPLVKVDCTAETAVCGKYGVSGYPTLKIFKNGEVSSDYNGPREADGIVKYMKSKAGPSSRLLKDASGLDKLMAGQEPFVVAFFSSESASGLSAFKQAADSLSEDFAFAHSVSADINSKFGFNDQVVIMRPTVLQSKFEDNKLAYSGAMDSGALRAWIEANI 233          

HSP 3 Score: 81.2629 bits (199), Expect = 3.456e-12
Identity = 47/103 (45.63%), Postives = 65/103 (63.11%), Query Frame = 1
Query: 1840 NFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKL-SAESDIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            NFD  + D  +  L+EFYAPWCGHCK LAP+YEE A +L S++  + + K+D TA   V   Y VSG+PT+    KN + S   Y+  RE D ++KY+ S+A 
Sbjct:   29 NFDSRIKD-LEIALVEFYAPWCGHCKRLAPQYEEAATRLKSSDPPVPLVKVDCTAETAVCGKYGVSGYPTLKIF-KNGEVS-SDYNGPREADGIVKYMKSKAG 128          

HSP 4 Score: 62.3882 bits (150), Expect = 2.597e-6
Identity = 34/90 (37.78%), Postives = 49/90 (54.44%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAF--DYSGERSADGIIKYMVSKS 278
            +L+EFYAPWCGHCK LAP+Y+  A  L  +   + IAK+D TA       + V G+PT+     G  +    Y G R  +  I Y+  ++
Sbjct:  385 VLIEFYAPWCGHCKSLAPKYDELAEKLSGET-DLVIAKMDATA-NDVPPPYDVRGFPTIYFAPKGGKSQPKQYQGGREVNDFITYLAKEA 472          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A1I8IJ81 (Protein disulfide-isomerase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005470g1 PE=3 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 2.844e-109
Identity = 159/259 (61.39%), Postives = 201/259 (77.61%), Query Frame = 1
Query: 1417 GLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRKSDL 2193
            G+ GHRT  N KYF K+PL+ A Y VDYE+NPKGTNYWRNRI+KVAKK+  +G  +HF+++N + M+ ELSE+G++SPD  KVY+ A++++ QKFKM  DF+M+  + F+ D    ++  YLKSE  PE    PVK+ VAKNFD++VNDPTKDVLIEFYAPWCGHCKSLAPKY+ELA+KLS E+D+VIAKMDATANDVP PY+V GFPTIYFAPK  K  PK Y  GREV+D + Y+A EA+  L+ +DR G  +K DL
Sbjct:  235 GMVGHRTSGNSKYF-KQPLVTAYYGVDYERNPKGTNYWRNRIMKVAKKY--TGTGLHFSVANSKAMSFELSEFGVDSPDEQKVYVAAKNDKGQKFKMAEDFTMDAFDAFLTDMQAGRLTPYLKSEPEPESQSAPVKIAVAKNFDKLVNDPTKDVLIEFYAPWCGHCKSLAPKYDELAEKLSGETDLVIAKMDATANDVPPPYDVRGFPTIYFAPKGGKSQPKQYQGGREVNDFITYLAKEATDELRGYDRAGNRKKQDL 490          

HSP 2 Score: 229.18 bits (583), Expect = 5.473e-63
Identity = 101/195 (51.79%), Postives = 134/195 (68.72%), Query Frame = 3
Query:   12 VILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            + LVEFYAPWCGHCK+LAP+YE AAT LK  DPP+ + KVDCTAET  C K+GVSGYPTLK+FKNG+ + DY+G R ADGI+KYM SK+GPSS+ LK     +K  A  +P VV FF+SES+    AF   A+ L+EDF FAH+    +++K  + + +VI     + +KFED ++ Y G      +R W+E N+
Sbjct:   39 IALVEFYAPWCGHCKRLAPQYEEAATRLKSSDPPVPLVKVDCTAETAVCGKYGVSGYPTLKIFKNGEVSSDYNGPREADGIVKYMKSKAGPSSRLLKDASGLDKLMAGQEPFVVAFFSSESASGLSAFKQAADSLSEDFAFAHSVSADINSKFGFNDQVVIMRPTVLQSKFEDNKLAYSGAMDSGALRAWIEANI 233          

HSP 3 Score: 81.2629 bits (199), Expect = 3.395e-12
Identity = 47/103 (45.63%), Postives = 65/103 (63.11%), Query Frame = 1
Query: 1840 NFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKL-SAESDIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            NFD  + D  +  L+EFYAPWCGHCK LAP+YEE A +L S++  + + K+D TA   V   Y VSG+PT+    KN + S   Y+  RE D ++KY+ S+A 
Sbjct:   29 NFDSRIKD-LEIALVEFYAPWCGHCKRLAPQYEEAATRLKSSDPPVPLVKVDCTAETAVCGKYGVSGYPTLKIF-KNGEVS-SDYNGPREADGIVKYMKSKAG 128          

HSP 4 Score: 62.3882 bits (150), Expect = 2.689e-6
Identity = 34/90 (37.78%), Postives = 49/90 (54.44%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAF--DYSGERSADGIIKYMVSKS 278
            +L+EFYAPWCGHCK LAP+Y+  A  L  +   + IAK+D TA       + V G+PT+     G  +    Y G R  +  I Y+  ++
Sbjct:  385 VLIEFYAPWCGHCKSLAPKYDELAEKLSGET-DLVIAKMDATA-NDVPPPYDVRGFPTIYFAPKGGKSQPKQYQGGREVNDFITYLAKEA 472          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: T1G058 (Protein disulfide-isomerase OS=Helobdella robusta OX=6412 GN=20214456 PE=3 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.813e-107
Identity = 167/258 (64.73%), Postives = 202/258 (78.29%), Query Frame = 1
Query: 1417 GLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIE-SPDFSKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRKS 2187
            G+ GHRT  NV  F +RPLI   Y+VDY KNPKGTNYWRNRI+KVAKK  + GK++HFAISN  + N EL+E+G+  S D  K+ + AR+ ++QKF M  DFS++ LEKF NDFL+  +  YLKSE++P  ND PVKVVVA+ FD+IVND TKDVLIEFYAPWCGHCKSLAPKYEELA+KL+ E DIVIAKMDATANDVP+PY+V GFPTIYFAPKNSK  PK Y  GREVDD +KY+A E++ PL  + R G+  K+
Sbjct:  231 GMVGHRTTGNVAQF-ERPLITVYYDVDYVKNPKGTNYWRNRIIKVAKKLSEEGKNVHFAISNADQFNHELTEHGLTYSAD--KLVVAARNAKDQKFSMTEDFSVDALEKFANDFLEGNLKPYLKSEAVPTSNDGPVKVVVAEEFDKIVNDETKDVLIEFYAPWCGHCKSLAPKYEELAQKLAEEEDIVIAKMDATANDVPAPYDVKGFPTIYFAPKNSKKFPKRYEGGREVDDFIKYLAKESTDPLTKYTRDGKKIKA 485          

HSP 2 Score: 213.772 bits (543), Expect = 2.372e-57
Identity = 98/182 (53.85%), Postives = 134/182 (73.63%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETK-TCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYK 548
            + + LV+F+APWCGHCKKLAPE+E AAT LK+ DPP+ + +VDCT   K +C KHGVSGYPTLKVFK G+FAFDY G R ADGI+KYM  K+GPSSKELK+ ++  KF  + DP V+GFF S SS+    F  +A  L+++FRFAHTFD ++ +  NY+  IV++   ++ +K E +++ Y+
Sbjct:   37 YEIALVKFFAPWCGHCKKLAPEFERAATILKRNDPPVILVEVDCTEGGKDSCSKHGVSGYPTLKVFKQGEFAFDYEGPRDADGIVKYMKGKAGPSSKELKSLDDVKKFLDNFDPSVIGFFKSSSSEENVQFQKLASALSDNFRFAHTFDPSVLSHYNYEGKIVMYQPPRLHSKMEPSELVYE 218          

HSP 3 Score: 72.4034 bits (176), Expect = 1.855e-9
Identity = 41/90 (45.56%), Postives = 54/90 (60.00%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVF-KNG-QFAFDYSGERSADGIIKYMVSKS 278
            +L+EFYAPWCGHCK LAP+YE  A  L +++  I IAK+D TA       + V G+PT+    KN  +F   Y G R  D  IKY+  +S
Sbjct:  382 VLIEFYAPWCGHCKSLAPKYEELAQKLAEEE-DIVIAKMDATA-NDVPAPYDVKGFPTIYFAPKNSKKFPKRYEGGREVDDFIKYLAKES 469          

HSP 4 Score: 61.2326 bits (147), Expect = 7.176e-6
Identity = 35/101 (34.65%), Postives = 56/101 (55.45%), Query Frame = 1
Query: 1879 LIEFYAPWCGHCKSLAPKYEELAKKLSA-ESDIVIAKMDAT--ANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI---ASEASSPLKNFD 2163
            L++F+APWCGHCK LAP++E  A  L   +  +++ ++D T    D  S + VSG+PT+    +        Y   R+ D ++KY+   A  +S  LK+ D
Sbjct:   41 LVKFFAPWCGHCKKLAPEFERAATILKRNDPPVILVEVDCTEGGKDSCSKHGVSGYPTLKVFKQG--EFAFDYEGPRDADGIVKYMKGKAGPSSKELKSLD 139          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: K1Q7T5 (Protein disulfide-isomerase OS=Crassostrea gigas OX=29159 GN=CGI_10011652 PE=3 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 5.587e-107
Identity = 165/253 (65.22%), Postives = 195/253 (77.08%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQG 2172
            +GL GHRT SN + F K+PL+VA Y+VDY KN KGTNYWRNR++KVAKK  D GK I FA+SN ++ + EL E+G+      K  +  RDER++K+ M  +FSM+NLEKF+ DFL +KV  YLKSE +P+  D PVKVVVAKNFDEIVND  +DVLIEFYAPWCGHCK L PKY EL +KL+ ES I IAKMDATANDV  PYEVSGFPTIYFAPK SK+SPK YS GREVDD LKY+A EA++ L  FDR G
Sbjct:  231 LGLCGHRTQSNAEKF-KKPLVVAFYDVDYVKNEKGTNYWRNRVMKVAKKIQDEGKKIFFAVSNSKDFSYELGEFGLGDVSGEKPVVAVRDERDRKYVMSDEFSMDNLEKFVRDFLDDKVEPYLKSEPVPDNTDAPVKVVVAKNFDEIVNDSERDVLIEFYAPWCGHCKQLEPKYTELGEKLAEESGITIAKMDATANDVAKPYEVSGFPTIYFAPKGSKNSPKRYSGGREVDDFLKYLAKEATNELSGFDRDG 482          

HSP 2 Score: 233.417 bits (594), Expect = 1.266e-64
Identity = 104/198 (52.53%), Postives = 146/198 (73.74%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            +H +ILVEF+APWCGHCKKLAPEYE AAT+LK  DPP+ +AKVDCTA  +TC+K GVSGYPTLK+F+ G+F+ +Y G R ADGIIKYM +++GP+SKEL    +  KF + AD  V+GFF    S+L K F  VA+ ++ D +FAHT  + +  K  +KN+IV++  K++ NKFE +++KY  DA+ ++I+ W+  N+
Sbjct:   33 DHELILVEFFAPWCGHCKKLAPEYERAATSLKDNDPPVPLAKVDCTASEETCKKFGVSGYPTLKIFRAGEFSEEYGGPREADGIIKYMQTRAGPTSKELNNVADAEKFLSKADYGVIGFFEDGESELAKTFQKVADAMSTDLKFAHTSSKAVLDKYGFKNDIVLYQPKRLRNKFEPSELKYTDDATVYKIKEWLNNNI 230          

HSP 3 Score: 70.0922 bits (170), Expect = 9.562e-9
Identity = 38/93 (40.86%), Postives = 57/93 (61.29%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKL-SAESDIVIAKMDATAN-DVPSPYEVSGFPT--IYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            +L+EF+APWCGHCK LAP+YE  A  L   +  + +AK+D TA+ +    + VSG+PT  I+ A + S+     Y   RE D ++KY+ + A 
Sbjct:   37 ILVEFFAPWCGHCKKLAPEYERAATSLKDNDPPVPLAKVDCTASEETCKKFGVSGYPTLKIFRAGEFSEE----YGGPREADGIIKYMQTRAG 125          

HSP 4 Score: 67.781 bits (164), Expect = 6.460e-8
Identity = 36/90 (40.00%), Postives = 51/90 (56.67%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG--QFAFDYSGERSADGIIKYMVSKS 278
            +L+EFYAPWCGHCK+L P+Y      L  ++  I IAK+D TA     + + VSG+PT+     G       YSG R  D  +KY+  ++
Sbjct:  384 VLIEFYAPWCGHCKQLEPKYTELGEKL-AEESGITIAKMDATA-NDVAKPYEVSGFPTIYFAPKGSKNSPKRYSGGREVDDFLKYLAKEA 471          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: R7UDG3 (Protein disulfide-isomerase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_164804 PE=3 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 1.313e-106
Identity = 167/259 (64.48%), Postives = 201/259 (77.61%), Query Frame = 1
Query: 1417 GLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRKSDL 2193
            GLAG RT SN++ F K+PL+VA Y+VDY KN KGTNYWRNR++KVAKKF   GK++ FAI++  + + EL+E+G++  D  K  + ARD  NQKF M  +FSM+NLE F+ DFL  K+  YLKSE IP   D+ VKVVVAKNFDEIVND +KDVLIEFYAPWCGHCKSLAPKYEELA KL+ E DIVIAKMDATANDVP  YEV GFPT++F+PK SK SP  Y  GREV+D LKYIA  A+ PLK +DR G+ +KS+L
Sbjct:  235 GLAGQRTTSNLEQF-KQPLVVAYYDVDYVKNAKGTNYWRNRVMKVAKKF--EGKTVFFAIASTDDFSPELNEFGMQVSDDGKPIVAARDASNQKFIMTQEFSMDNLEAFVTDFLDGKLEPYLKSEPIPATQDDAVKVVVAKNFDEIVNDESKDVLIEFYAPWCGHCKSLAPKYEELATKLAKEEDIVIAKMDATANDVPKQYEVRGFPTLFFSPKGSKMSPLKYEGGREVEDFLKYIAKTATDPLKGYDRNGKKKKSEL 490          

HSP 2 Score: 249.98 bits (637), Expect = 8.612e-71
Identity = 110/198 (55.56%), Postives = 150/198 (75.76%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            ++ V LV+FYAPWCGHCKKLAPE+E A++ L   DPP+A+ KVDCT ETK C+KHGVSGYPTLK+F+ G+ A DY+G R ADGI+K M SK+GPSSK+L TE     +    + V++GFF SE S+L K F  +A+ L+EDFRFAH+ D+ ++ K +Y  ++VI   KKMANKFE++ VKY G+AS H+++TW+ +N+
Sbjct:   36 DYGVALVKFYAPWCGHCKKLAPEFERASSVLASDDPPVALVKVDCTTETKICQKHGVSGYPTLKIFRGGELAEDYNGPRDADGIVKVMRSKAGPSSKQLMTEAQVEAYMNKEENVILGFFDSEHSELLKQFKKLADALSEDFRFAHSVDKDVNAKFSYSEDVVIVRPKKMANKFEESTVKYSGEASLHKMKTWLHDNV 233          

HSP 3 Score: 73.559 bits (179), Expect = 8.437e-10
Identity = 39/86 (45.35%), Postives = 52/86 (60.47%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG--QFAFDYSGERSADGIIKYM 266
            +L+EFYAPWCGHCK LAP+YE  AT L K++  I IAK+D TA     +++ V G+PTL     G       Y G R  +  +KY+
Sbjct:  385 VLIEFYAPWCGHCKSLAPKYEELATKLAKEE-DIVIAKMDATA-NDVPKQYEVRGFPTLFFSPKGSKMSPLKYEGGREVEDFLKYI 468          

HSP 4 Score: 62.003 bits (149), Expect = 3.341e-6
Identity = 35/110 (31.82%), Postives = 60/110 (54.55%), Query Frame = 1
Query: 1819 VKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            V V+   NF+  + D     L++FYAPWCGHCK LAP++E  +  L+++   + + K+D T    +   + VSG+PT+           + Y+  R+ D ++K + S+A 
Sbjct:   22 VVVLTDANFESAIAD-YGVALVKFYAPWCGHCKKLAPEFERASSVLASDDPPVALVKVDCTTETKICQKHGVSGYPTLKIF--RGGELAEDYNGPRDADGIVKVMRSKAG 128          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: pdia3 (protein disulfide isomerase family A member 3 [Source:NCBI gene;Acc:103022595])

HSP 1 Score: 286.574 bits (732), Expect = 6.804e-88
Identity = 134/248 (54.03%), Postives = 176/248 (70.97%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
             G+  H T  N  +   + L+VA Y+VDY+KNPKG+NYWRNR++KVAK F+D GK + FA++N    + ++SE G+++       +  R  +  K+ M  +FS +   LE+F+ D+   K+  YLKSE IPE ND PVKVVVA+NFD IVND +KDVLIEFYAPWCGHCKSL PKY+EL +KL+ + ++VIAKMDATANDVPS Y+V GFPTIYF+P   K +PK Y  GREV D + Y+  EAS+PL
Sbjct:  230 FGMCPHMTEDNKDHLKGKDLLVAYYDVDYDKNPKGSNYWRNRVMKVAKGFLDEGKKLSFAVANKNSFSHDVSELGLDASGGELPVVGIRTAKGDKYVMQEEFSRDGKALERFLQDYFDGKLKRYLKSEPIPENNDGPVKVVVAENFDSIVNDDSKDVLIEFYAPWCGHCKSLEPKYKELGEKLANDPNVVIAKMDATANDVPSSYDVRGFPTIYFSPAGQKQNPKRYEGGREVSDFISYLKKEASNPL 477          

HSP 2 Score: 189.504 bits (480), Expect = 5.247e-52
Identity = 93/200 (46.50%), Postives = 132/200 (66.00%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKYKGDA-SEHQIRTWVEENM 596
            +H +ILVEF+APWCGHCK+LAPEYE AAT LK     +++AKVDCTA +  C K+GVSGYPTLK+F++G+ +  Y G R+ADGI+ ++  ++GP+S ELKT  +F KF    D  VVGFF    S     FL  A  L E +RFAHT  E L  K +     +V+F   ++ NKFE++ VK+  D  +  +I+ ++++N+
Sbjct:   33 DHDLILVEFFAPWCGHCKRLAPEYEAAATRLKGI---VSLAKVDCTANSNVCSKYGVSGYPTLKIFRDGEESGAYDGPRTADGIVSHLKKQAGPASVELKTVADFEKFIGDRDASVVGFFADGGSAAQSEFLKSASALRESYRFAHTNLEDLLKKSDIDGEGVVLFRPPRLNNKFEESSVKFSEDKFTNAKIKRFIQDNI 229          

HSP 3 Score: 72.7886 bits (177), Expect = 5.881e-13
Identity = 36/90 (40.00%), Postives = 55/90 (61.11%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            +L+EF+APWCGHCK LAP+YE  A +L  +  + +AK+D TAN +V S Y VSG+PT+       +    +Y   R  D ++ ++  +A 
Sbjct:   37 ILVEFFAPWCGHCKRLAPEYEAAATRL--KGIVSLAKVDCTANSNVCSKYGVSGYPTLKIFRDGEESG--AYDGPRTADGIVSHLKKQAG 122          

HSP 4 Score: 65.0846 bits (157), Expect = 1.337e-10
Identity = 35/86 (40.70%), Postives = 45/86 (52.33%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG--QFAFDYSGERSADGIIKYM 266
            +L+EFYAPWCGHCK L P+Y+     L   DP + IAK+D TA       + V G+PT+     G  Q    Y G R     I Y+
Sbjct:  386 VLIEFYAPWCGHCKSLEPKYKELGEKL-ANDPNVVIAKMDATA-NDVPSSYDVRGFPTIYFSPAGQKQNPKRYEGGREVSDFISYL 469          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: pdia7 (protein disulfide-isomerase A3-like [Source:NCBI gene;Acc:103024123])

HSP 1 Score: 260.766 bits (665), Expect = 3.370e-78
Identity = 129/249 (51.81%), Postives = 166/249 (66.67%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSE-YGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
             GL  H T  N +    R L+ A Y+VDY +NPKGTNYWRNR++KVA +F   G S  FA+++  +   EL E +G+         IT R    QK+ M  +F+ +   LEKF+ D+  +++  Y+KSE+ PE N  PVKVVVA  F+EIVN+P KDVL+EFYAPWCGHCK+L PKY EL KKLS++ +IVIAKMDATANDVP  Y+V GFPTIYFAP   K  P+ Y  GREV D + ++  EA+ PL
Sbjct:  232 FGLCPHLTSENKEVLWARDLLTAYYDVDYVRNPKGTNYWRNRVMKVATQFQSRGLS--FAVADQVDFLDELEEEFGLGLSGGELPVITIRTRAGQKYTMQEEFTRDGKSLEKFLEDYFAKRLKPYVKSEAAPESNGGPVKVVVANTFEEIVNNPEKDVLVEFYAPWCGHCKNLEPKYTELGKKLSSDPNIVIAKMDATANDVPLDYDVQGFPTIYFAPAGQKEQPRRYEGGREVSDFISFLKKEATHPL 478          

HSP 2 Score: 181.8 bits (460), Expect = 2.906e-49
Identity = 87/199 (43.72%), Postives = 127/199 (63.82%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            EH  +LVEF+APWCGHC++LAPEYE AAT LK     +++AKVDCT  +KTCE   V+GYPTLK+F+NG+ A  Y G R+ADGI+ YM  ++GPSS  L +E + + F  + D  VVGFF+   S     FL  +  L + +RFAH  D  +  K    + ++++F    + +KFE++ VK+    S   +RT++ +N+
Sbjct:   36 EHDTLLVEFFAPWCGHCQRLAPEYEAAATRLKGT---VSLAKVDCTVNSKTCETFVVNGYPTLKIFQNGEEASSYDGPRTADGIVSYMKKQAGPSSVPLHSEADLDSFINTFDASVVGFFSGPDSLQLAEFLKASSALRDSYRFAHATDLKIGLKHGVNSESVLLFRPPHLNSKFEESVVKFTESVSTAALRTFIRDNI 231          

HSP 3 Score: 67.3958 bits (163), Expect = 2.613e-11
Identity = 33/90 (36.67%), Postives = 52/90 (57.78%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAND-VPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            +L+EF+APWCGHC+ LAP+YE  A +L  +  + +AK+D T N      + V+G+PT+       + S  SY   R  D ++ Y+  +A 
Sbjct:   40 LLVEFFAPWCGHCQRLAPEYEAAATRL--KGTVSLAKVDCTVNSKTCETFVVNGYPTLKIFQNGEEAS--SYDGPRTADGIVSYMKKQAG 125          

HSP 4 Score: 65.0846 bits (157), Expect = 1.310e-10
Identity = 36/86 (41.86%), Postives = 45/86 (52.33%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQ--FAFDYSGERSADGIIKYM 266
            +LVEFYAPWCGHCK L P+Y      L   DP I IAK+D TA     + + V G+PT+     GQ      Y G R     I ++
Sbjct:  387 VLVEFYAPWCGHCKNLEPKYTELGKKL-SSDPNIVIAKMDATANDVPLD-YDVQGFPTIYFAPAGQKEQPRRYEGGREVSDFISFL 470          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: pdia8 (protein disulfide-isomerase A3-like [Source:NCBI gene;Acc:103028648])

HSP 1 Score: 258.84 bits (660), Expect = 1.885e-77
Identity = 126/250 (50.40%), Postives = 169/250 (67.60%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSE-YGIESPDFSKV-YITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
             G+  H T  N+    KR L+ A Y++DY  NPKG+NYWRNR++KVA ++  S + + F+++N ++   EL E YG+ S + S+V ++T R     K+ M  +F+ +   LE+F+ D+    +  Y+KSE +P KN+ PVKVVVA  F+EIVNDP KDVLIEFYAPWCGHCK L PKY EL ++LS++ +IVIAKMDATANDVP  Y+V GFPTIYF P   K  PK Y   REV D L ++  EA+S L
Sbjct:  238 FGICPHLTKENIDQLRKRDLLTAYYDLDYVHNPKGSNYWRNRVMKVASQY--SSRGLLFSVANRKDFEDELEEDYGLGSTEGSEVPFVTIRTRLGHKYSMREEFTRDGKSLERFLEDYYANSLKRYIKSEPVPAKNNGPVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTELGQELSSDPNIVIAKMDATANDVPEGYDVHGFPTIYFVPAGRKAEPKRYEGAREVKDFLNFLKREATSSL 485          

HSP 2 Score: 176.792 bits (447), Expect = 1.560e-47
Identity = 89/199 (44.72%), Postives = 122/199 (61.31%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            EH  +LV+FYAPWCGHCKKLAPE+E AA  LK     + +AKVDCT+ T+ C + GV+GYPTLK+F+NG+ +  Y G RSA GI+  M  ++GP S  L  E++   F    D  VVG F S  S     FL  A  + E FRFAHT D  L  K N  +  I++F   ++A+KFE++ V + G  S   +R ++ +N+
Sbjct:   42 EHETMLVKFYAPWCGHCKKLAPEFETAAKRLKGV---VTLAKVDCTSSTEVCGRFGVTGYPTLKIFRNGRESSSYDGPRSAVGIVDQMKKQAGPDSVPLHNEKDLETFVNHYDASVVGVFESSDSPQLVEFLKGANLMRESFRFAHTTDLQLGLKYNLTSEGILLFRPPRLASKFEESVVSHTGPFSVTALRRFIRDNI 237          

HSP 3 Score: 69.3218 bits (168), Expect = 7.579e-12
Identity = 47/142 (33.10%), Postives = 78/142 (54.93%), Query Frame = 1
Query: 1744 INDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGRE---VDDMLKYIASEASSPLKN 2157
            ++  L   + V L   S+  ++D  V  +   +FD +  +  + +L++FYAPWCGHCK LAP++E  AK+L     + +AK+D T++ +V   + V+G+PT+    +N + S  SY   R    + D +K  A   S PL N
Sbjct:    5 VSGLLSGALFVCLWGGSVSARSD--VVELTDVDFDYVAAE-HETMLVKFYAPWCGHCKKLAPEFETAAKRLKGV--VTLAKVDCTSSTEVCGRFGVTGYPTLKIF-RNGRES-SSYDGPRSAVGIVDQMKKQAGPDSVPLHN 139          

HSP 4 Score: 67.3958 bits (163), Expect = 2.827e-11
Identity = 36/86 (41.86%), Postives = 47/86 (54.65%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFA--FDYSGERSADGIIKYM 266
            +L+EFYAPWCGHCKKL P+Y      L   DP I IAK+D TA     E + V G+PT+     G+ A    Y G R     + ++
Sbjct:  394 VLIEFYAPWCGHCKKLEPKYTELGQEL-SSDPNIVIAKMDATA-NDVPEGYDVHGFPTIYFVPAGRKAEPKRYEGAREVKDFLNFL 477          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: pdia8 (protein disulfide-isomerase A3-like [Source:NCBI gene;Acc:103028648])

HSP 1 Score: 226.098 bits (575), Expect = 2.274e-65
Identity = 117/250 (46.80%), Postives = 161/250 (64.40%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSE-YGIESPDFSKV-YITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
             G+  H T  N+    KR L+ A Y++DY  NPKG+NYWRNR++KVA ++  S + + F+++N ++   EL E YG+ S + S+V ++T R     K+ M  +F+ +   LE+F+ D+    +  Y+KSE +P KN+ PVKVVVA  F+EIVNDP KDVLIEFYAPWCGHCK L PKY EL ++LS++ +IVIAKMDATANDVP  Y+V G+          K  P      REV D L ++  EA+S L
Sbjct:  238 FGICPHLTKENIDQLRKRDLLTAYYDLDYVHNPKGSNYWRNRVMKVASQY--SSRGLLFSVANRKDFEDELEEDYGLGSTEGSEVPFVTIRTRLGHKYSMREEFTRDGKSLERFLEDYYANSLKRYIKSEPVPAKNNGPVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTELGQELSSDPNIVIAKMDATANDVPEGYDVHGY---------VKQPP----GAREVKDFLNFLKREATSSL 472          

HSP 2 Score: 176.792 bits (447), Expect = 1.203e-47
Identity = 89/199 (44.72%), Postives = 122/199 (61.31%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKN-NIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            EH  +LV+FYAPWCGHCKKLAPE+E AA  LK     + +AKVDCT+ T+ C + GV+GYPTLK+F+NG+ +  Y G RSA GI+  M  ++GP S  L  E++   F    D  VVG F S  S     FL  A  + E FRFAHT D  L  K N  +  I++F   ++A+KFE++ V + G  S   +R ++ +N+
Sbjct:   42 EHETMLVKFYAPWCGHCKKLAPEFETAAKRLKGV---VTLAKVDCTSSTEVCGRFGVTGYPTLKIFRNGRESSSYDGPRSAVGIVDQMKKQAGPDSVPLHNEKDLETFVNHYDASVVGVFESSDSPQLVEFLKGANLMRESFRFAHTTDLQLGLKYNLTSEGILLFRPPRLASKFEESVVSHTGPFSVTALRRFIRDNI 237          

HSP 3 Score: 69.3218 bits (168), Expect = 7.510e-12
Identity = 47/142 (33.10%), Postives = 78/142 (54.93%), Query Frame = 1
Query: 1744 INDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGRE---VDDMLKYIASEASSPLKN 2157
            ++  L   + V L   S+  ++D  V  +   +FD +  +  + +L++FYAPWCGHCK LAP++E  AK+L     + +AK+D T++ +V   + V+G+PT+    +N + S  SY   R    + D +K  A   S PL N
Sbjct:    5 VSGLLSGALFVCLWGGSVSARSD--VVELTDVDFDYVAAE-HETMLVKFYAPWCGHCKKLAPEFETAAKRLKGV--VTLAKVDCTSSTEVCGRFGVTGYPTLKIF-RNGRES-SSYDGPRSAVGIVDQMKKQAGPDSVPLHN 139          

HSP 4 Score: 61.6178 bits (148), Expect = 1.698e-9
Identity = 30/56 (53.57%), Postives = 35/56 (62.50%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGY 182
            +L+EFYAPWCGHCKKL P+Y      L   DP I IAK+D TA     E + V GY
Sbjct:  394 VLIEFYAPWCGHCKKLEPKYTELGQEL-SSDPNIVIAKMDATA-NDVPEGYDVHGY 447          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: pdia8 (protein disulfide-isomerase A3-like [Source:NCBI gene;Acc:103028648])

HSP 1 Score: 214.927 bits (546), Expect = 1.646e-61
Identity = 113/250 (45.20%), Postives = 159/250 (63.60%), Query Frame = 1
Query: 1411 SMGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSE-YGIESPDFSKV-YITARDERNQKFKMIADF-SMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
            + G+  H T  N+    KR L+ A Y++DY  NPKG+NYWRN ++KVA ++  S + + F+++N ++   EL E YG+ S + S+V ++T R     K+ M  +F   ++LE+F+ D+    +  Y+KSE +P KN+ PVKVVVA  F+EIVNDP KDVLIEFYAPWCGHCK L PKY EL ++LS++ +IVIAKMDATANDVP  Y+V                   ++  REV D L ++  EA+S L
Sbjct:  232 NFGICPHLTKENIDQLRKRDLLTAYYDLDYVHNPKGSNYWRN-VMKVASQY--SSRGLLFSVANRKDFEDELEEDYGLGSTEGSEVPFVTIRTRLGHKYSMREEFRDGKSLERFLEDYYANSLKRYIKSEPVPAKNNGPVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTELGQELSSDPNIVIAKMDATANDVPEGYDV------------------HFNGAREVKDFLNFLKREATSSL 460          

HSP 2 Score: 156.377 bits (394), Expect = 1.211e-40
Identity = 87/198 (43.94%), Postives = 122/198 (61.62%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAK-VDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEEN 593
            EH  +LV+FYA  CGHCKKLAPE+E AA  LK     + +AK VDCT+ T+ C + GV+GYPTLK+F+NG+ +  Y G RSA GI+  M  ++GP S  L  E++   F    D  VV F +S+S  L + FL  A  + E FRFAHT D  L  K N  + I++F   ++A+KFE++ V + G  S   +R ++ +N
Sbjct:   42 EHETMLVKFYA--CGHCKKLAPEFETAAKRLKGV---VTLAKQVDCTSSTEVCGRFGVTGYPTLKIFRNGRESSSYDGPRSA-GIVDQMKKQAGPDSVPLHNEKDLETFVNHYDASVVVFESSDSPQLVE-FLKGANLMRESFRFAHTTDLQLGLKYNLTSGILLFRPPRLASKFEESVVSHTGPFSVTALRRFIRDN 232          

HSP 3 Score: 60.077 bits (144), Expect = 4.950e-9
Identity = 26/43 (60.47%), Postives = 30/43 (69.77%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTA 143
            +L+EFYAPWCGHCKKL P+Y      L   DP I IAK+D TA
Sbjct:  387 VLIEFYAPWCGHCKKLEPKYTELGQEL-SSDPNIVIAKMDATA 428          

HSP 4 Score: 51.9878 bits (123), Expect = 1.616e-6
Identity = 45/142 (31.69%), Postives = 76/142 (53.52%), Query Frame = 1
Query: 1744 INDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAK-MDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGRE--VDDMLKYIASEASSPLKN 2157
            ++  L   + V L   S+  ++D  V  +   +FD +  +  + +L++FYA  CGHCK LAP++E  AK+L     + +AK +D T++ +V   + V+G+PT+    +N + S  SY   R   + D +K  A   S PL N
Sbjct:    5 VSGLLSGALFVCLWGGSVSARSD--VVELTDVDFDYVAAE-HETMLVKFYA--CGHCKKLAPEFETAAKRLKGV--VTLAKQVDCTSSTEVCGRFGVTGYPTLKIF-RNGRES-SSYDGPRSAGIVDQMKKQAGPDSVPLHN 137          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: pdia3 (protein disulfide isomerase family A, member 3 [Source:ZFIN;Acc:ZDB-GENE-031002-9])

HSP 1 Score: 274.633 bits (701), Expect = 5.542e-84
Identity = 131/245 (53.47%), Postives = 174/245 (71.02%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSME--NLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            +G+  H T  N   F  + L+VA Y+VDY KNPKG+NYWRNR++KVAKKFI+ G ++ +AI+N ++  Q+LS+YG+E        +  +     K+ +  +F+ +  +LE F+ D+   K+  +LKSE IPE ND PVKVVVA+ FDE+VND +KDVLIEFYAPWCGHCK+L PKY ELA KL  + +I+IAKMDATANDVP+ Y+V GFPTIYF+P  SK SPK Y  GREV D + Y+  EA+
Sbjct:  237 LGICPHLTDDNKDLFKGKDLLVAYYDVDYTKNPKGSNYWRNRVMKVAKKFIEEGHTLSYAIANHKDFGQQLSDYGLEHVSGDVPVVAIKKSNGDKYILREEFTRDGKSLENFLQDYFDGKLKKHLKSEPIPEDNDGPVKVVVAEIFDELVNDESKDVLIEFYAPWCGHCKNLEPKYLELADKLKNDPNILIAKMDATANDVPAQYDVRGFPTIYFSPMGSKDSPKKYEGGREVSDFISYLKREAT 481          

HSP 2 Score: 209.92 bits (533), Expect = 5.707e-60
Identity = 98/198 (49.49%), Postives = 139/198 (70.20%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDA-SEHQIRTWVEENM 596
            H ++LVEF+APWCGHCK+LAPEYE AAT LK     +A+AKVDCTA T+TC K GVSGYPTLK+F++G+ + DY G R+ADGI+ ++  ++GPSS ELKT E+  KF    DP +VGFF   SSD    F+ VA    +++RFAH+  + +  K   +  IV+F   ++A+KFE+TQV Y  D+ S  +I+ ++++N+
Sbjct:   42 HDMVLVEFFAPWCGHCKRLAPEYEKAATKLKNT---VALAKVDCTANTETCNKFGVSGYPTLKIFRDGELSSDYDGPRTADGIVGFLKKQAGPSSVELKTVEDLEKFVGDNDPSIVGFFKDASSDAQTEFMKVASSQRDNYRFAHSNVQAVLDKQGAEEAIVVFRPLRLASKFEETQVTYAEDSYSSAKIKAFIQDNI 236          

HSP 3 Score: 71.633 bits (174), Expect = 3.002e-13
Identity = 36/90 (40.00%), Postives = 55/90 (61.11%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            VL+EF+APWCGHCK LAP+YE+ A KL  ++ + +AK+D TAN +  + + VSG+PT+         S   Y   R  D ++ ++  +A 
Sbjct:   45 VLVEFFAPWCGHCKRLAPEYEKAATKL--KNTVALAKVDCTANTETCNKFGVSGYPTLKIFRDGELSS--DYDGPRTADGIVGFLKKQAG 130          

HSP 4 Score: 66.2402 bits (160), Expect = 1.187e-11
Identity = 38/90 (42.22%), Postives = 47/90 (52.22%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG--QFAFDYSGERSADGIIKYM 266
            E   +L+EFYAPWCGHCK L P+Y   A  L K DP I IAK+D TA      ++ V G+PT+     G       Y G R     I Y+
Sbjct:  389 ESKDVLIEFYAPWCGHCKNLEPKYLELADKL-KNDPNILIAKMDATA-NDVPAQYDVRGFPTIYFSPMGSKDSPKKYEGGREVSDFISYL 476          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 184.882 bits (468), Expect = 5.950e-50
Identity = 101/250 (40.40%), Postives = 153/250 (61.20%), Query Frame = 1
Query: 1411 SMGLAGHRTHSN--VKYFAKRPLIVALYNVDYEKNPK-GTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMI-ADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVP-SPYEVSGFPTIYFAPKNSKHSPKSYSSG-REVDDMLKYIASEAS 2142
            S+ L G R  SN   +Y ++RPL+V  Y VD+  + +  T +WR+++L+VAK F        FAI++  + ++ELS+ G+      +V     D   +K+ M   +F  + L  F+  F + K+   +KS+ +P+ N  PVKVVV + F+++V D +KDVLIEFYAPWCGHCKSL P Y++L KK      +VIAKMDAT ND+P   Y+  GFPTIYF+P  +K  P  ++ G R+++ + K+I   A+
Sbjct:  387 SVPLVGQRKPSNEAKRYASRRPLVVVFYGVDFSFDYRTATQFWRSKVLEVAKDF----PKFTFAIASEDDYSKELSDLGLAESG-EEVNAAILDASGKKYAMAPEEFDADVLRDFVISFEKGKLKAVVKSQPLPKSNKGPVKVVVGRTFEQMVLDNSKDVLIEFYAPWCGHCKSLEPIYKDLGKKYKGHKGLVIAKMDATVNDIPHDSYKAEGFPTIYFSPSGAKDRPIKFADGSRDLESLSKFIEKHAT 631          

HSP 2 Score: 176.407 bits (446), Expect = 5.206e-47
Identity = 84/198 (42.42%), Postives = 129/198 (65.15%), Query Frame = 3
Query:   12 VILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVV-GFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLN-YKNNIVIFHSKKMANKFEDTQVKY--KGDASEHQIRTWVEEN 593
            +ILVEFYAPWCGHCKKLAPEYE AA  L K  PPI +AKVD T E++  ++ GVSGYPTLK+F+ G+ A+DY+G R   GI+ +M+ ++GP+S+ELK+ +  N F  + D VV+ G F +E     + F      + E+F+F HTF+E +   L      +V+ H ++  +K+E  Q  +  + D+++  ++ +VE++
Sbjct:  190 IILVEFYAPWCGHCKKLAPEYEKAAQELSKNTPPIPLAKVDATVESELGKRFGVSGYPTLKLFRKGK-AYDYNGPREQYGIVSHMIEQAGPASQELKSMKQLNGFVQNGDDVVILGVFKNEQDVALQLFQETGNNVREEFKFYHTFEENIKNHLKAVDGQVVVLHPERFQSKYEPKQFTFDIQADSTDSDLKAFVEKH 386          

HSP 3 Score: 113.235 bits (282), Expect = 3.156e-26
Identity = 58/123 (47.15%), Postives = 75/123 (60.98%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGII---KYMVS---KSGPSSKELKTEENFNKFTASADPVVVGFFT 365
            +L+EFYAPWCGHCK+ A EYE  A  L + DPPI +AKVD T      E+  VSGYPT+K+ K GQ A DY G+R+ D II   K + S   K  P +    TE NF++    AD ++V F+ 
Sbjct:   76 VLLEFYAPWCGHCKEFASEYEKIAKELAENDPPIPVAKVDATVAVHLAERFSVSGYPTIKILKKGQ-AVDYDGDRTQDAIIAKVKEVASPDWKPPPEAVLTLTESNFDEIVNDADIILVEFYA 197          

HSP 4 Score: 81.2629 bits (199), Expect = 3.305e-16
Identity = 46/112 (41.07%), Postives = 69/112 (61.61%), Query Frame = 1
Query: 1813 EPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            E V  +   NFDEIVND    +L+EFYAPWCGHCK LAP+YE+ A++LS  +  I +AK+DAT  +++   + VSG+PT+    K   +    Y+  RE   ++ ++  +A 
Sbjct:  171 EAVLTLTESNFDEIVND-ADIILVEFYAPWCGHCKKLAPEYEKAAQELSKNTPPIPLAKVDATVESELGKRFGVSGYPTLKLFRKGKAY---DYNGPREQYGIVSHMIEQAG 278          

HSP 5 Score: 68.9366 bits (167), Expect = 2.782e-12
Identity = 50/119 (42.02%), Postives = 68/119 (57.14%), Query Frame = 1
Query: 1804 KNDEPVKVVVAKNFDEIVNDPTKD-VLIEFYAPWCGHCKSLAPKYEELAKKLSAESD--IVIAKMDAT-ANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSP 2148
            K +  V ++   NFD  V    KD VL+EFYAPWCGHCK  A +YE++AK+L AE+D  I +AK+DAT A  +   + VSG+PTI    K        Y   R  D ++  +  E +SP
Sbjct:   53 KEENGVLILKDLNFDFFV--AGKDTVLLEFYAPWCGHCKEFASEYEKIAKEL-AENDPPIPVAKVDATVAVHLAERFSVSGYPTIKILKKGQA---VDYDGDRTQDAIIAKV-KEVASP 164          

HSP 6 Score: 53.9138 bits (128), Expect = 1.181e-7
Identity = 24/59 (40.68%), Postives = 33/59 (55.93%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCK L P Y+      K     + IAK+D T      + +   G+PT+
Sbjct:  541 VLIEFYAPWCGHCKSLEPIYKDLGKKYKGHK-GLVIAKMDATVNDIPHDSYKAEGFPTI 598          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: p4hb (prolyl 4-hydroxylase, beta polypeptide [Source:ZFIN;Acc:ZDB-GENE-080610-1])

HSP 1 Score: 121.709 bits (304), Expect = 6.922e-32
Identity = 67/189 (35.45%), Postives = 107/189 (56.61%), Query Frame = 3
Query:   33 APWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG--QFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEEN 593
            APWCGHCK L PE+  AA  LK +   I + KVD T ET+  +++GV GYPT+K FK+G  + A +Y+  R AD I+ ++  ++GPS+  L       KF  SA+ VVVGFF    ++  K FL  A+ +++      + D+  +     K  +++F       KF++ +  Y+G+ S+  +R +V+ N
Sbjct:    1 APWCGHCKALGPEFAKAAGTLKAEGSAIRLGKVDATEETELAKEYGVRGYPTIKFFKDGDAKNAKEYAAGRQADDIVNWLKKRTGPSATTLDDAAATAKFIESAEVVVVGFFKDVEAEDAKVFLKAADGIDDIAFGLASSDDAFTQYEVSKEGVILFK------KFDEGRNVYEGELSKEGLRKFVKSN 183          

HSP 2 Score: 73.1738 bits (178), Expect = 4.176e-15
Identity = 33/80 (41.25%), Postives = 50/80 (62.50%), Query Frame = 1
Query: 1894 APWCGHCKSLAPKYEELAKKLSAE-SDIVIAKMDAT-ANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI 2127
            APWCGHCK+L P++ + A  L AE S I + K+DAT   ++   Y V G+PTI F       + K Y++GR+ DD++ ++
Sbjct:    1 APWCGHCKALGPEFAKAAGTLKAEGSAIRLGKVDATEETELAKEYGVRGYPTIKFFKDGDAKNAKEYAAGRQADDIVNWL 80          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002052.1 (pep scaffold:Pmarinus_7.0:GL480798:2613:20969:-1 gene:ENSPMAG00000001848.1 transcript:ENSPMAT00000002052.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.383 bits (272), Expect = 9.622e-26
Identity = 58/130 (44.62%), Postives = 79/130 (60.77%), Query Frame = 1
Query: 1708 IADFSMENLEKFINDFLQEKVPVYLKSESIPEK-NDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSS 2094
             +DF+  N+  F  D+L E    + KS+ IP+  N  PVKV+V KNFDE V D TK+V +EFYA WC HCK LAP +E+L  +     +IVIAKMDA  N+V + + + G+P I + P       +S SS
Sbjct:  283 FSDFTTANITSFCQDYLDEHNKPFSKSQEIPKDWNKRPVKVLVGKNFDEFVFDETKNVFVEFYASWCDHCKKLAPVWEQLGVQYKDHDNIVIAKMDAEKNEVAAVH-IPGYPKIKYFPAGPGKKVRSSSS 411          

HSP 2 Score: 57.7658 bits (138), Expect = 4.710e-9
Identity = 41/158 (25.95%), Postives = 69/158 (43.67%), Query Frame = 3
Query:   42 CGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFA--FDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFF-TSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSK 506
            C  C +L P+       L+++  P+ +  +D         +  VS YP   +F  G  A    Y  +R A+ + K+   ++GP +  + T      F  S   V++GFF  +ES DL K FL +A+  +E   F  T  E +  K     + ++   K
Sbjct:    1 CEQCSELPPKLARTVELLRERGAPVRLGSLDGETHATLATEFDVSHYPDFLLFDPGSRAKPRHYHAQREAEALAKWATRRAGPPAVTVATTAEAQAFVDSDSLVLLGFFKDTESRDL-KTFLEIADTYDE-VPFGVTSSEEVFAKYGVSTDSIVLFKK 156          

HSP 3 Score: 55.8398 bits (133), Expect = 2.216e-8
Identity = 30/65 (46.15%), Postives = 35/65 (53.85%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG 209
            + VEFYA WC HCKKLAP +E      K  D  I IAK+D  AE        + GYP +K F  G
Sbjct:  340 VFVEFYASWCDHCKKLAPVWEQLGVQYKDHD-NIVIAKMD--AEKNEVAAVHIPGYPKIKYFPAG 401          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: TMX3 (thioredoxin related transmembrane protein 3 [Source:HGNC Symbol;Acc:HGNC:24718])

HSP 1 Score: 103.605 bits (257), Expect = 8.506e-24
Identity = 60/194 (30.93%), Postives = 95/194 (48.97%), Query Frame = 3
Query:    9 SVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEE 590
             V LV+FYAPWCGHCKKL P +   A  +K    P+ + K+D TA +    ++GV GYPT+K+ K G  +++Y G R+ D II +    +GP+ + L T   F    +  D  +   +    S L ++F  VA ++  +  F  T +E L   ++        H    A  F+D       ++ +  + TWV  
Sbjct:   15 GVWLVDFYAPWCGHCKKLEPVWNEVAQEMKASGSPVRVGKLDATAHSGIATEYGVRGYPTIKLIK-GDLSYNYKGPRTKDEIIAFANRVAGPAMRHLSTPALFAHTQSRHD--IFFLYVGGDSKLKESFTQVALEMVVNAYFFSTPEEVLPANVH-------IHEAPAALVFKDGTYYEYDESDDGDLATWVRR 198          

HSP 2 Score: 65.0846 bits (157), Expect = 2.552e-11
Identity = 28/58 (48.28%), Postives = 42/58 (72.41%), Query Frame = 1
Query: 1879 LIEFYAPWCGHCKSLAPKYEELAKKLSAE-SDIVIAKMDATAN-DVPSPYEVSGFPTI 2046
            L++FYAPWCGHCK L P + E+A+++ A  S + + K+DATA+  + + Y V G+PTI
Sbjct:   18 LVDFYAPWCGHCKKLEPVWNEVAQEMKASGSPVRVGKLDATAHSGIATEYGVRGYPTI 75          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: PDI1 (Protein disulfide isomerase; multifunctional oxidoreductase of the ER lumen, essential for disulfide bond formation in secretory and cell-surface proteins, processing of non-native disulfide bonds; Ero1p activator; complexes with exomannosidase, Mnl1p to facilitate the recognition of misfolded glycoproteins and the trimming of glycan Man8GlcNAc2 to Man7GlcNAc2 on substrates, thereby accelerating ERAD; PDI1 has a paralog, EUG1, that arose from the whole genome duplication [Source:SGD;Acc:S000000548])

HSP 1 Score: 122.865 bits (307), Expect = 6.278e-30
Identity = 75/198 (37.88%), Postives = 106/198 (53.54%), Query Frame = 1
Query: 1585 HFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLS-AESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGR 2175
             F +  + +M ++L +YG+  P  S+    A DE + K  +      + +E  + DFL+      +KS+ I E  D  V  +V KN DEIVNDP KDVL+ +YAPWCGHCK LAP Y+ELA   + A SD++IAK+D T NDV     + G+PTI   P   K     Y   R +D +  +I         +FD  G+
Sbjct:  310 QFPLFAIHDMTEDL-KYGL--PQLSE---EAFDELSDKIVL----ESKAIESLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVV-IEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENG-----HFDVDGK 491          

HSP 2 Score: 105.145 bits (261), Expect = 3.970e-24
Identity = 52/145 (35.86%), Postives = 83/145 (57.24%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQF--AFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRF 434
            H ++L EF+APWCGHCK +APEY  AA  L +++  I +A++DCT     C +H + G+P+LK+FKN     + DY G R+A+ I+++M+ +S P+   +     +        PV+V     + +D    F S+A K   D+ F
Sbjct:   49 HDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKN--ITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLPAYLANETFVTPVIVQSGKID-ADFNATFYSMANKHFNDYDF 190          

HSP 3 Score: 64.6994 bits (156), Expect = 2.651e-11
Identity = 35/123 (28.46%), Postives = 71/123 (57.72%), Query Frame = 1
Query: 1774 VYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEA 2139
            V+ + E++  ++   VK+    +F+E +      VL EF+APWCGHCK++AP+Y + A+ L  E +I +A++D T N D+   + + GFP++     +  ++   Y   R  + +++++  ++
Sbjct:   20 VFAQQEAVAPEDSAVVKLAT-DSFNEYIQSHDL-VLAEFFAPWCGHCKNMAPEYVKAAETL-VEKNITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQS 139          

HSP 4 Score: 62.7734 bits (151), Expect = 1.070e-10
Identity = 31/86 (36.05%), Postives = 46/86 (53.49%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQ--FAFDYSGERSADGIIKYM 266
            +LV +YAPWCGHCK+LAP Y+  A         + IAK+D T          + GYPT+ ++  G+   +  Y G RS D +  ++
Sbjct:  397 VLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHT--ENDVRGVVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFI 480          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: EUG1 (Protein disulfide isomerase of the endoplasmic reticulum lumen; EUG1 has a paralog, PDI1, that arose from the whole genome duplication; function overlaps with that of Pdi1p; may interact with nascent polypeptides in the ER [Source:SGD;Acc:S000002926])

HSP 1 Score: 95.9005 bits (237), Expect = 3.685e-21
Identity = 54/152 (35.53%), Postives = 83/152 (54.61%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFD---YSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASAD-PVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFD 449
            H ++LVEF+APWC H + L P  E AA+ LK+ + P  + ++DC A +  C +  ++ YPTLK+FKNG+  FD   Y G +  D I +YM+     S   L +E+    +  +A  PVV+    +  ++ Y+    VA  L ED+ F    D
Sbjct:   50 HPLVLVEFFAPWCLHSQILRPHLEEAASILKEHNVP--VVQIDCEANSMVCLQQTINTYPTLKIFKNGRI-FDGQVYRGVKITDEITQYMIQLYEASVIYLNSEDEIQPYLENATLPVVINRGLTGLNETYQ---EVALDLAEDYVFLSLLD 195          

HSP 2 Score: 74.7146 bits (182), Expect = 1.984e-14
Identity = 48/139 (34.53%), Postives = 82/139 (58.99%), Query Frame = 1
Query: 1738 KFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESD----IVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            + + D+ +      +KSE IP++    V  +V K  D+IV+D  KDVL+++YA WC H K  AP YEE+A  L+++      I+IA++D+ AND+ S + V+G+PTI   P  +   P  ++  R ++D+ ++I    +
Sbjct:  350 QLVKDYREGTAKPIVKSEEIPKEQKSNVYKIVGKTHDDIVHDDDKDVLVKYYATWCIHSKRFAPIYEEIANVLASDESVRDKILIAEVDSGANDILS-FPVTGYPTIALYPAGNNSKPIIFNKIRNLEDVFEFIKESGT 487          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: MPD1 (Member of the protein disulfide isomerase (PDI) family; interacts with and inhibits the chaperone activity of Cne1p; MPD1 overexpression in a pdi1 null mutant suppresses defects in Pdi1p functions such as carboxypeptidase Y maturation [Source:SGD;Acc:S000005814])

HSP 1 Score: 68.5514 bits (166), Expect = 6.155e-13
Identity = 40/136 (29.41%), Postives = 66/136 (48.53%), Query Frame = 1
Query: 1807 NDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAND-VPSPYEVSGFPTIY-FAPKN--------------SKHSPKSYSSGREVDDMLKYIASEASSPLKNFDR 2166
            +D  +  +  K+FD+ +++     L+EFYAPWCGHCK L+  + + AK+L     +     D   N  + + Y+V+GFPT+  F P                S H+ + YS  R +  ++ +  S   S +K F R
Sbjct:   27 SDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSFSAHANEVYSGARTLAPIVDFSLSRIRSYVKKFVR 162          

HSP 2 Score: 68.1662 bits (165), Expect = 8.015e-13
Identity = 39/105 (37.14%), Postives = 56/105 (53.33%), Query Frame = 3
Query:   18 LVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDC--TAETKTCEKHGVSGYPTLKVFK-----------NGQFAFD------YSGERSADGIIKYMVSK 275
            LVEFYAPWCGHCKKL+  +  AA   K+ D  + +A V+C        C K+ V+G+PTL VF+           N + +F       YSG R+   I+ + +S+
Sbjct:   51 LVEFYAPWCGHCKKLSSTFRKAA---KRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSFSAHANEVYSGARTLAPIVDFSLSR 152          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: TRX1 (Cytoplasmic thioredoxin isoenzyme; part of thioredoxin system which protects cells against oxidative and reductive stress; forms LMA1 complex with Pbi2p; acts as a cofactor for Tsa1p; required for ER-Golgi transport and vacuole inheritance; with Trx2p, facilitates mitochondrial import of small Tims Tim9p, Tim10p, Tim13p by maintaining them in reduced form; abundance increases iunder DNA replication stress; TRX1 has a paralog, TRX2, that arose from the whole genome duplication [Source:SGD;Acc:S000004033])

HSP 1 Score: 52.373 bits (124), Expect = 6.887e-9
Identity = 26/70 (37.14%), Postives = 38/70 (54.29%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQ 212
            +  +++V+FYA WCG CK +AP  E       +Q P     K+D        +K+ VS  PTL +FKNG+
Sbjct:   17 QDKLVVVDFYATWCGPCKMIAPMIE----KFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGK 82          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: TRX2 (Cytoplasmic thioredoxin isoenzyme; part of thioredoxin system which protects cells against oxidative and reductive stress; forms LMA1 complex with Pbi2p; acts as a cofactor for Tsa1p; required for ER-Golgi transport and vacuole inheritance; with Trx1p, facilitates mitochondrial import of small Tims Tim9p, Tim10p, Tim13p by maintaining them in reduced form; abundance increases under DNA replication stress; TRX2 has a paralog, TRX1, that arose from the whole genome duplication [Source:SGD;Acc:S000003441])

HSP 1 Score: 51.2174 bits (121), Expect = 1.662e-8
Identity = 31/92 (33.70%), Postives = 45/92 (48.91%), Query Frame = 1
Query: 1834 AKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDA-TANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREV 2106
            A  +D  +    K V+++F+A WCG CK +AP  E+ A++    SD    K+D    +DV    EVS  PT+ F           Y  G+EV
Sbjct:    8 ASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQY---SDAAFYKLDVDEVSDVAQKAEVSSMPTLIF-----------YKGGKEV 85          

HSP 2 Score: 44.2838 bits (103), Expect = 4.517e-6
Identity = 23/67 (34.33%), Postives = 35/67 (52.24%), Query Frame = 3
Query:   12 VILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQ 212
            +++V+F+A WCG CK +AP  E       +Q    A  K+D    +   +K  VS  PTL  +K G+
Sbjct:   21 LVVVDFFATWCGPCKMIAPMIE----KFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGK 83          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO31634 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXD7])

HSP 1 Score: 246.514 bits (628), Expect = 2.654e-73
Identity = 124/245 (50.61%), Postives = 166/245 (67.76%), Query Frame = 1
Query: 1417 GLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
            G  G RT  N + F K PL V  ++VD++KN KG+ YWRNR+LKV K F D  K+++FAI++  +  + LS+ G+   D +       ++   KF M   FS+++ ++F+ D+    +  ++KSE +PE ND PVKVVV +NF EIVNDPTKDVLIEFYAPWCGHCKSL PKY EL +KL    DIVIAKMDATAND P  + V GFPTIY+AP N+K +P+ Y  GREV D + +I  +A+ P+
Sbjct:  234 GRVGQRTPDNEEQFPK-PLCVVFFDVDWKKNAKGSKYWRNRVLKVTKFFDD--KAMNFAIASFSDYERVLSDIGVT--DKANPSAVVYNDAGDKFLMKEKFSVDSFKQFLEDYFAGSLKPHIKSEPLPESNDGPVKVVVGENFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNELGEKLQDVKDIVIAKMDATANDAPPNFSVQGFPTIYWAPANNKENPEKYEGGREVSDFVDFIKRKATKPV 473          

HSP 2 Score: 192.971 bits (489), Expect = 9.455e-54
Identity = 94/193 (48.70%), Postives = 128/193 (66.32%), Query Frame = 3
Query:   12 VILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETK-TCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADP-VVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWV 584
            ++LVEF+APWCGHCK+LAPEYE AA ALKK DPP+ +AKVDCT   K TC K+GVSGYPTLK+F+NG+ + DY G R + GII+YM  ++GPSS E+K+ ++  K    A+  VVVGF   +  DL  AF+  A ++ + F FAH     +  K NYKN IV+F  K +  K E + + Y G   +  I+ ++
Sbjct:   37 IMLVEFFAPWCGHCKRLAPEYETAAEALKKNDPPVPLAKVDCTEAGKDTCSKYGVSGYPTLKIFRNGEMSKDYDGPRDSSGIIRYMKKQAGPSSVEIKSVDHLEKKLDDAESNVVVGFLDGD-DDLKNAFMRTANEMRDSFSFAHASVTDVLEKYNYKNQIVVFRPKHLHTKLEPSFIAYTGSPDDFYIKKFI 228          

HSP 3 Score: 69.3218 bits (168), Expect = 2.341e-12
Identity = 37/92 (40.22%), Postives = 56/92 (60.87%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSA-ESDIVIAKMDAT--ANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            +L+EF+APWCGHCK LAP+YE  A+ L   +  + +AK+D T    D  S Y VSG+PT+    +N + S K Y   R+   +++Y+  +A 
Sbjct:   38 MLVEFFAPWCGHCKRLAPEYETAAEALKKNDPPVPLAKVDCTEAGKDTCSKYGVSGYPTLKIF-RNGEMS-KDYDGPRDSSGIIRYMKKQAG 127          

HSP 4 Score: 55.8398 bits (133), Expect = 3.736e-8
Identity = 28/60 (46.67%), Postives = 36/60 (60.00%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEY-EIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCK L P+Y E+       +D  I IAK+D TA         V G+PT+
Sbjct:  382 VLIEFYAPWCGHCKSLEPKYNELGEKLQDVKD--IVIAKMDATA-NDAPPNFSVQGFPTI 438          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO32930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM8])

HSP 1 Score: 214.542 bits (545), Expect = 4.265e-60
Identity = 112/262 (42.75%), Postives = 165/262 (62.98%), Query Frame = 1
Query: 1378 ISNYEIDNCILSMGLAGHRTHSNVKYFAKRPLIVALYNVDYE-KNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIAD---FSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
            +  +  D  +  +GL  + ++   K +A RPL +  Y VD+   N   T +WR+++++VAK   D    I FAI+N +E  QEL ++G+ +    +V +   D+  +KF+M  D   FS ++L +F+ +F    +   +KS+ +P+ N EPV VVV K FDEIVNDP KDVLIEFYAPWCGHCK+L P +++L K    + +IVIAK+DATANDVPS Y V GFPTIYFA    K +P  +  GRE+ D++K++  +A+  L
Sbjct:  383 LQGFYKDKRVPLVGL--YTSYDKDKKYAARPLCIVYYGVDFGFDNRVATQFWRSKVIEVAKDHRD----ITFAIANEEESEQELKDFGL-AESGEEVNVGCFDKEGRKFRMDPDEEEFSEDSLREFVEEFKAGNLKPIIKSQPVPKSNKEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRNDKNIVIAKIDATANDVPSTYAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVEEKATVSL 637          

HSP 2 Score: 159.844 bits (403), Expect = 3.690e-41
Identity = 80/184 (43.48%), Postives = 115/184 (62.50%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPV-VVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNY-KNNIVIFHSKKMANKFEDTQVKYKG 551
             S++LVEF+APWCGHCK+LAPEYE AA  L+K DPPI +A VD T E++  +K+ V GYPTLKVF+ G+ A +Y G+R   GI  YM S+ GPSS+ L + +    F    D V ++GFF  E   + +++L     + +D+ FAHTFD          K++IV+F  ++  +K+E     Y+G
Sbjct:  193 ESLMLVEFFAPWCGHCKQLAPEYEKAAQELQKNDPPIPLAIVDATIESELAQKYEVQGYPTLKVFRKGK-ATEYKGQRDQYGIASYMRSQVGPSSRILSSLKAVQDFMKEKDDVTIMGFFDGEDDKMLESYLEANNDVRDDYPFAHTFDAAAKKHFGIKKSSIVLFQPERFLSKYEPKHFVYEG 375          

HSP 3 Score: 119.783 bits (299), Expect = 4.851e-28
Identity = 72/209 (34.45%), Postives = 112/209 (53.59%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELK------TEENFNKFTASADPVVVGFFT---SESSDLYKAFLSVAEKL--NEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            E+++ILVEFYAPWCGHCK LAPEY  AA  +K  DPP+  AK+D T  +   ++  VSGYPTLK+F+ G   ++Y G R   GI++YM  +S P+ K         T+ENF +       ++V FF         L   +   A++L  N+        D T+ ++L  K  +  + + K+  K + T+  YKG   ++ I +++   +
Sbjct:   77 ENNIILVEFYAPWCGHCKSLAPEYAKAAKKMKLNDPPVPFAKMDATVASDIAQRFDVSGYPTLKIFRKGT-PYEYEGPREESGIVEYMKKQSDPNWKPPPVAALTLTKENFTEVVNRESLMLVEFFAPWCGHCKQLAPEYEKAAQELQKNDPPIPLAIVDATIESELAQKYEVQGYPTLKVFRKGKATE--YKGQRDQYGIASYMRSQV 282          

HSP 4 Score: 86.2705 bits (212), Expect = 1.753e-17
Identity = 48/120 (40.00%), Postives = 77/120 (64.17%), Query Frame = 1
Query: 1786 SESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSA-ESDIVIAKMDAT-ANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEA 2139
            S+ + E++D  V V+ +KNFD ++ +    +L+EFYAPWCGHCKSLAP+Y + AKK+   +  +  AKMDAT A+D+   ++VSG+PT+       K +P  Y   RE   +++Y+  ++
Sbjct:   54 SDEVKEEDD--VLVLNSKNFDRVIEE-NNIILVEFYAPWCGHCKSLAPEYAKAAKKMKLNDPPVPFAKMDATVASDIAQRFDVSGYPTLKIF---RKGTPYEYEGPREESGIVEYMKKQS 167          

HSP 5 Score: 73.1738 bits (178), Expect = 2.095e-13
Identity = 40/94 (42.55%), Postives = 61/94 (64.89%), Query Frame = 1
Query: 1777 YLKSESIPEKNDEPVK--VVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSA-ESDIVIAKMDAT-ANDVPSPYEVSGFPTI 2046
            Y+K +S P     PV    +  +NF E+VN  +  +L+EF+APWCGHCK LAP+YE+ A++L   +  I +A +DAT  +++   YEV G+PT+
Sbjct:  162 YMKKQSDPNWKPPPVAALTLTKENFTEVVNRESL-MLVEFFAPWCGHCKQLAPEYEKAAQELQKNDPPIPLAIVDATIESELAQKYEVQGYPTL 254          

HSP 6 Score: 60.4622 bits (145), Expect = 1.669e-9
Identity = 37/102 (36.27%), Postives = 54/102 (52.94%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL--KVFKNGQFAFDYSGERSADGIIKYMVSKSGPS-SKELKTEE 311
            +L+EFYAPWCGHCK L P ++       + D  I IAK+D TA       + V G+PT+     K+ +    + G R    +IK++  K+  S SKE   +E
Sbjct:  546 VLIEFYAPWCGHCKALEPTFKKLGKHF-RNDKNIVIAKIDATA-NDVPSTYAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVEEKATVSLSKEKAKDE 645          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO33843 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR22])

HSP 1 Score: 159.844 bits (403), Expect = 1.028e-45
Identity = 72/124 (58.06%), Postives = 92/124 (74.19%), Query Frame = 1
Query: 1780 LKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
            +KS+ +P+ N EPV VVV K FDEIVNDP KDVLIEFYAPWCGHCK+L P +++L K    + +IVIAK+DATANDVPS Y V GFPTIYFA    K +P  +  GRE+ D++K++  +A+  L
Sbjct:   16 VKSQPVPKSNKEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRNDKNIVIAKIDATANDVPSTYAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVEEKATVSL 139          

HSP 2 Score: 60.4622 bits (145), Expect = 8.443e-11
Identity = 37/102 (36.27%), Postives = 54/102 (52.94%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL--KVFKNGQFAFDYSGERSADGIIKYMVSKSGPS-SKELKTEE 311
            +L+EFYAPWCGHCK L P ++       + D  I IAK+D TA       + V G+PT+     K+ +    + G R    +IK++  K+  S SKE   +E
Sbjct:   48 VLIEFYAPWCGHCKALEPTFKKLGKHF-RNDKNIVIAKIDATA-NDVPSTYAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVEEKATVSLSKEKAKDE 147          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO36830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHH5])

HSP 1 Score: 142.895 bits (359), Expect = 2.623e-36
Identity = 82/195 (42.05%), Postives = 121/195 (62.05%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNN-IVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            +LVEFYAPWCGHCK LAPEY  AA  LK +   I +AKVD TAETK  EK  V GYPT+K FK+G+ + +Y+G R+A  I+ ++  K+GP +K+L T +    F  + +  VVGFFT + SD  KAFLS A+ ++ D  F    D+ ++++   + + IV+F       KF++ +  Y G+    +I+ +V+ N 
Sbjct:   44 VLVEFYAPWCGHCKALAPEYAKAAGQLKSEKSEIKLAKVDATAETKLGEKFQVQGYPTIKFFKDGKPS-EYAGGRTAPEIVSWLNKKTGPPAKDLATADAMKDFI-TKEVAVVGFFTDKESDAAKAFLSAADGID-DVEFGIVSDKAIASEHKVEGDKIVLF------KKFDEGRNDYDGEYDFEKIQQFVKANQ 229          

HSP 2 Score: 139.043 bits (349), Expect = 5.702e-35
Identity = 78/191 (40.84%), Postives = 119/191 (62.30%), Query Frame = 1
Query: 1573 GKSIHFAISNVQEMNQELSEY-GIESPDFSKV-YITARDERNQKFK-MIADFSMENLEKFINDFLQEKVPVYLKSESIPEKND-EPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIAS 2133
            GK +   ++   E NQ + E+ GI+S +   +  I   D+   K+K   A+ + EN+++F+  FL +K+  +L S  IPE  D +PVKV+  KNFDE+  +  K+V +EFYAPWCGHCK LAP +++L +K    +DIV+AKMD+TAN+V    +V  FPTI + PK  +     Y+ GR +DD +K++ S
Sbjct:  280 GKVLFVYVNTEVEDNQRIVEFFGIQSSELPTIRLINLADDDMTKYKPTAAEITSENVKEFVQAFLDKKLKPHLLSAEIPEDWDSKPVKVLCGKNFDEVARNKDKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHADIVVAKMDSTANEVEG-VKVHSFPTIKYFPKEGEAV--DYNGGRTLDDFVKFLES 467          

HSP 3 Score: 95.5153 bits (236), Expect = 1.030e-20
Identity = 56/127 (44.09%), Postives = 80/127 (62.99%), Query Frame = 1
Query: 1786 SESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAE-SDIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNF 2160
            SE I E+ D  V V+  KNFDE V    K VL+EFYAPWCGHCK+LAP+Y + A +L +E S+I +AK+DATA   +   ++V G+PTI F  K+ K  P  Y+ GR   +++ ++  +   P K+ 
Sbjct:   17 SEEIKEEED--VLVLTEKNFDEAVA-ANKHVLVEFYAPWCGHCKALAPEYAKAAGQLKSEKSEIKLAKVDATAETKLGEKFQVQGYPTIKFF-KDGK--PSEYAGGRTAPEIVSWLNKKTGPPAKDL 137          

HSP 4 Score: 69.3218 bits (168), Expect = 2.343e-12
Identity = 36/86 (41.86%), Postives = 49/86 (56.98%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVS 272
            + VEFYAPWCGHCK+LAP ++      K     I +AK+D TA     E   V  +PT+K F     A DY+G R+ D  +K++ S
Sbjct:  385 VFVEFYAPWCGHCKQLAPIWDQLGEKYKDH-ADIVVAKMDSTA--NEVEGVKVHSFPTIKYFPKEGEAVDYNGGRTLDDFVKFLES 467          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO47340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMG9])

HSP 1 Score: 110.923 bits (276), Expect = 2.771e-26
Identity = 50/97 (51.55%), Postives = 71/97 (73.20%), Query Frame = 1
Query: 1840 NFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI 2127
            NFDE+VN   K  L+EFYAPWCGHCK LAP YE+L +  +  SD++IAK+DA  + D+ S ++V GFPTI + PK S  +P+ Y+ GR+++D +K+I
Sbjct:   31 NFDEVVNGE-KFALVEFYAPWCGHCKQLAPTYEQLGEAYTQSSDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGST-TPEEYNGGRDINDFIKFI 125          

HSP 2 Score: 98.5969 bits (244), Expect = 3.172e-22
Identity = 55/138 (39.86%), Postives = 82/138 (59.42%), Query Frame = 1
Query: 1744 INDFL---QEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAND-VPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASS 2145
            INDF+   +EK  V  +   IP      V  +   NFD+IV +P  +VL+EF+APWCGHCK+LAP YE++ +    E + VIAK+DA A+  +   Y VSG+PT+ F  K +K   + YSSGR+    + ++  +  +
Sbjct:  118 INDFIKFIEEKTGVRGRVPVIPS----AVADLDESNFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVYEKVGEAFKNEPNCVIAKVDADAHSALGQKYGVSGYPTLKFFSKTNKDG-EEYSSGRDEQSFVDFMNEKCGT 250          

HSP 3 Score: 87.0409 bits (214), Expect = 2.496e-18
Identity = 44/90 (48.89%), Postives = 54/90 (60.00%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVF-KNGQFAFDYSGERSADGIIKYMVSKSG 281
            +LVEF+APWCGHCK LAP YE    A K + P   IAKVD  A +   +K+GVSGYPTLK F K  +   +YS  R     + +M  K G
Sbjct:  161 VLVEFFAPWCGHCKNLAPVYEKVGEAFKNE-PNCVIAKVDADAHSALGQKYGVSGYPTLKFFSKTNKDGEEYSSGRDEQSFVDFMNEKCG 249          

HSP 4 Score: 83.5741 bits (205), Expect = 3.087e-17
Identity = 54/147 (36.73%), Postives = 73/147 (49.66%), Query Frame = 3
Query:   18 LVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFA-FDYSGERSADGIIKYMVSKSG--------PSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFR 431
            LVEFYAPWCGHCK+LAP YE    A   Q   + IAKVD   +     +  V G+PT+K F  G     +Y+G R  +  IK++  K+G        PS+     E NF+K   + D  V+  F +      K    V EK+ E F+
Sbjct:   43 LVEFYAPWCGHCKQLAPTYEQLGEAY-TQSSDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDINDFIKFIEEKTGVRGRVPVIPSAVADLDESNFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVYEKVGEAFK 188          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia3 (protein disulfide isomerase family A member 3 [Source:NCBI gene;Acc:101164975])

HSP 1 Score: 292.738 bits (748), Expect = 3.185e-90
Identity = 138/248 (55.65%), Postives = 176/248 (70.97%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMEN--LEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
             G+  H T  N      + L+VA Y VDY+KNPKG+NYWRNR++KVAK F+D GK ++FA++N    + E+SE+G+ S       +  R  +  K+ M  +FS +   LE+F+ D+   K+  YLKSE IPE ND PVKV+VA+NFD IVND +KDVLIEFYAPWCGHCK+L PKY EL +KL+ + ++VIAKMDATANDVPSPYEVSGFPTIYF+P   K SPK Y  GREV D + Y+  EAS+PL
Sbjct:  229 FGICPHMTDDNKDQLKGKDLLVAYYEVDYDKNPKGSNYWRNRVMKVAKSFLDQGKKLNFAVANKNTFSHEVSEFGLSSSSGELPVVAIRTSKGDKYVMTEEFSRDGKALERFLQDYFDGKLKRYLKSEPIPEDNDGPVKVLVAENFDSIVNDDSKDVLIEFYAPWCGHCKNLEPKYNELGEKLANDPNVVIAKMDATANDVPSPYEVSGFPTIYFSPAGRKTSPKKYEGGREVSDFISYLKREASNPL 476          

HSP 2 Score: 189.119 bits (479), Expect = 7.828e-52
Identity = 94/200 (47.00%), Postives = 135/200 (67.50%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETL--STKLNYKNNIVIFHSKKMANKFEDTQVKYKGDA-SEHQIRTWVEENM 596
            H + LVEF+APWCGHCK+LAPEYE AAT LK   P   + KVDCTA +  C K+GVSGYPTLK+F++G+ +  Y G RSADGI+ ++  ++GP+S ELKT+ +F KF    D  VVGFF  +S+   + FL  A  L +D+RFAHT  E L  S  ++ +  +V+F   ++ NKFE+  VK+  D  + ++I+ +++EN+
Sbjct:   34 HDLALVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LVKVDCTANSNICSKYGVSGYPTLKIFRDGEESGPYDGPRSADGIVSFLKKQAGPASVELKTDADFEKFIGDQDASVVGFFADQSTSQAE-FLKAASALRDDYRFAHTNSEALLKSNGID-EEGVVLFRPPRLNNKFEENSVKFTEDKFTSNKIKKFIQENI 228          

HSP 3 Score: 71.633 bits (174), Expect = 1.190e-12
Identity = 35/90 (38.89%), Postives = 53/90 (58.89%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
             L+EF+APWCGHCK LAP+YE  A +L  +  + + K+D TAN ++ S Y VSG+PT+       +  P  Y   R  D ++ ++  +A 
Sbjct:   37 ALVEFFAPWCGHCKRLAPEYEAAATRL--KGIVPLVKVDCTANSNICSKYGVSGYPTLKIFRDGEESGP--YDGPRSADGIVSFLKKQAG 122          

HSP 4 Score: 65.0846 bits (157), Expect = 1.391e-10
Identity = 35/86 (40.70%), Postives = 45/86 (52.33%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAF--DYSGERSADGIIKYM 266
            +L+EFYAPWCGHCK L P+Y      L   DP + IAK+D TA       + VSG+PT+     G+      Y G R     I Y+
Sbjct:  385 VLIEFYAPWCGHCKNLEPKYNELGEKL-ANDPNVVIAKMDATA-NDVPSPYEVSGFPTIYFSPAGRKTSPKKYEGGREVSDFISYL 468          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia8 (protein disulfide-isomerase A3 [Source:NCBI gene;Acc:101165241])

HSP 1 Score: 217.238 bits (552), Expect = 1.566e-62
Identity = 110/249 (44.18%), Postives = 162/249 (65.06%), Query Frame = 1
Query: 1417 GLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSE-YGIESPDFSKV-YITARDERNQKFKMIADFSM--ENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
            GL  H T  N      R L+ A Y++DY+ N +G+NYWRNR++KVA K+  +G+S+ F+++N ++   EL E Y + + D   + ++T R +  QK+ M  +F+   ++LE+F+ D+   ++  Y+KSE IPEKN   VKVVVA++F+EIVNDP KDVLI+FY+P C HCK L P Y ELA+ L ++   VIAKM+A  ND+P  Y+V G+PTIY AP   K +P  Y   RE+ + L ++  E+S  L
Sbjct:  194 GLCPHMTLENRDRLRVRDLLTAYYDLDYQHNVRGSNYWRNRVMKVASKY--AGRSLMFSVANKKDFLMELEEDYDLGTSDAGDMPFVTIRTKLGQKYVMREEFTRDGQSLERFLEDYFAGRLKQYIKSEPIPEKNSAAVKVVVAESFNEIVNDPDKDVLIQFYSPSCPHCKKLEPIYRELAETLYSDPHTVIAKMNAVDNDIPLGYDVQGYPTIYLAPAGRKDNPIRYQGPRELKEFLNFLKRESSHKL 440          

HSP 2 Score: 162.925 bits (411), Expect = 5.004e-43
Identity = 80/195 (41.03%), Postives = 121/195 (62.05%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNN-IVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            +LV+FYAPWCGHCKKLAPE+E AA  LK     + +AKVDCTA ++TC + GV+GYPTLK+F+ G+ +  Y G R+ADGI + M  ++GP S  LK++E+   F  + D  +VG F S        FL  A  L + FRFAH  D  ++   N  +  +++F   ++A+ FED+ V +K   +   +R ++ +++
Sbjct:    1 MLVKFYAPWCGHCKKLAPEFEKAAKKLKGI---VKLAKVDCTANSETCGRFGVTGYPTLKIFRYGKDSASYDGPRTADGIYEVMRRQTGPDSVHLKSKEDLQAFVNNYDASIVGVFPSSEGSRLPEFLKAAGLLRDQFRFAHITDLQVADDHNVDSECVLLFRPPRLASAFEDSVVVFKDYLTISSLRRFLRDHL 192          

HSP 3 Score: 66.6254 bits (161), Expect = 4.813e-11
Identity = 29/58 (50.00%), Postives = 44/58 (75.86%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTI 2046
            +L++FYAPWCGHCK LAP++E+ AKKL  +  + +AK+D TAN +    + V+G+PT+
Sbjct:    1 MLVKFYAPWCGHCKKLAPEFEKAAKKL--KGIVKLAKVDCTANSETCGRFGVTGYPTL 56          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia8 (protein disulfide-isomerase A3 [Source:NCBI gene;Acc:101165241])

HSP 1 Score: 217.238 bits (552), Expect = 4.249e-62
Identity = 110/249 (44.18%), Postives = 162/249 (65.06%), Query Frame = 1
Query: 1417 GLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSE-YGIESPDFSKV-YITARDERNQKFKMIADFSM--ENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPL 2151
            GL  H T  N      R L+ A Y++DY+ N +G+NYWRNR++KVA K+  +G+S+ F+++N ++   EL E Y + + D   + ++T R +  QK+ M  +F+   ++LE+F+ D+   ++  Y+KSE IPEKN   VKVVVA++F+EIVNDP KDVLI+FY+P C HCK L P Y ELA+ L ++   VIAKM+A  ND+P  Y+V G+PTIY AP   K +P  Y   RE+ + L ++  E+S  L
Sbjct:  239 GLCPHMTLENRDRLRVRDLLTAYYDLDYQHNVRGSNYWRNRVMKVASKY--AGRSLMFSVANKKDFLMELEEDYDLGTSDAGDMPFVTIRTKLGQKYVMREEFTRDGQSLERFLEDYFAGRLKQYIKSEPIPEKNSAAVKVVVAESFNEIVNDPDKDVLIQFYSPSCPHCKKLEPIYRELAETLYSDPHTVIAKMNAVDNDIPLGYDVQGYPTIYLAPAGRKDNPIRYQGPRELKEFLNFLKRESSHKL 485          

HSP 2 Score: 167.548 bits (423), Expect = 2.528e-44
Identity = 82/199 (41.21%), Postives = 123/199 (61.81%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNN-IVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            EH  +LV+FYAPWCGHCKKLAPE+E AA  LK     + +AKVDCTA ++TC + GV+GYPTLK+F+ G+ +  Y G R+ADGI + M  ++GP S  LK++E+   F  + D  +VG F S        FL  A  L + FRFAH  D  ++   N  +  +++F   ++A+ FED+ V +K   +   +R ++ +++
Sbjct:   42 EHETMLVKFYAPWCGHCKKLAPEFEKAAKKLKGI---VKLAKVDCTANSETCGRFGVTGYPTLKIFRYGKDSASYDGPRTADGIYEVMRRQTGPDSVHLKSKEDLQAFVNNYDASIVGVFPSSEGSRLPEFLKAAGLLRDQFRFAHITDLQVADDHNVDSECVLLFRPPRLASAFEDSVVVFKDYLTISSLRRFLRDHL 237          

HSP 3 Score: 66.2402 bits (160), Expect = 6.315e-11
Identity = 29/58 (50.00%), Postives = 44/58 (75.86%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATAN-DVPSPYEVSGFPTI 2046
            +L++FYAPWCGHCK LAP++E+ AKKL  +  + +AK+D TAN +    + V+G+PT+
Sbjct:   46 MLVKFYAPWCGHCKKLAPEFEKAAKKL--KGIVKLAKVDCTANSETCGRFGVTGYPTL 101          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia4 (protein disulfide isomerase family A member 4 [Source:NCBI gene;Acc:101168751])

HSP 1 Score: 194.512 bits (493), Expect = 1.178e-52
Identity = 112/249 (44.98%), Postives = 150/249 (60.24%), Query Frame = 1
Query: 1411 SMGLAGHRTHSN-VKYFAKRPLIVALYNVDYEKN-PKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIAD-FSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSP-YEVSGFPTIYFAPKNSKHSPKSYSSG-REVDDMLKYIASEAS 2142
            S+ L GHR  SN  K ++KRP++V  Y VD+  +  K T +WR+++L+VAK F +      FAI++ ++   EL   G+ S    +V      E  +KF M  D F  E L  F+  F + K+   +KS+ +P+ N  PVKVVV K FDEIV D  KDVLIEFYAPWCGHCK L P Y  L KK   E ++VIAKMDATAND+P+  Y+  GFPTIY AP N K SP  +  G R V+ +  ++   A+
Sbjct:  389 SIPLVGHRKPSNDAKRYSKRPMVVVYYGVDFSFDYKKATQFWRSKVLEVAKDFPE----YTFAIADEEDYADELKSLGL-SDSGEEVNAGIMAEGGKKFAMEPDDFDSEVLRDFVMAFKKGKLKPIIKSQPVPKSNTGPVKVVVGKTFDEIVMDTQKDVLIEFYAPWCGHCKKLEPDYLSLGKKYKKEKNLVIAKMDATANDIPNDNYKAEGFPTIYLAPANGKQSPVKFEGGDRTVEALSNFLEKHAT 632          

HSP 2 Score: 158.688 bits (400), Expect = 2.487e-40
Identity = 76/174 (43.68%), Postives = 112/174 (64.37%), Query Frame = 3
Query:   12 VILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASA-DPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYK-NNIVIFHSKKMANKFE 527
            +ILVEFYAPWCGHCK+LAPEYE AA  L K+ PPI +AKVD T ET+  +++GV+G+PTLK+F+ G+ AF+Y+G R   GI+++M  ++GP SK+++  +   +      D V+VG F++E    Y+ +      L EDF F H+F   ++  L      IVI   +K  +K+E
Sbjct:  192 IILVEFYAPWCGHCKRLAPEYEKAAKELSKRTPPIPLAKVDATVETELAKRYGVNGFPTLKIFRKGR-AFEYNGPRENYGIVEHMGEQAGPPSKQVQAVKQVQELIKDGDDAVIVGIFSNEQDSAYELYTEACNTLREDFSFRHSFSSDVAKLLKASPGQIVIVQPEKFRSKYE 364          

HSP 3 Score: 115.546 bits (288), Expect = 2.848e-26
Identity = 56/122 (45.90%), Postives = 76/122 (62.30%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVS------KSGPSSKELKTEENFNKFTASADPVVVGFF 362
            +LVEFYAPWCGHCK+ APEYE  A  LK  DPPI +AKVD T  ++   K  VSGYPT+K+ KNG+   DY G R+   I++ +        K  P +  + T+ENF+    +AD ++V F+
Sbjct:   78 VLVEFYAPWCGHCKQFAPEYEKIAQTLKDNDPPIPVAKVDATQASQLASKFDVSGYPTIKILKNGE-PVDYDGARTEKAIVERVKEVAHPDWKPPPDATLVLTQENFDDTVNNADIILVEFY 198          

HSP 4 Score: 81.6481 bits (200), Expect = 1.475e-15
Identity = 46/113 (40.71%), Postives = 69/113 (61.06%), Query Frame = 1
Query: 1825 VVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKN 2157
            V+  +NFD+ VN+    +L+EFYAPWCGHCK LAP+YE+ AK+LS  +  I +AK+DAT   ++   Y V+GFPT+    K        Y+  RE   +++++  +A  P K 
Sbjct:  177 VLTQENFDDTVNN-ADIILVEFYAPWCGHCKRLAPEYEKAAKELSKRTPPIPLAKVDATVETELAKRYGVNGFPTLKIFRKGRAF---EYNGPRENYGIVEHMGEQAGPPSKQ 285          

HSP 5 Score: 73.9442 bits (180), Expect = 3.458e-13
Identity = 40/79 (50.63%), Postives = 55/79 (69.62%), Query Frame = 1
Query: 1819 VKVVVAKNFDEIVNDPTKD-VLIEFYAPWCGHCKSLAPKYEELAKKL-SAESDIVIAKMDAT-ANDVPSPYEVSGFPTI 2046
            V V+   NFD  +    KD VL+EFYAPWCGHCK  AP+YE++A+ L   +  I +AK+DAT A+ + S ++VSG+PTI
Sbjct:   60 VLVLTDNNFDTFME--GKDTVLVEFYAPWCGHCKQFAPEYEKIAQTLKDNDPPIPVAKVDATQASQLASKFDVSGYPTI 136          

HSP 6 Score: 60.4622 bits (145), Expect = 4.635e-9
Identity = 27/59 (45.76%), Postives = 37/59 (62.71%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTL 191
            +L+EFYAPWCGHCKKL P+Y       KK+   + IAK+D TA     + +   G+PT+
Sbjct:  542 VLIEFYAPWCGHCKKLEPDYLSLGKKYKKEK-NLVIAKMDATANDIPNDNYKAEGFPTI 599          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 142.124 bits (357), Expect = 7.788e-36
Identity = 77/201 (38.31%), Postives = 124/201 (61.69%), Query Frame = 1
Query: 1549 VAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDE-PVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSP 2148
            VA++F   GK ++  I     ++  L+ +G+   D   V +   D + +KFK+ ++ ++++L +   + + +    YL+SE IPE  D+ PVKV+VAKNF+ +  DPTK+V +EFYAPWCGHCK LAP +E+L +  +   DI+IAKMDATAN+V S   + GFPT+ + P   K    SY+  R+++ + K++ +    P
Sbjct:  214 VAREF--KGKVLYILIDMTTAVSHVLNYFGVLEKDSPTVRMINMDTQ-KKFKIASEMTIDSLRQLSQEVVDDTAEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYADHDDIIIAKMDATANEVES-VAIDGFPTLKYFPAGDKEVI-SYTGNRDLETLSKFLDNGGVLP 409          

HSP 2 Score: 70.4774 bits (171), Expect = 2.612e-12
Identity = 36/85 (42.35%), Postives = 48/85 (56.47%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNG-QFAFDYSGERSADGIIKYM 266
            + VEFYAPWCGHCK+LAP +E         D  I IAK+D TA     E   + G+PTLK F  G +    Y+G R  + + K++
Sbjct:  321 VFVEFYAPWCGHCKELAPIWEQLGEIYADHD-DIIIAKMDATA--NEVESVAIDGFPTLKYFPAGDKEVISYTGNRDLETLSKFL 402          

HSP 3 Score: 70.4774 bits (171), Expect = 2.928e-12
Identity = 49/170 (28.82%), Postives = 88/170 (51.76%), Query Frame = 3
Query:   93 LKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQF--AFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFD-ETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEEN 593
            LK++   + +AKVD   E +  E+  V  +PT+K+F NG      +Y+G+R+  GI++++  +SGP + +L + ++  +F  + +  VVGFF +  S+    F  VA  L  D  FA T   E         N +V+F  KK  +   D ++  +    +H +  +++EN
Sbjct:    2 LKEEGSEMRLAKVDAIEEKELAEEFNVDSFPTVKLFMNGDRKEPIEYTGKRTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVGFFDNLESEAAAVFKEVAFDLT-DVEFAVTASPEVFKEYEVTANKVVLF--KKFDDGRADFELSEEDKLDKHNLTNFIKEN 168          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000041085.1 (SMESG000041085.1)

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 258/260 (99.23%), Postives = 260/260 (100.00%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRKSDL 2193
            MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKM+ADFSMENLEKFINDFL+EKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRKSDL
Sbjct:  231 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMMADFSMENLEKFINDFLEEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRKSDL 490          

HSP 2 Score: 410.994 bits (1055), Expect = 7.783e-136
Identity = 196/198 (98.99%), Postives = 198/198 (100.00%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQ+RTWVEEN+
Sbjct:   33 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQMRTWVEENI 230          

HSP 3 Score: 71.633 bits (174), Expect = 9.766e-13
Identity = 40/91 (43.96%), Postives = 55/91 (60.44%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            +L+EFYAPWCGHCK LAP+YE  A  L  +   I IAK+D TA       + VSG+PT+    KN + +   YS  R  D ++KY+ S++ 
Sbjct:   37 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVF-KNGQFA-FDYSGERSADGIIKYMVSKSG 125          

HSP 4 Score: 70.8626 bits (172), Expect = 1.486e-12
Identity = 40/91 (43.96%), Postives = 55/91 (60.44%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVF-KNGQFA-FDYSGERSADGIIKYMVSKSG 281
            +L+EFYAPWCGHCK LAP+YE  A  L  +   I IAK+D TA       + VSG+PT+    KN + +   YS  R  D ++KY+ S++ 
Sbjct:  385 VLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 473          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000041085.1 (SMESG000041085.1)

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 258/260 (99.23%), Postives = 260/260 (100.00%), Query Frame = 1
Query: 1414 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRKSDL 2193
            MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKM+ADFSMENLEKFINDFL+EKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRKSDL
Sbjct:  217 MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMMADFSMENLEKFINDFLEEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFDRQGRDRKSDL 476          

HSP 2 Score: 410.994 bits (1055), Expect = 4.831e-136
Identity = 196/198 (98.99%), Postives = 198/198 (100.00%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM 596
            EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQ+RTWVEEN+
Sbjct:   19 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQMRTWVEENI 216          

HSP 3 Score: 71.633 bits (174), Expect = 9.691e-13
Identity = 40/91 (43.96%), Postives = 55/91 (60.44%), Query Frame = 1
Query: 1876 VLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 2142
            +L+EFYAPWCGHCK LAP+YE  A  L  +   I IAK+D TA       + VSG+PT+    KN + +   YS  R  D ++KY+ S++ 
Sbjct:   23 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVF-KNGQFA-FDYSGERSADGIIKYMVSKSG 111          

HSP 4 Score: 70.8626 bits (172), Expect = 1.555e-12
Identity = 40/91 (43.96%), Postives = 55/91 (60.44%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVF-KNGQFA-FDYSGERSADGIIKYMVSKSG 281
            +L+EFYAPWCGHCK LAP+YE  A  L  +   I IAK+D TA       + VSG+PT+    KN + +   YS  R  D ++KY+ S++ 
Sbjct:  371 VLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEAS 459          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000023147.1 (SMESG000023147.1)

HSP 1 Score: 142.124 bits (357), Expect = 1.238e-35
Identity = 84/197 (42.64%), Postives = 116/197 (58.88%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHT-----FDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEE 590
            +LVEFYAPWCGHCK LAPEY  AA  LK+++  I +AKVD T E     K  + GYPTLK FK+G+   DY G R+AD II ++  K+GP +  LK+ E       S D VVVGFF  ++S   KAF SVA+   +D  F  T     FDE    K++  ++IV+F       KF++ +  + G   +  IRT++++
Sbjct:   44 VLVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGK-VMDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQASAAAKAFESVADS-KDDVVFGVTSQKAVFDE---FKVSSDDSIVLFK------KFDEGRNDFTGPFVDKDIRTFIDK 229          

HSP 2 Score: 124.405 bits (311), Expect = 1.059e-29
Identity = 77/197 (39.09%), Postives = 112/197 (56.85%), Query Frame = 1
Query: 1552 AKKFIDSGKSIHFAISNVQEMNQELSEY-GIESPDFSKVYITARDERNQKFK-MIADFSMENLEKFINDFLQEKVPVYLKSESIPEKNDE-PVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIAS 2133
            AKKF+  G+ +   I+  +E N  + E+ G+   D     +   ++   KFK   A  S ENL  F+   L  KV  ++ ++ IPE  D+ PVKV+V KNFD +  D +K V +EFYAPWCGHCK LAP +++L +     +DIVIAKMD+TAN+V     +  FPTI + PK+S      +   R ++   K+I S
Sbjct:  277 AKKFL--GQVLFVIINTDEEDNDRVLEFFGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEG-VRIQSFPTIKYFPKDSDEMV-DFEGDRTLETFKKFIDS 469          

HSP 3 Score: 89.3521 bits (220), Expect = 2.532e-18
Identity = 47/115 (40.87%), Postives = 74/115 (64.35%), Query Frame = 1
Query: 1810 DEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIV-IAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSP 2148
            +E V V+   NF+E++ +  K VL+EFYAPWCGHCK+LAP+Y   A+KL  ++ I+ +AK+DAT  ND+ S +++ G+PT+ F  K+ K     Y  GR  D ++ ++  +   P
Sbjct:   23 EEGVLVLTNSNFNEVI-EKNKYVLVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFF-KDGK--VMDYGGGRTADTIISWLEKKTGPP 133          

HSP 4 Score: 63.929 bits (154), Expect = 2.954e-10
Identity = 34/87 (39.08%), Postives = 50/87 (57.47%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVF-KNGQFAFDYSGERSADGIIKYMVS 272
            + VEFYAPWCGHCK+LAP ++       K +  I IAK+D TA     E   +  +PT+K F K+     D+ G+R+ +   K++ S
Sbjct:  386 VFVEFYAPWCGHCKQLAPIWDQLGETY-KDNTDIVIAKMDSTA--NEVEGVRIQSFPTIKYFPKDSDEMVDFEGDRTLETFKKFIDS 469          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000010656.1 (SMESG000010656.1)

HSP 1 Score: 143.665 bits (361), Expect = 1.377e-35
Identity = 72/204 (35.29%), Postives = 118/204 (57.84%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNN-------IVIFHSKKMANKFEDTQVKYK---GDASEHQIRTWVEENM 596
            ILVEF+APWCGHCK LAPE+  AA  L   +PPI +A VD T ET   +++ VSGYP+LK+FKN  F  DYSG RS+DGI+ +M+     ++K + +  +F         +++G F+SE+  L+  F+     + EDF   ++F + +  +L Y  N       I++   + + N +E    K++    + +  ++ +++E+NM
Sbjct:  163 ILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPSLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLVREDFSSIYSFSDEI--RLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNM 364          

HSP 2 Score: 122.479 bits (306), Expect = 9.995e-29
Identity = 76/209 (36.36%), Postives = 112/209 (53.59%), Query Frame = 3
Query:    6 HSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELK------TEENFNKFTASADPVVVGFFT-------SESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEEN 593
            +++++VEFYAPWCGHCK+L P Y  AA  LKK +PPI + KVD T E++   + G+SGYPTLK FK+G   +DY   RS   I+ +M     P  +  K      T+ENF +   S+  ++V FF        S + +  KA   +   LN   + A T D T+ T L  + ++  + S K+  K ++  V Y G  S   I  W+ +N
Sbjct:   45 NNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELATRFGISGYPTLKFFKSG-IPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTQIVESSGYILVEFFAPWCGHCKSLAPEFAKA-AKILSNLNPPIQLA-TVDATVETDLAKEYHVSGYPSLKLF-KNKNFFVDYSGPRSSDGIVDWMIKN 249          

HSP 3 Score: 74.3294 bits (181), Expect = 2.021e-13
Identity = 63/225 (28.00%), Postives = 107/225 (47.56%), Query Frame = 1
Query: 1432 RTHSNVKYFAKRPLIVALYNVDYEKNPK-GTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIA--DFSMENLEKFINDFLQEKVPVYLKSESIPEKN-DEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVP--SPYEVSGF-PTIYFAPKNSKHSPKS 2085
            RT   ++   K+ L +  + VD+  + K  T  W  +I K+A  + D    I FAI++ +  + +L E  ++     ++ +    E + K++M A  +F  E++ KF++  L  KV   LKS  IP+    E +  VV   + E++ND   + L+  Y   C  C+SL      L+   S +S +    MD + ND+P  S  E   F PT+ F   ++   P S
Sbjct:  374 RTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ---IQFAIADDERQSDKLRELRLDDSG-EEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNILSSLSSTFSGKS-LKFFSMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNS 593          

HSP 4 Score: 73.559 bits (179), Expect = 2.806e-13
Identity = 41/119 (34.45%), Postives = 67/119 (56.30%), Query Frame = 1
Query: 1810 DEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNF 2160
            D  V V+ ++NFDE +N     V++EFYAPWCGHCK L P Y + A +L   +  I++ K+DAT  +++ + + +SG+PT+ F      +      S   + + +K + S    P KN+
Sbjct:   27 DSNVYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELATRFGISGYPTLKFFKSGIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNY 144          

HSP 5 Score: 69.3218 bits (168), Expect = 5.862e-12
Identity = 44/122 (36.07%), Postives = 71/122 (58.20%), Query Frame = 1
Query: 1819 VKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLS-AESDIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYI------ASEASSPLKNF 2160
            V  +  +NF +IV + +  +L+EF+APWCGHCKSLAP++ + AK LS     I +A +DAT   D+   Y VSG+P++      +K+    YS  R  D ++ ++      A++A S + +F
Sbjct:  145 VLTLTKENFTQIV-ESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPSLKLF--KNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDF 263          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000069732.1 (SMESG000069732.1)

HSP 1 Score: 109.768 bits (273), Expect = 5.283e-25
Identity = 70/225 (31.11%), Postives = 116/225 (51.56%), Query Frame = 1
Query: 1552 AKKFIDSGKSIHFAI---SNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIADFSME----------------------------NLEKFINDFLQEKVPVYLKSESIPEK-NDEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIA 2130
             K F +S + +HF +      +E ++EL E  I  P+ + V     D  N    +I  F+++                             +++F+ D    K+  +LKS++IPE  N EPVK++V KNF+E+  +  K V +EFYAPWC +CK L P +E LAK+L    D++IAK+D T ND+ + +E+  FPT+    K+S +    YS  R  + + ++++
Sbjct:  242 GKVFQNSHRFMHFMVFMDDKFEEAHKELEEAAINHPEITFVMTDVTD--NTTSSLIKHFNVDLSNLPHLVLSDAKHKRLFLPGFNEINGKRIDQFLMDVKNGKIGQFLKSQNIPENWNSEPVKILVGKNFEEVALNKQKTVFVEFYAPWCNYCKQLEPIWERLAKELLDVPDLIIAKLDKTENDIKN-FEIKSFPTLKLFLKDS-NEVVDYSGPRTRERLKEFLS 462          

HSP 2 Score: 71.633 bits (174), Expect = 1.049e-12
Identity = 43/145 (29.66%), Postives = 70/145 (48.28%), Query Frame = 3
Query:    3 EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFA 437
            +H  IL+ FYAPWC   +KL P +E AA  L + +  I + KVD T ET    K  +  YPT+ +FK  +    YS       I+ +++SK       + + ++ ++     D +    F   +  +   F+  AE L +D +FA
Sbjct:   41 DHKPILINFYAPWCKFSQKLLPHFENAAKNLLQMESRIKLGKVDVTVETDLANKFKIKSYPTIILFKEDR-QIPYSKAHHHLTILNWLISKVDKLIISVNSTDSLDEVRQKTDVL----FVINNDIMGDTFVGAAE-LIDDVQFA 179          

HSP 3 Score: 64.3142 bits (155), Expect = 1.785e-10
Identity = 41/101 (40.59%), Postives = 57/101 (56.44%), Query Frame = 3
Query:   15 ILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTA-ETKTCEKHGVSGYPTLKVF-KNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEE 311
            + VEFYAPWC +CK+L P +E  A  L    P + IAK+D T  + K  E   +  +PTLK+F K+     DYSG R+ +  +K  +SK    +  LK EE
Sbjct:  380 VFVEFYAPWCNYCKQLEPIWERLAKELLDV-PDLIIAKLDKTENDIKNFE---IKSFPTLKLFLKDSNEVVDYSGPRTRER-LKEFLSKFVNLNNALKNEE 475          

HSP 4 Score: 58.9214 bits (141), Expect = 8.421e-9
Identity = 38/109 (34.86%), Postives = 58/109 (53.21%), Query Frame = 1
Query: 1819 VKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKK-LSAESDIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEA 2139
            V VV  + F+E++ND  K +LI FYAPWC   + L P +E  AK  L  ES I + K+D T   D+ + +++  +PTI    K  +  P  YS       +L ++ S+ 
Sbjct:   27 VFVVNNETFEELIND-HKPILINFYAPWCKFSQKLLPHFENAAKNLLQMESRIKLGKVDVTVETDLANKFKIKSYPTIILF-KEDRQIP--YSKAHHHLTILNWLISKV 131          
The following BLAST results are available for this feature:
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDIA35.893e-8854.66protein disulfide isomerase family A member 3 [Sou... [more]
PDIA44.043e-5444.58protein disulfide isomerase family A member 4 [Sou... [more]
PDIA44.099e-5444.58protein disulfide isomerase family A member 4 [Sou... [more]
P4HB4.618e-3236.18prolyl 4-hydroxylase subunit beta [Source:HGNC Sym... [more]
P4HB3.422e-3136.32prolyl 4-hydroxylase subunit beta [Source:HGNC Sym... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdi-31.835e-7748.84pep chromosome:WBcel235:I:7015912:7021743:-1 gene:... [more]
pdi-31.835e-7748.84pep chromosome:WBcel235:I:7015912:7020790:-1 gene:... [more]
pdi-31.835e-7748.84pep chromosome:WBcel235:I:7015912:7020797:-1 gene:... [more]
C14B9.21.137e-4540.61Probable protein disulfide-isomerase A4 [Source:U... [more]
pdi-23.165e-3639.69Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERp605.952e-9257.09gene:FBgn0033663 transcript:FBtr0088058[more]
Pdi1.729e-3236.41gene:FBgn0286818 transcript:FBtr0346644[more]
Pdi1.729e-3236.41gene:FBgn0286818 transcript:FBtr0075648[more]
CG93026.037e-1849.40gene:FBgn0032514 transcript:FBtr0080470[more]
prtp2.908e-1745.45gene:FBgn0030329 transcript:FBtr0332954[more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia31.985e-8854.03protein disulfide isomerase family A, member 3 [So... [more]
pdia75.200e-8353.20protein disulfide isomerase family A, member 7 [So... [more]
pdia83.123e-7248.40protein disulfide isomerase family A, member 8 [So... [more]
pdia83.123e-7248.40protein disulfide isomerase family A, member 8 [So... [more]
pdia47.080e-5344.76protein disulfide isomerase family A, member 4 [So... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia32.996e-8955.06protein disulfide isomerase family A member 3 [Sou... [more]
pdia35.384e-8355.22protein disulfide isomerase family A member 3 [Sou... [more]
pdia31.566e-8255.22protein disulfide isomerase family A member 3 [Sou... [more]
pdia31.441e-7349.39protein disulfide isomerase family A member 3 [Sou... [more]
pdia35.098e-7254.55protein disulfide isomerase family A member 3 [Sou... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdia31.312e-8653.85protein disulfide isomerase associated 3 [Source:M... [more]
Pdia44.947e-5444.18protein disulfide isomerase associated 4 [Source:M... [more]
P4hb3.258e-3035.24prolyl 4-hydroxylase, beta polypeptide [Source:MGI... [more]
Pdia32.303e-2964.20protein disulfide isomerase associated 3 [Source:M... [more]
Pdia24.960e-2846.72protein disulfide isomerase associated 2 [Source:M... [more]
back to top
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P38657|PDIA3_BOVIN7.268e-8954.66Protein disulfide-isomerase A3 OS=Bos taurus OX=99... [more]
sp|Q5RDG4|PDIA3_PONAB2.830e-8754.66Protein disulfide-isomerase A3 OS=Pongo abelii OX=... [more]
sp|P30101|PDIA3_HUMAN2.830e-8754.66Protein disulfide-isomerase A3 OS=Homo sapiens OX=... [more]
sp|Q4VIT4|PDIA3_CHLAE4.042e-8754.66Protein disulfide-isomerase A3 OS=Chlorocebus aeth... [more]
sp|Q8JG64|PDIA3_CHICK8.706e-8654.88Protein disulfide-isomerase A3 OS=Gallus gallus OX... [more]
back to top
BLAST of Protein disulfide-isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IGN62.373e-10961.39Protein disulfide-isomerase OS=Macrostomum lignano... [more]
A0A1I8IJ812.844e-10961.39Protein disulfide-isomerase OS=Macrostomum lignano... [more]
T1G0581.813e-10764.73Protein disulfide-isomerase OS=Helobdella robusta ... [more]
K1Q7T55.587e-10765.22Protein disulfide-isomerase OS=Crassostrea gigas O... [more]
R7UDG31.313e-10664.48Protein disulfide-isomerase OS=Capitella teleta OX... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia36.804e-8854.03protein disulfide isomerase family A member 3 [Sou... [more]
pdia73.370e-7851.81protein disulfide-isomerase A3-like [Source:NCBI g... [more]
pdia81.885e-7750.40protein disulfide-isomerase A3-like [Source:NCBI g... [more]
pdia82.274e-6546.80protein disulfide-isomerase A3-like [Source:NCBI g... [more]
pdia81.646e-6145.20protein disulfide-isomerase A3-like [Source:NCBI g... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia35.542e-8453.47protein disulfide isomerase family A, member 3 [So... [more]
pdia45.950e-5040.40protein disulfide isomerase family A, member 4 [So... [more]
p4hb6.922e-3235.45prolyl 4-hydroxylase, beta polypeptide [Source:ZFI... [more]
ENSPMAT00000002052.19.622e-2644.62pep scaffold:Pmarinus_7.0:GL480798:2613:20969:-1 g... [more]
TMX38.506e-2430.93thioredoxin related transmembrane protein 3 [Sourc... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PDI16.278e-3037.88Protein disulfide isomerase; multifunctional oxido... [more]
EUG13.685e-2135.53Protein disulfide isomerase of the endoplasmic ret... [more]
MPD16.155e-1329.41Member of the protein disulfide isomerase (PDI) fa... [more]
TRX16.887e-937.14Cytoplasmic thioredoxin isoenzyme; part of thiored... [more]
TRX21.662e-833.70Cytoplasmic thioredoxin isoenzyme; part of thiored... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO316342.654e-7350.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329304.265e-6042.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO338431.028e-4558.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368302.623e-3642.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473402.771e-2651.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia33.185e-9055.65protein disulfide isomerase family A member 3 [Sou... [more]
pdia81.566e-6244.18protein disulfide-isomerase A3 [Source:NCBI gene;A... [more]
pdia84.249e-6244.18protein disulfide-isomerase A3 [Source:NCBI gene;A... [more]
pdia41.178e-5244.98protein disulfide isomerase family A member 4 [Sou... [more]
pdia27.788e-3638.31protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041085.17.783e-13699.23SMESG000041085.1[more]
SMESG000041085.14.831e-13699.23SMESG000041085.1[more]
SMESG000023147.11.238e-3542.64SMESG000023147.1[more]
SMESG000010656.11.377e-3535.29SMESG000010656.1[more]
SMESG000069732.15.283e-2531.11SMESG000069732.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012219 ID=SMED30012219|Name=Protein disulfide-isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=2291bp
AAGAACATTCTGTTATTCTTGTTGAATTTTATGCTCCATGGTGTGGACAC
TGTAAGAAATTAGCTCCTGAATATGAAATCGCAGCCACAGCTTTAAAGAA
ACAAGATCCACCCATCGCAATTGCTAAAGTAGATTGTACTGCTGAAACTA
AAACCTGTGAAAAGCATGGTGTTAGTGGATATCCAACCCTTAAAGTTTTT
AAAAATGGGCAATTCGCATTTGATTATAGCGGAGAACGATCAGCCGATGG
AATAATTAAATATATGGTATCGAAAAGTGGCCCTTCATCTAAAGAACTTA
AAACTGAAGAAAATTTTAATAAATTTACTGCTTCAGCAGACCCGGTTGTT
GTTGGGTTTTTCACATCAGAATCTTCAGATCTGTATAAGGCATTTTTAAG
TGTGGCCGAAAAATTAAATGAAGACTTTCGATTTGCCCACACTTTTGATG
AGACTTTAAGTACAAAGTTGAATTATAAAAATAATATTGTTATTTTCCAT
TCCAAAAAAATGGCAAATAAATTTGAAGATACCCAAGTGAAGTACAAAGG
AGACGCATCAGAACATCAAATAAGAACCTGGGTTGAAGAAAATATGTAAG
TTAATTATGTTCAGATTCGATTTTAAAATTAACTGATAAATTTTAATTTT
AAACCTTAAACGCTTATTGGTCGCCACGTTTTAACCAATAAGGGACATCA
TAAGTGGACTATAAGCTCGATTAGTATGATAGACGTGTCAATTTTCTATT
TGAAAATTCGATAATTGTATTAAGAATTATGTCGTAATTGTTTTTATGCA
ATTATTATTCACTGGAATTGCAATTTATCTCTAATCTGAATCTGTTGAAA
TTAAAAAAAACTTTGTATTGAAATCGTTTCATATTTAAATTTATTATTTA
TAAATGTCTTTCAAGTGTGCAGCGTTTTAAGTAACCGATGACGTAACTGC
TGTCATTGTGATTTATTTAATTGTATAATTCAATTTTACAGCTTGTTATA
TTAATCAAAATTAACTTCGCACAGGGTGATTTATATTGGGTAATTTTTTA
ATTGGTTTTGATTTACTTGAAAATATAATAAAATCCAATTAAATTAATGA
TTTCGATGTTTAATCTGAAAAAAAATAATATTCGGGTAGATTAGTGTTAT
AAAGTGAGCACATAAAATGGACTTTCCTTTTAGATCGATGAGGATATTTT
TAATTTGGCCTTTGTAAATTGATTCCATATGTAATGCTTTATATAAGATA
AACTATGCGGTTAACTGTATCAAATTTATTTAGCTATGTTTCCTTTATCA
TAAATGGTTTATCGAATTTTAAAGAGATATATTTTATAGCGAATACTAAA
AATCGGCGGATTATTTAGGAATTTTTAATTTCCAATTACGAAATTGATAA
TTGTATTCTTAGCATGGGATTGGCTGGCCATAGAACTCATTCTAATGTCA
AATACTTTGCCAAAAGACCTTTGATCGTCGCTCTTTACAATGTTGACTAC
GAAAAGAATCCTAAAGGAACAAACTACTGGAGAAATAGAATATTGAAAGT
TGCCAAAAAATTTATCGATTCTGGAAAATCTATACATTTTGCTATTTCCA
ATGTTCAAGAAATGAACCAAGAACTGTCAGAATATGGCATCGAATCTCCA
GATTTCAGTAAAGTATACATCACAGCCAGAGATGAAAGAAATCAGAAATT
TAAAATGATAGCAGATTTTTCTATGGAAAATTTGGAAAAATTCATTAACG
ATTTCCTACAAGAGAAAGTCCCAGTCTATTTGAAATCTGAATCTATTCCA
GAGAAAAACGATGAACCGGTTAAAGTTGTTGTGGCTAAGAATTTCGACGA
GATCGTTAACGATCCTACAAAAGATGTATTGATTGAGTTCTATGCCCCGT
GGTGCGGACATTGCAAGAGTTTGGCGCCGAAATATGAGGAATTAGCCAAG
AAACTGTCCGCTGAATCAGATATTGTTATTGCAAAAATGGATGCTACTGC
AAACGATGTTCCGAGTCCTTATGAGGTGTCAGGATTCCCGACAATTTATT
TTGCGCCGAAGAATTCTAAACACTCTCCTAAATCATACAGTAGCGGTCGA
GAGGTCGACGATATGTTGAAGTATATTGCATCTGAAGCATCTTCTCCATT
GAAAAATTTCGATCGACAAGGCAGAGATCGTAAATCAGATCTTTAGAAAT
TCTAGTTTATTGAAATTAAATCATCATTGACAGGCGTTGTATTTTGCTAT
TCAATTTATCTGGTTTATTAACGTGTATGTAATTGTGTACT
back to top

protein sequence of SMED30012219-orf-1

>SMED30012219-orf-1 ID=SMED30012219-orf-1|Name=SMED30012219-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=261bp
MGLAGHRTHSNVKYFAKRPLIVALYNVDYEKNPKGTNYWRNRILKVAKKF
IDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKMIA
DFSMENLEKFINDFLQEKVPVYLKSESIPEKNDEPVKVVVAKNFDEIVND
PTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVP
SPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNFD
RQGRDRKSDL*
back to top

protein sequence of SMED30012219-orf-2

>SMED30012219-orf-2 ID=SMED30012219-orf-2|Name=SMED30012219-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=199bp
EHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETK
TCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELK
TEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDE
TLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQIRTWVEENM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR005788Disulphide_isomerase
IPR013766Thioredoxin_domain
IPR012336Thioredoxin-like_fold
IPR017937Thioredoxin_CS
Vocabulary: biological process
TermDefinition
GO:0045454cell redox homeostasis
Vocabulary: molecular function
TermDefinition
GO:0003756protein disulfide isomerase activity
GO:0016853isomerase activity
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00421THIOREDOXINcoord: 204..215
score: 35.14
coord: 155..163
score: 58.58
coord: 163..172
score: 65.89
NoneNo IPR availablePFAMPF13848Thioredoxin_6coord: 5..113
e-value: 2.1E-12
score: 47.3
NoneNo IPR availablePANTHERPTHR18929:SF60PROTEIN DISULFIDE-ISOMERASEcoord: 1..246
NoneNo IPR availablePANTHERPTHR18929PROTEIN DISULFIDE ISOMERASEcoord: 1..246
NoneNo IPR availableCDDcd02995PDI_a_PDI_a'_Ccoord: 135..238
e-value: 7.02531E-60
score: 182.756
NoneNo IPR availableCDDcd03073PDI_b'_ERp72_ERp57coord: 4..115
e-value: 6.27853E-39
score: 129.764
IPR013766Thioredoxin domainPFAMPF00085Thioredoxincoord: 136..239
e-value: 3.1E-30
score: 104.2
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 117..243
score: 14.686
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 123..257
e-value: 1.3E-41
score: 143.7
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 8..117
e-value: 7.0E-35
score: 121.4
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 6..133
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 134..239
IPR005788Disulphide isomeraseTIGRFAMTIGR01126TIGR01126coord: 139..241
e-value: 2.6E-36
score: 122.1
IPR017937Thioredoxin, conserved sitePROSITEPS00194THIOREDOXIN_1coord: 156..174