Heterogeneous nuclear ribonucleoprotein U-like 1

Overview
NameHeterogeneous nuclear ribonucleoprotein U-like 1
Smed IDSMED30012216
Length (bp)3952
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heterogeneous nuclear ribonucleoprotein U-like 1 (SMED30012216) t-SNE clustered cells

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein U-like 1 (SMED30012216) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heterogeneous nuclear ribonucleoprotein U-like 1 (SMED30012216) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein U-like 1 (SMED30012216) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012216

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012216SMESG000033768.1 SmedASXL_016219SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012216SMESG000033768.1 SmedASXL_016219SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30012216SMESG000033768.1 dd_Smed_v4_1485_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012216SMESG000033768.1 dd_Smed_v4_1485_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012216SMESG000033768.1 dd_Smed_v4_1485_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012216SMESG000033768.1 dd_Smed_v4_1485_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012216SMESG000033768.1 dd_Smed_v4_1485_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012216SMESG000033768.1 dd_Smed_v4_1485_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012216SMESG000033768.1 dd_Smed_v4_1485_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Human
Match: HNRNPUL1 (heterogeneous nuclear ribonucleoprotein U like 1 [Source:HGNC Symbol;Acc:HGNC:17011])

HSP 1 Score: 352.058 bits (902), Expect = 2.821e-106
Identity = 180/404 (44.55%), Postives = 255/404 (63.12%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFN-GDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V +D YN D++  ++ +     PL  +GF Y+  G + +YGV+ G+V FE+KI ++  V+ L S   D + +RIGWS D+    LGE   SYGY   GK  ++  F +YG K  E+DVIGCF +F  G+ + LSF+ NG   G AFRI    L    L PH+ VKN   E NFG    + +CS    + G        +T +  + L++R R    PK K ECE+LMM GLP+ GKTTW  +    +P K+YN+L  N +++KM+V  LR++ N A RWD  I  ATQCLN+ ++IA  ++RN+ILDQTN Y +AQRR+M+PFE F RKAI++ PTD++ + R  +   EEGKDVP+ AVL+MK NF +P+   D  +E++FIELQR EA++LV++YNEE +
Sbjct:   58 TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQ-RAEPYCS---VLPG--------FTFIQHLPLSERIRGTVGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTLPDVG-DFLDEVLFIELQREEADKLVRQYNEEGR 448          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Human
Match: HNRNPUL1 (heterogeneous nuclear ribonucleoprotein U like 1 [Source:HGNC Symbol;Acc:HGNC:17011])

HSP 1 Score: 353.599 bits (906), Expect = 1.756e-105
Identity = 180/404 (44.55%), Postives = 255/404 (63.12%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFN-GDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V +D YN D++  ++ +     PL  +GF Y+  G + +YGV+ G+V FE+KI ++  V+ L S   D + +RIGWS D+    LGE   SYGY   GK  ++  F +YG K  E+DVIGCF +F  G+ + LSF+ NG   G AFRI    L    L PH+ VKN   E NFG    + +CS    + G        +T +  + L++R R    PK K ECE+LMM GLP+ GKTTW  +    +P K+YN+L  N +++KM+V  LR++ N A RWD  I  ATQCLN+ ++IA  ++RN+ILDQTN Y +AQRR+M+PFE F RKAI++ PTD++ + R  +   EEGKDVP+ AVL+MK NF +P+   D  +E++FIELQR EA++LV++YNEE +
Sbjct:  109 TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQ-RAEPYCS---VLPG--------FTFIQHLPLSERIRGTVGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTLPDVG-DFLDEVLFIELQREEADKLVRQYNEEGR 499          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Human
Match: HNRNPUL1 (heterogeneous nuclear ribonucleoprotein U like 1 [Source:HGNC Symbol;Acc:HGNC:17011])

HSP 1 Score: 354.755 bits (909), Expect = 1.769e-105
Identity = 180/404 (44.55%), Postives = 255/404 (63.12%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFN-GDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V +D YN D++  ++ +     PL  +GF Y+  G + +YGV+ G+V FE+KI ++  V+ L S   D + +RIGWS D+    LGE   SYGY   GK  ++  F +YG K  E+DVIGCF +F  G+ + LSF+ NG   G AFRI    L    L PH+ VKN   E NFG    + +CS    + G        +T +  + L++R R    PK K ECE+LMM GLP+ GKTTW  +    +P K+YN+L  N +++KM+V  LR++ N A RWD  I  ATQCLN+ ++IA  ++RN+ILDQTN Y +AQRR+M+PFE F RKAI++ PTD++ + R  +   EEGKDVP+ AVL+MK NF +P +  D  +E++FIELQR EA++LV++YNEE +
Sbjct:  209 TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQ-RAEPYCS---VLPG--------FTFIQHLPLSERIRGTVGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTLP-DVGDFLDEVLFIELQREEADKLVRQYNEEGR 599          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Human
Match: HNRNPUL1 (heterogeneous nuclear ribonucleoprotein U like 1 [Source:HGNC Symbol;Acc:HGNC:17011])

HSP 1 Score: 353.214 bits (905), Expect = 2.013e-105
Identity = 180/404 (44.55%), Postives = 255/404 (63.12%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFN-GDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V +D YN D++  ++ +     PL  +GF Y+  G + +YGV+ G+V FE+KI ++  V+ L S   D + +RIGWS D+    LGE   SYGY   GK  ++  F +YG K  E+DVIGCF +F  G+ + LSF+ NG   G AFRI    L    L PH+ VKN   E NFG    + +CS    + G        +T +  + L++R R    PK K ECE+LMM GLP+ GKTTW  +    +P K+YN+L  N +++KM+V  LR++ N A RWD  I  ATQCLN+ ++IA  ++RN+ILDQTN Y +AQRR+M+PFE F RKAI++ PTD++ + R  +   EEGKDVP+ AVL+MK NF +P+   D  +E++FIELQR EA++LV++YNEE +
Sbjct:  109 TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQ-RAEPYCS---VLPG--------FTFIQHLPLSERIRGTVGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTLPDV-GDFLDEVLFIELQREEADKLVRQYNEEGR 499          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Human
Match: HNRNPUL1 (heterogeneous nuclear ribonucleoprotein U like 1 [Source:HGNC Symbol;Acc:HGNC:17011])

HSP 1 Score: 353.214 bits (905), Expect = 2.013e-105
Identity = 180/404 (44.55%), Postives = 255/404 (63.12%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFN-GDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V +D YN D++  ++ +     PL  +GF Y+  G + +YGV+ G+V FE+KI ++  V+ L S   D + +RIGWS D+    LGE   SYGY   GK  ++  F +YG K  E+DVIGCF +F  G+ + LSF+ NG   G AFRI    L    L PH+ VKN   E NFG    + +CS    + G        +T +  + L++R R    PK K ECE+LMM GLP+ GKTTW  +    +P K+YN+L  N +++KM+V  LR++ N A RWD  I  ATQCLN+ ++IA  ++RN+ILDQTN Y +AQRR+M+PFE F RKAI++ PTD++ + R  +   EEGKDVP+ AVL+MK NF +P+   D  +E++FIELQR EA++LV++YNEE +
Sbjct:  109 TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQ-RAEPYCS---VLPG--------FTFIQHLPLSERIRGTVGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTLPDV-GDFLDEVLFIELQREEADKLVRQYNEEGR 499          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Celegans
Match: hrpu-1 (Heterogeneous nuclear RibonucleoProtein U [Source:UniProtKB/TrEMBL;Acc:B9WRU1])

HSP 1 Score: 194.512 bits (493), Expect = 1.069e-49
Identity = 125/401 (31.17%), Postives = 207/401 (51.62%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVI-PLCEDGFQYVCGGVKGNYGVK----------SGKVYFEVKI-----LKKFKVELNSDAGDSNFIRIGWS-ADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNL-RKKVNASRWDSFILSAT-QCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIP-EENSDLFNEIIFIE 1654
            + LD+YN+D+ +  +E  +  I P  +DG   + GG++ N+G+K          S ++ F+++I     ++    E  +D GD   +RIG+S A    L LGE   S+   + GK  ++ +FSD+G      DV+ C  + +  +I  S+ ING++ G  F  L     D V+ P I  KN    VN G    D     K KI      ED  W  + +++     RS   P  K +C VLM  GLP  GKTTW  + + EHP + + L+S + V++ MKV  + R ++   +   F+     + +N+ + +A  RR+N+ILD TNC+   ++R++  FEEF RK ++ VP +D +Q+R+ +   EE + +   A++Q K    +P     +   E+IFI+
Sbjct:  944 IELDYYNADILVKSAEKDIWQIEPFNQDGLALMWGGIRSNFGIKLPFKQTGKDASHRLAFQIQIDSYQSIQHLPTEFMADGGD---VRIGFSLASTASLILGESPGSWCISASGKRAANNHFSDFGKLFDIGDVVTCIFDLSVGTI--SYQINGENVGSPFESLQFREGD-VIFPTICTKNANINVNMGQELTDE----KWKIP-----EDRDWMFITEMDRAHLVRSHTAPAAKKDCTVLMTVGLPGVGKTTWVRRYLAEHPHEHWTLISADVVMDAMKVNGVPRIRLPTLKRPDFLRGIIGKSMNRLILLAPRRRKNYILDMTNCFAEKRKRKLMAFEEFNRKCMLFVPDEDTHQKRLIKQEHEENEKLDTDAMMQHKAAMSLPIVAEGEPCEELIFID 1329          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Celegans
Match: hrpu-1 (Heterogeneous nuclear RibonucleoProtein U [Source:UniProtKB/TrEMBL;Acc:B9WRU1])

HSP 1 Score: 194.512 bits (493), Expect = 1.069e-49
Identity = 125/401 (31.17%), Postives = 207/401 (51.62%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVI-PLCEDGFQYVCGGVKGNYGVK----------SGKVYFEVKI-----LKKFKVELNSDAGDSNFIRIGWS-ADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNL-RKKVNASRWDSFILSAT-QCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIP-EENSDLFNEIIFIE 1654
            + LD+YN+D+ +  +E  +  I P  +DG   + GG++ N+G+K          S ++ F+++I     ++    E  +D GD   +RIG+S A    L LGE   S+   + GK  ++ +FSD+G      DV+ C  + +  +I  S+ ING++ G  F  L     D V+ P I  KN    VN G    D     K KI      ED  W  + +++     RS   P  K +C VLM  GLP  GKTTW  + + EHP + + L+S + V++ MKV  + R ++   +   F+     + +N+ + +A  RR+N+ILD TNC+   ++R++  FEEF RK ++ VP +D +Q+R+ +   EE + +   A++Q K    +P     +   E+IFI+
Sbjct:  944 IELDYYNADILVKSAEKDIWQIEPFNQDGLALMWGGIRSNFGIKLPFKQTGKDASHRLAFQIQIDSYQSIQHLPTEFMADGGD---VRIGFSLASTASLILGESPGSWCISASGKRAANNHFSDFGKLFDIGDVVTCIFDLSVGTI--SYQINGENVGSPFESLQFREGD-VIFPTICTKNANINVNMGQELTDE----KWKIP-----EDRDWMFITEMDRAHLVRSHTAPAAKKDCTVLMTVGLPGVGKTTWVRRYLAEHPHEHWTLISADVVMDAMKVNGVPRIRLPTLKRPDFLRGIIGKSMNRLILLAPRRRKNYILDMTNCFAEKRKRKLMAFEEFNRKCMLFVPDEDTHQKRLIKQEHEENEKLDTDAMMQHKAAMSLPIVAEGEPCEELIFID 1329          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Celegans
Match: hrpu-1 (Heterogeneous nuclear RibonucleoProtein U [Source:UniProtKB/TrEMBL;Acc:B9WRU1])

HSP 1 Score: 191.045 bits (484), Expect = 2.620e-49
Identity = 125/401 (31.17%), Postives = 207/401 (51.62%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVI-PLCEDGFQYVCGGVKGNYGVK----------SGKVYFEVKI-----LKKFKVELNSDAGDSNFIRIGWS-ADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNL-RKKVNASRWDSFILSAT-QCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIP-EENSDLFNEIIFIE 1654
            + LD+YN+D+ +  +E  +  I P  +DG   + GG++ N+G+K          S ++ F+++I     ++    E  +D GD   +RIG+S A    L LGE   S+   + GK  ++ +FSD+G      DV+ C  + +  +I  S+ ING++ G  F  L     D V+ P I  KN    VN G    D     K KI      ED  W  + +++     RS   P  K +C VLM  GLP  GKTTW  + + EHP + + L+S + V++ MKV  + R ++   +   F+     + +N+ + +A  RR+N+ILD TNC+   ++R++  FEEF RK ++ VP +D +Q+R+ +   EE + +   A++Q K    +P     +   E+IFI+
Sbjct:  194 IELDYYNADILVKSAEKDIWQIEPFNQDGLALMWGGIRSNFGIKLPFKQTGKDASHRLAFQIQIDSYQSIQHLPTEFMADGGD---VRIGFSLASTASLILGESPGSWCISASGKRAANNHFSDFGKLFDIGDVVTCIFDLSVGTI--SYQINGENVGSPFESLQFREGD-VIFPTICTKNANINVNMGQELTDE----KWKIP-----EDRDWMFITEMDRAHLVRSHTAPAAKKDCTVLMTVGLPGVGKTTWVRRYLAEHPHEHWTLISADVVMDAMKVNGVPRIRLPTLKRPDFLRGIIGKSMNRLILLAPRRRKNYILDMTNCFAEKRKRKLMAFEEFNRKCMLFVPDEDTHQKRLIKQEHEENEKLDTDAMMQHKAAMSLPIVAEGEPCEELIFID 579          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Celegans
Match: hrpu-1 (Heterogeneous nuclear RibonucleoProtein U [Source:UniProtKB/TrEMBL;Acc:B9WRU1])

HSP 1 Score: 191.045 bits (484), Expect = 2.620e-49
Identity = 125/401 (31.17%), Postives = 207/401 (51.62%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVI-PLCEDGFQYVCGGVKGNYGVK----------SGKVYFEVKI-----LKKFKVELNSDAGDSNFIRIGWS-ADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNL-RKKVNASRWDSFILSAT-QCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIP-EENSDLFNEIIFIE 1654
            + LD+YN+D+ +  +E  +  I P  +DG   + GG++ N+G+K          S ++ F+++I     ++    E  +D GD   +RIG+S A    L LGE   S+   + GK  ++ +FSD+G      DV+ C  + +  +I  S+ ING++ G  F  L     D V+ P I  KN    VN G    D     K KI      ED  W  + +++     RS   P  K +C VLM  GLP  GKTTW  + + EHP + + L+S + V++ MKV  + R ++   +   F+     + +N+ + +A  RR+N+ILD TNC+   ++R++  FEEF RK ++ VP +D +Q+R+ +   EE + +   A++Q K    +P     +   E+IFI+
Sbjct:  194 IELDYYNADILVKSAEKDIWQIEPFNQDGLALMWGGIRSNFGIKLPFKQTGKDASHRLAFQIQIDSYQSIQHLPTEFMADGGD---VRIGFSLASTASLILGESPGSWCISASGKRAANNHFSDFGKLFDIGDVVTCIFDLSVGTI--SYQINGENVGSPFESLQFREGD-VIFPTICTKNANINVNMGQELTDE----KWKIP-----EDRDWMFITEMDRAHLVRSHTAPAAKKDCTVLMTVGLPGVGKTTWVRRYLAEHPHEHWTLISADVVMDAMKVNGVPRIRLPTLKRPDFLRGIIGKSMNRLILLAPRRRKNYILDMTNCFAEKRKRKLMAFEEFNRKCMLFVPDEDTHQKRLIKQEHEENEKLDTDAMMQHKAAMSLPIVAEGEPCEELIFID 579          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Celegans
Match: hrpu-1 (Heterogeneous nuclear RibonucleoProtein U [Source:UniProtKB/TrEMBL;Acc:B9WRU1])

HSP 1 Score: 174.096 bits (440), Expect = 1.071e-44
Identity = 115/367 (31.34%), Postives = 188/367 (51.23%), Query Frame = 2
Query:  611 GGVKGNYGVK----------SGKVYFEVKI-----LKKFKVELNSDAGDSNFIRIGWS-ADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNL-RKKVNASRWDSFILSAT-QCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIP-EENSDLFNEIIFIE 1654
            GG++ N+G+K          S ++ F+++I     ++    E  +D GD   +RIG+S A    L LGE   S+   + GK  ++ +FSD+G      DV+ C  + +  +I  S+ ING++ G  F  L     D V+ P I  KN    VN G    D     K KI      ED  W  + +++     RS   P  K +C VLM  GLP  GKTTW  + + EHP + + L+S + V++ MKV  + R ++   +   F+     + +N+ + +A  RR+N+ILD TNC+   ++R++  FEEF RK ++ VP +D +Q+R+ +   EE + +   A++Q K    +P     +   E+IFI+
Sbjct:    3 GGIRSNFGIKLPFKQTGKDASHRLAFQIQIDSYQSIQHLPTEFMADGGD---VRIGFSLASTASLILGESPGSWCISASGKRAANNHFSDFGKLFDIGDVVTCIFDLSVGTI--SYQINGENVGSPFESLQFREGD-VIFPTICTKNANINVNMGQELTDE----KWKIP-----EDRDWMFITEMDRAHLVRSHTAPAAKKDCTVLMTVGLPGVGKTTWVRRYLAEHPHEHWTLISADVVMDAMKVNGVPRIRLPTLKRPDFLRGIIGKSMNRLILLAPRRRKNYILDMTNCFAEKRKRKLMAFEEFNRKCMLFVPDEDTHQKRLIKQEHEENEKLDTDAMMQHKAAMSLPIVAEGEPCEELIFID 354          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Fly
Match: CG30122 (gene:FBgn0050122 transcript:FBtr0086660)

HSP 1 Score: 153.295 bits (386), Expect = 5.112e-37
Identity = 81/220 (36.82%), Postives = 127/220 (57.73%), Query Frame = 2
Query: 1100 WTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNL-RKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGK--DVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDINSDGKSK 1750
            + L+G V + +     +    + ECEV+++ GLP  GKT W  + + E+ DKRY L+  +  + KM +    RK V+  RWD         L    +IA+ RRRNFILDQTN Y +AQRR+MK F +F R A++ +P++DE +RR+ +  +E+G    V ES +  ++ NF +P      F++I + EL  +EA+  VKKYNE+ K     + + D +S+
Sbjct:  683 YVLIGLVPVEKLVSGPQRVGSRKECEVILLVGLPGAGKTHWAHKHVAENADKRYELIGPDAFISKMTIDGASRKTVHKGRWDKVYEICLNSLAALEDIAMKRRRNFILDQTNVYASAQRRKMKGFNDFKRIAVVCIPSEDELKRRIAEK-EEKGNAFTVKESTINNLRANFTLPSLEFGWFDDINYTELTGDEAKSEVKKYNEKGKKAIDAERSRDKRSR 901          

HSP 2 Score: 104.375 bits (259), Expect = 4.148e-22
Identity = 62/180 (34.44%), Postives = 91/180 (50.56%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLL-VIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNS----DAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDL-KDHVLIPHIYVKNVCFEVNFGST 1033
            V L + +SD++L I         PL  + +  +  G + NYGV+ GKV FEV+ L +  V  NS    D       R+G+S     L LGE   S+GY   G+  +   F+DYG     DDVIGC+L+   +   +++++NG+D G AF      L ++  L PHI  K   + VNF  T
Sbjct:  300 VGLSWLDSDLHLRIDPTTFASAKPLTSEIYSLIWSGARANYGVREGKVCFEVR-LSEESVPENSHYFRDEPHVRGFRVGFSMPKSSLLLGEAEHSFGYCETGRKATQSEFTDYGKPYQLDDVIGCYLDLESEPCTINYTLNGEDLGVAFEFEKSILGEEGALFPHIVTKGYEYLVNFSDT 478          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Fly
Match: CG30122 (gene:FBgn0050122 transcript:FBtr0300924)

HSP 1 Score: 152.91 bits (385), Expect = 5.381e-37
Identity = 81/220 (36.82%), Postives = 127/220 (57.73%), Query Frame = 2
Query: 1100 WTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNL-RKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGK--DVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDINSDGKSK 1750
            + L+G V + +     +    + ECEV+++ GLP  GKT W  + + E+ DKRY L+  +  + KM +    RK V+  RWD         L    +IA+ RRRNFILDQTN Y +AQRR+MK F +F R A++ +P++DE +RR+ +  +E+G    V ES +  ++ NF +P      F++I + EL  +EA+  VKKYNE+ K     + + D +S+
Sbjct:  683 YVLIGLVPVEKLVSGPQRVGSRKECEVILLVGLPGAGKTHWAHKHVAENADKRYELIGPDAFISKMTIDGASRKTVHKGRWDKVYEICLNSLAALEDIAMKRRRNFILDQTNVYASAQRRKMKGFNDFKRIAVVCIPSEDELKRRIAEK-EEKGNAFTVKESTINNLRANFTLPSLEFGWFDDINYTELTGDEAKSEVKKYNEKGKKAIDAERSRDKRSR 901          

HSP 2 Score: 104.375 bits (259), Expect = 4.554e-22
Identity = 62/180 (34.44%), Postives = 91/180 (50.56%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLL-VIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNS----DAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDL-KDHVLIPHIYVKNVCFEVNFGST 1033
            V L + +SD++L I         PL  + +  +  G + NYGV+ GKV FEV+ L +  V  NS    D       R+G+S     L LGE   S+GY   G+  +   F+DYG     DDVIGC+L+   +   +++++NG+D G AF      L ++  L PHI  K   + VNF  T
Sbjct:  300 VGLSWLDSDLHLRIDPTTFASAKPLTSEIYSLIWSGARANYGVREGKVCFEVR-LSEESVPENSHYFRDEPHVRGFRVGFSMPKSSLLLGEAEHSFGYCETGRKATQSEFTDYGKPYQLDDVIGCYLDLESEPCTINYTLNGEDLGVAFEFEKSILGEEGALFPHIVTKGYEYLVNFSDT 478          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Fly
Match: CG30122 (gene:FBgn0050122 transcript:FBtr0300923)

HSP 1 Score: 152.91 bits (385), Expect = 5.386e-37
Identity = 81/220 (36.82%), Postives = 127/220 (57.73%), Query Frame = 2
Query: 1100 WTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNL-RKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGK--DVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDINSDGKSK 1750
            + L+G V + +     +    + ECEV+++ GLP  GKT W  + + E+ DKRY L+  +  + KM +    RK V+  RWD         L    +IA+ RRRNFILDQTN Y +AQRR+MK F +F R A++ +P++DE +RR+ +  +E+G    V ES +  ++ NF +P      F++I + EL  +EA+  VKKYNE+ K     + + D +S+
Sbjct:  683 YVLIGLVPVEKLVSGPQRVGSRKECEVILLVGLPGAGKTHWAHKHVAENADKRYELIGPDAFISKMTIDGASRKTVHKGRWDKVYEICLNSLAALEDIAMKRRRNFILDQTNVYASAQRRKMKGFNDFKRIAVVCIPSEDELKRRIAEK-EEKGNAFTVKESTINNLRANFTLPSLEFGWFDDINYTELTGDEAKSEVKKYNEKGKKAIDAERSRDKRSR 901          

HSP 2 Score: 104.375 bits (259), Expect = 4.556e-22
Identity = 62/180 (34.44%), Postives = 91/180 (50.56%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLL-VIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNS----DAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDL-KDHVLIPHIYVKNVCFEVNFGST 1033
            V L + +SD++L I         PL  + +  +  G + NYGV+ GKV FEV+ L +  V  NS    D       R+G+S     L LGE   S+GY   G+  +   F+DYG     DDVIGC+L+   +   +++++NG+D G AF      L ++  L PHI  K   + VNF  T
Sbjct:  300 VGLSWLDSDLHLRIDPTTFASAKPLTSEIYSLIWSGARANYGVREGKVCFEVR-LSEESVPENSHYFRDEPHVRGFRVGFSMPKSSLLLGEAEHSFGYCETGRKATQSEFTDYGKPYQLDDVIGCYLDLESEPCTINYTLNGEDLGVAFEFEKSILGEEGALFPHIVTKGYEYLVNFSDT 478          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Fly
Match: Ddx1 (gene:FBgn0015075 transcript:FBtr0078492)

HSP 1 Score: 69.707 bits (169), Expect = 1.297e-11
Identity = 52/175 (29.71%), Postives = 78/175 (44.57%), Query Frame = 2
Query:  518 LDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKS-GKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNI 1039
            + F++    L ++ +GL     C+        G +   GV+  GK YFE  +             D    R+GWS     L LG   + +G+   GK  ++  F DYG   G+ DVIGC L+     +  SF+ NG + G AFR L  +L      P + +KN   + NFG T+ 
Sbjct:   91 MSFFDRGNALAVTPDGLR----CQSREFKEWHGCRATTGVRGKGKFYFEATVT------------DEGLCRVGWSTQQANLDLGTCRMGFGFGGTGKKSNNRQFDDYGEAFGKADVIGCLLDLKNQEV--SFTKNGQNLGVAFR-LPDNLAKETFYPAVVLKNAEMQFNFGKTDF 246          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Fly
Match: RyR (gene:FBgn0011286 transcript:FBtr0088638)

HSP 1 Score: 53.5286 bits (127), Expect = 1.903e-6
Identity = 37/106 (34.91%), Postives = 55/106 (51.89%), Query Frame = 2
Query:  617 VKGNYGVKSGKVYFEVKILKKFKVELNSDAGDSNFIRIGWS-ADNEPLS-LGEFGLSYGYDSMGKT-VSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGD 925
            V+ NY V SGK YFE ++L             S  +R+GW+ AD  P + LG    S+ +D    T +  G+   +G +    DVIGCF++    +I  SFS+NG+
Sbjct: 1083 VERNYAVTSGKWYFEFEVLT------------SGPMRVGWARADCYPGAMLGSEDTSWAFDGHNVTKMHAGSIEHFGVRYEAGDVIGCFIDVKEQTI--SFSLNGE 1174          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Zebrafish
Match: hnrnpul1 (heterogeneous nuclear ribonucleoprotein U-like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2432])

HSP 1 Score: 359.762 bits (922), Expect = 1.144e-107
Identity = 179/405 (44.20%), Postives = 256/405 (63.21%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNG-DSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEY-QRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V +D YNSD++  +S +     PL  +GF Y+  G +  YGV  G+V +E+K+ +   V+ L S   D + +R+GWS D+    LGE   SYGY   GK  ++  F DYG K GE D+IGC+++F+  + + ++FS NG     AFR+   +L    L PH+ VKN   E NFG      F           P+ D  ++ +G V+L  R R    P  K++C+VLMM GLP+CGKTTW  +  + +PDKR+N+L  N ++EKMKV  LR++ N A RWD  I  ATQCLN+ ++IA  ++RN+ILDQTN Y +AQRR+M+PFE F RKA+++ P D++  +RR  Q   E+GKDVP+ AVL+MK NFV+PE   D  +E++FIELQR+EA +L+K+YNEE +
Sbjct:  199 TLVAIDTYNSDLHFKVSPDHCSGYPLTIEGFAYLWSGARATYGVNKGRVCYELKVKEYISVKHLPSSEPDPHVVRVGWSLDSCSTQLGEEAFSYGYGGTGKKSTNYKFGDYGEKFGEGDIIGCYIDFDSHEQVEMAFSKNGKWLDVAFRVSKEELAGQALFPHVLVKNCAVEFNFGQREEPYF-----------PLPD-GYSFIGDVSLENRVRGTVGPSSKSDCQVLMMVGLPACGKTTWAAKHAEMNPDKRFNILGTNAIMEKMKVMGLRRQRNYAGRWDILIQQATQCLNRLLQIASHKKRNYILDQTNVYGSAQRRKMRPFEGFHRKAVVICPRDEDLKERRCKQA--EDGKDVPDQAVLEMKANFVLPEA-GDFLDEVMFIELQRDEARDLIKRYNEEGR 588          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Zebrafish
Match: hnrnpul1l (heterogeneous nuclear ribonucleoprotein U-like 1 like [Source:ZFIN;Acc:ZDB-GENE-030131-890])

HSP 1 Score: 352.058 bits (902), Expect = 2.895e-104
Identity = 176/402 (43.78%), Postives = 249/402 (61.94%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEF-NGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            V +D YN D++  ++ +     PL  +GF Y+  G +  YGV  G+V FE+KI ++  V+ L S   D + +RIGWS D+    LGE   S+GY   GK   +  F DYG K  E D++GC+++F + + I ++FS NG   G  +R+   +L    L PH+ VKN   E NFG      F  P    EG        +T L  ++L  R R    P  KT+CE+LMM GLP  GKTTW  +  KE+P+K++N+L  N ++EKMKV  LR++ N A RWD  I  ATQCLN+ ++IA  ++RN+ILDQTN Y +AQRR+M+PFE F RKAI++ PTD++ + R  +   EEGKDVP+ AVL+MK NFV+P +  +  +E+ FIELQ+ EAE L+K+YNEE +
Sbjct:  242 VVIDTYNCDLHFKVARDRYSGYPLTIEGFAYLWAGARATYGVNKGRVCFEMKINEEIPVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSFGYGGTGKKSCNCKFEDYGEKFTESDILGCYIDFESSEEIEIAFSKNGKSLGSCYRVSREELAGRALFPHVLVKNCAVEFNFGQREEPYFPPP----EG--------FTYLQDISLEDRVRGSVGPANKTDCEILMMVGLPGSGKTTWALKYAKENPEKKFNILGTNAIMEKMKVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTLKRTDEEGKDVPDHAVLEMKANFVLP-DVGEFLDEVRFIELQKEEAEALIKQYNEEGR 630          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Zebrafish
Match: hnrnpub (heterogeneous nuclear ribonucleoprotein Ub [Source:ZFIN;Acc:ZDB-GENE-030131-6422])

HSP 1 Score: 297.745 bits (761), Expect = 2.095e-85
Identity = 163/404 (40.35%), Postives = 239/404 (59.16%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNL-RKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKN 1711
            T V LD YN D++  +S N      L  + F ++  G + +YGV  GKV FE+K+ +K  ++ LNS   D + + IGWS  N  LSLGE   SY Y   GK  S+    DYG    E+DVIGCF+ F  D + +SFS NG+D G AF++    L D  L PH+   N   E NFG      F  PK        +ED  +T + ++ L +R R  K P  K +CEV++M GLP  GKTTW  + ++E+P K YN+LS N VLEK+ + ++ R+  + ++  +        L K +EIA  ++R++ILDQTN    AQRR+M  F  F RKA++V PTD+  + R  +  + +GKD+PE A+L+MK  + +PE+  D F+E+ ++ELQ++EA +L++KY EE+KN
Sbjct:  203 TLVCLDPYNCDLHFKVSRNRYSASSLTMESFAHLWAGGRASYGVNKGKVCFEMKVTEKTPIKHLNSKIMDFHDVHIGWSLANGCLSLGEEEFSYSYSDKGKKASNCVTEDYGEGFDENDVIGCFINFEADEVEISFSKNGNDLGVAFKVNKESLADRALFPHVLCHNCTVEFNFGQNETPFF--PK--------LED--FTFMQQIPLEERIRGPKGPVAKKDCEVIVMVGLPGSGKTTWVVKHVEENPGK-YNILSTNTVLEKLMINSVKRQNKDITKLMAISQRVPFYLGKLIEIAARKKRHYILDQTNVSSAAQRRKMCLFAGFQRKAVVVFPTDENLKERAQKKAEADGKDIPEHALLKMKALYTLPEQ-GDCFSEVTYVELQKDEASKLLEKYKEESKN 592          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Zebrafish
Match: hnrnpua (heterogeneous nuclear ribonucleoprotein Ua [Source:ZFIN;Acc:ZDB-GENE-030131-3731])

HSP 1 Score: 281.567 bits (719), Expect = 4.094e-80
Identity = 152/420 (36.19%), Postives = 242/420 (57.62%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAG-DSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKV-NASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK--NQKKKDINSDGKSKR 1753
            T V LD YN D++  +S +      L  + F Y+  G +G+YGV  GK  FE+K+++K  V+  S  G + + + +GWS  N    LGE   SY +    K  S+    DYG    E+DV+GCF+ F+G  + +SFS NG+D G+AF +   +LK   L PH+   N   E NFG      F  P              +TLL ++ ++ R R  K P+ K +CEV+++ GLP  GKT W  +  + +P K YN+L  + +LEKM +  L++++ + ++     L A   L KF+EIA  ++RN+ILDQTN   +A++R+M  F  F RKA++V PTD+EY++R  +  + +GK VPE A+ + K  + +P E  D F+E++++ELQ+ E  +L+++Y E++K  + + K I +  +SKR
Sbjct:  195 TTVCLDTYNCDLHFKVSRDRYSASSLTMESFAYLWAGGRGSYGVDKGKACFEMKVIEKIPVKHISSKGIEDHDVLVGWSLANSSYLLGEEAYSYAFSMTAKKTSNAVTEDYGETFDENDVVGCFINFDGAEVEISFSKNGEDLGKAFTVSKDELKGKPLFPHVLCHNCAVEFNFGQQESPFFAQPD------------GFTLLQQIPVHDRIRGPKGPENKKDCEVIVVVGLPGSGKTEWVTKHTEANPGK-YNILGTDTILEKMMISTLKRQMKDVTKLLEISLRAPLFLGKFIEIAARKKRNYILDQTNVSASARKRKMCLFAGFQRKAVVVCPTDEEYKKRTLKKAETDGKKVPEQAIRKTKRIYSLPVEG-DCFSEVLYVELQKEEVAKLLEQYKEDSKICSLEPKPIQAGVQSKR 600          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Zebrafish
Match: si:ch211-107m4.1 (si:ch211-107m4.1 [Source:ZFIN;Acc:ZDB-GENE-081107-3])

HSP 1 Score: 264.233 bits (674), Expect = 1.916e-74
Identity = 149/403 (36.97%), Postives = 225/403 (55.83%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKV-ELNSD-AGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFN--GDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            V LD YN D++  +  NG    PL  + F  +  G +  +G   GKV FE K +K+     LN++ A D + +R+GWS D+  L LGE  LSYG+D  G  V+ G    +G    E DVIGC+   +  G++  LSF  NG   G AF + S  L    L PH+  KN    VN    + DA   P              ++ L  +   QRTR+  P   K++CEVLMM G+P  GKT W +  I ++P KRY+LLS N++L  M     R+   A+  +  +  ATQC+++ ++IA +++RN+ILDQ N YP+AQR +M  F  + RKA++V P D+ ++ R+ Q  ++EG  V E+++L+ K +F +P +   L  E++F+EL   EA +L+ +Y EEA+
Sbjct:  242 VRLDSYNGDLHFEVDSNGSSGQPLFWEKFPLLWSGCRMTHGYCQGKVGFEAKFVKRLSAPALNTNNAPDLHVLRVGWSVDSSSLQLGEVELSYGFDGRGSIVTGGKEESFGEPFTEGDVIGCYAHIDETGEA-TLSFHKNGRSLGVAFHLNSSVLGGQALYPHVLCKNCSVSVNL---DPDAPWYPF----------PAGFSALSTLPPGQRTRAPLPAASKSDCEVLMMVGMPGSGKTHWAQAHILQNPSKRYDLLSTNSILNCM-----REPTGANHRELMLQQATQCVSQLIKIAAAKKRNYILDQANIYPSAQRHKMLCFHGYQRKAVVVFPPDEVWRSRLVQRQEQEGIAVQETSLLKAKVSFTVPVQGQHL-EEVMFVELNSEEALKLLTQYKEEAR 624          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Xenopus
Match: HNRNPUL1 (heterogeneous nuclear ribonucleoprotein U-like 1 [Source:NCBI gene;Acc:100498275])

HSP 1 Score: 361.303 bits (926), Expect = 3.045e-111
Identity = 188/403 (46.65%), Postives = 253/403 (62.78%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKV-ELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEF--NGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            V LD YNSD++  + ++  +  PL  +GF Y+  G +  +GV  G+V FE+K+ +K  V  L S+  D + +R+GWS D+    LGE   SYGY   GK  S+  F +YG    E DVIGC+++F  +GD I +SFS NG   G AFR+    L    L PHI VKN   E NFG    + FCS    I G        +T +  V   +R R  +PPK K ECE+LMM GLP  GKTTW  +    HP+K+Y +L  N ++EKM+V  LR++ N A RWD  I  ATQCLN+ ++IA  R+RN+ILDQTN Y TAQ+R+M+PFE F RKAII+ PTD + Q R+ +   EEGKDVP+SAVL+MK NF +PE   D  +E+I++ELQ+ +AE LV++YNEE K
Sbjct:   70 VVLDNYNSDLHFKLDKDRTVGYPLTIEGFAYLWSGARATHGVNRGRVCFEMKVTEKISVGHLPSNEPDPHVVRVGWSLDSCSTQLGEEPFSYGYGGTGKKSSNSRFENYGETFAEHDVIGCYIDFESHGD-IEMSFSKNGQPLGVAFRVHKETLGSQALFPHILVKNCTVEFNFGQ-RPEPFCS---AIPG--------FTFIQHVQPYERVRGTEPPKNKAECEILMMVGLPGAGKTTWAVKHAAAHPEKKYVILGTNAIMEKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARRKRNYILDQTNVYGTAQKRKMRPFEGFQRKAIIICPTDADLQDRIVKRTDEEGKDVPDSAVLEMKANFALPEP-GDFLDEVIYVELQKEDAEPLVRQYNEEGK 458          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Xenopus
Match: HNRNPUL1 (heterogeneous nuclear ribonucleoprotein U-like 1 [Source:NCBI gene;Acc:100498275])

HSP 1 Score: 364.385 bits (934), Expect = 5.077e-111
Identity = 188/403 (46.65%), Postives = 253/403 (62.78%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKV-ELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEF--NGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            V LD YNSD++  + ++  +  PL  +GF Y+  G +  +GV  G+V FE+K+ +K  V  L S+  D + +R+GWS D+    LGE   SYGY   GK  S+  F +YG    E DVIGC+++F  +GD I +SFS NG   G AFR+    L    L PHI VKN   E NFG    + FCS    I G        +T +  V   +R R  +PPK K ECE+LMM GLP  GKTTW  +    HP+K+Y +L  N ++EKM+V  LR++ N A RWD  I  ATQCLN+ ++IA  R+RN+ILDQTN Y TAQ+R+M+PFE F RKAII+ PTD + Q R+ +   EEGKDVP+SAVL+MK NF +PE   D  +E+I++ELQ+ +AE LV++YNEE K
Sbjct:  125 VVLDNYNSDLHFKLDKDRTVGYPLTIEGFAYLWSGARATHGVNRGRVCFEMKVTEKISVGHLPSNEPDPHVVRVGWSLDSCSTQLGEEPFSYGYGGTGKKSSNSRFENYGETFAEHDVIGCYIDFESHGD-IEMSFSKNGQPLGVAFRVHKETLGSQALFPHILVKNCTVEFNFGQ-RPEPFCS---AIPG--------FTFIQHVQPYERVRGTEPPKNKAECEILMMVGLPGAGKTTWAVKHAAAHPEKKYVILGTNAIMEKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARRKRNYILDQTNVYGTAQKRKMRPFEGFQRKAIIICPTDADLQDRIVKRTDEEGKDVPDSAVLEMKANFALPEP-GDFLDEVIYVELQKEDAEPLVRQYNEEGK 513          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Xenopus
Match: HNRNPUL1 (heterogeneous nuclear ribonucleoprotein U-like 1 [Source:NCBI gene;Acc:100498275])

HSP 1 Score: 369.007 bits (946), Expect = 1.508e-110
Identity = 188/403 (46.65%), Postives = 253/403 (62.78%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKV-ELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEF--NGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            V LD YNSD++  + ++  +  PL  +GF Y+  G +  +GV  G+V FE+K+ +K  V  L S+  D + +R+GWS D+    LGE   SYGY   GK  S+  F +YG    E DVIGC+++F  +GD I +SFS NG   G AFR+    L    L PHI VKN   E NFG    + FCS    I G        +T +  V   +R R  +PPK K ECE+LMM GLP  GKTTW  +    HP+K+Y +L  N ++EKM+V  LR++ N A RWD  I  ATQCLN+ ++IA  R+RN+ILDQTN Y TAQ+R+M+PFE F RKAII+ PTD + Q R+ +   EEGKDVP+SAVL+MK NF +PE   D  +E+I++ELQ+ +AE LV++YNEE K
Sbjct:  148 VVLDNYNSDLHFKLDKDRTVGYPLTIEGFAYLWSGARATHGVNRGRVCFEMKVTEKISVGHLPSNEPDPHVVRVGWSLDSCSTQLGEEPFSYGYGGTGKKSSNSRFENYGETFAEHDVIGCYIDFESHGD-IEMSFSKNGQPLGVAFRVHKETLGSQALFPHILVKNCTVEFNFGQ-RPEPFCS---AIPG--------FTFIQHVQPYERVRGTEPPKNKAECEILMMVGLPGAGKTTWAVKHAAAHPEKKYVILGTNAIMEKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARRKRNYILDQTNVYGTAQKRKMRPFEGFQRKAIIICPTDADLQDRIVKRTDEEGKDVPDSAVLEMKANFALPEP-GDFLDEVIYVELQKEDAEPLVRQYNEEGK 536          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Xenopus
Match: HNRNPUL1 (heterogeneous nuclear ribonucleoprotein U-like 1 [Source:NCBI gene;Acc:100498275])

HSP 1 Score: 360.147 bits (923), Expect = 2.866e-109
Identity = 188/403 (46.65%), Postives = 253/403 (62.78%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKV-ELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEF--NGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            V LD YNSD++  + ++  +  PL  +GF Y+  G +  +GV  G+V FE+K+ +K  V  L S+  D + +R+GWS D+    LGE   SYGY   GK  S+  F +YG    E DVIGC+++F  +GD I +SFS NG   G AFR+    L    L PHI VKN   E NFG    + FCS    I G        +T +  V   +R R  +PPK K ECE+LMM GLP  GKTTW  +    HP+K+Y +L  N ++EKM+V  LR++ N A RWD  I  ATQCLN+ ++IA  R+RN+ILDQTN Y TAQ+R+M+PFE F RKAII+ PTD + Q R+ +   EEGKDVP+SAVL+MK NF +PE   D  +E+I++ELQ+ +AE LV++YNEE K
Sbjct:   70 VVLDNYNSDLHFKLDKDRTVGYPLTIEGFAYLWSGARATHGVNRGRVCFEMKVTEKISVGHLPSNEPDPHVVRVGWSLDSCSTQLGEEPFSYGYGGTGKKSSNSRFENYGETFAEHDVIGCYIDFESHGD-IEMSFSKNGQPLGVAFRVHKETLGSQALFPHILVKNCTVEFNFGQ-RPEPFCS---AIPG--------FTFIQHVQPYERVRGTEPPKNKAECEILMMVGLPGAGKTTWAVKHAAAHPEKKYVILGTNAIMEKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARRKRNYILDQTNVYGTAQKRKMRPFEGFQRKAIIICPTDADLQDRIVKRTDEEGKDVPDSAVLEMKANFALPEP-GDFLDEVIYVELQKEDAEPLVRQYNEEGK 458          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Xenopus
Match: hnrnpu (heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) [Source:NCBI gene;Acc:100038222])

HSP 1 Score: 292.352 bits (747), Expect = 2.665e-85
Identity = 164/405 (40.49%), Postives = 234/405 (57.78%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQK 1717
            T V LD YN D++  IS + L    L  + F  +  G +  YGV  GKV FE+K+ +K  V+ + +   D + +R+GWS  +    LGE   SYGY        +G   DYG K  E+DVI C   F  D I LS++ NG D G AF+I    + +  L PHI   N   E NFG      F  P    EG        +TL+  V L  R R+   P+ K +CEV+MM GLP  GKTTW     +++P K YN+L  N ++EKM V   ++  +  + ++ +  A QCL+KF+EIA  ++R+FILDQTN    AQRR+M  F  F RKA++V PTD+ Y+ R  +  + EGKD+PE AVL+MK NF +PE  S+ F+EI ++ELQ+ +A++L+++Y EE+K +K
Sbjct:  125 TMVLLDTYNCDLHFKISRDRLSASSLTMESFALLWAGGRATYGVLKGKVCFEMKVTEKIPVKHVYTKETDVHEVRVGWSLSSCGYMLGEEENSYGYSLKAAKCCNGVAEDYGEKYDENDVITCCANFEEDEIELSYAKNGQDLGVAFKINKDTILEQALFPHILCHNCAVEFNFGQMAEPFFSIP----EG--------YTLIQNVPLEDRVRAPLGPEQKQDCEVIMMIGLPGAGKTTWVTNHTEQNPGK-YNILGTNTIMEKMTVGCKKQMSDTGKLNALLQRAPQCLSKFIEIAARKKRHFILDQTNVSVAAQRRKMCLFAGFQRKAVVVCPTDELYKERTQKKSEVEGKDLPEHAVLKMKGNFTLPEA-SECFDEISYVELQKEDADKLIEQYKEESKTEK 515          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Mouse
Match: Hnrnpul1 (heterogeneous nuclear ribonucleoprotein U-like 1 [Source:MGI Symbol;Acc:MGI:2443517])

HSP 1 Score: 353.599 bits (906), Expect = 1.306e-105
Identity = 180/404 (44.55%), Postives = 255/404 (63.12%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFN-GDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V +D YN D++  ++ +     PL  +GF Y+  G + +YGV+ G+V FE+KI ++  V+ L S   D + +RIGWS D+    LGE   SYGY   GK  ++  F +YG K  E+DVIGCF +F  G+ + LSF+ NG   G AFRI    L    L PH+ VKN   E NFG    + +CS    + G        +T +  + L++R R    PK K ECE+LMM GLP+ GKTTW  +    +P K+YN+L  N +++KM+V  LR++ N A RWD  I  ATQCLN+ ++IA  ++RN+ILDQTN Y +AQRR+M+PFE F RKAI++ PTD++ + R  +   EEGKDVP+ AVL+MK NF +P+   D  +E++FIELQR EA++LV++YNEE +
Sbjct:  110 TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQ-RAEPYCS---VLPG--------FTFIQHLPLSERIRGTIGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTVKRTDEEGKDVPDHAVLEMKANFTLPDV-GDFLDEVLFIELQREEADKLVRQYNEEGR 500          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Mouse
Match: Hnrnpul1 (heterogeneous nuclear ribonucleoprotein U-like 1 [Source:MGI Symbol;Acc:MGI:2443517])

HSP 1 Score: 353.984 bits (907), Expect = 8.445e-105
Identity = 180/404 (44.55%), Postives = 255/404 (63.12%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFN-GDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V +D YN D++  ++ +     PL  +GF Y+  G + +YGV+ G+V FE+KI ++  V+ L S   D + +RIGWS D+    LGE   SYGY   GK  ++  F +YG K  E+DVIGCF +F  G+ + LSF+ NG   G AFRI    L    L PH+ VKN   E NFG    + +CS    + G        +T +  + L++R R    PK K ECE+LMM GLP+ GKTTW  +    +P K+YN+L  N +++KM+V  LR++ N A RWD  I  ATQCLN+ ++IA  ++RN+ILDQTN Y +AQRR+M+PFE F RKAI++ PTD++ + R  +   EEGKDVP+ AVL+MK NF +P+   D  +E++FIELQR EA++LV++YNEE +
Sbjct:  210 TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQ-RAEPYCS---VLPG--------FTFIQHLPLSERIRGTIGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTVKRTDEEGKDVPDHAVLEMKANFTLPDV-GDFLDEVLFIELQREEADKLVRQYNEEGR 600          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Mouse
Match: Hnrnpu (heterogeneous nuclear ribonucleoprotein U [Source:MGI Symbol;Acc:MGI:1858195])

HSP 1 Score: 306.99 bits (785), Expect = 1.349e-88
Identity = 167/403 (41.44%), Postives = 235/403 (58.31%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKV-ELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKV-NASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V LD YN D++  IS + L    L  + F ++  G + +YGV  GKV FE+K+ +K  V  L +   D + +RIGWS     + LGE   SYGY   G    +    DYG K  E+DVI CF  F  D + LS++ NG D G AF+I    L D  L PH+   N   E NFG      F  P          ED T+  +  V L  R R  K P+ K +CEV+MM GLP  GKTTW  +   E+P K YN+L  N +++KM V   +K++ +  + ++ +  A QCL KF+EIA  ++RNFILDQTN    AQRR+M  F  F RKA++V P D++Y++R  +  + EGKD+PE AVL+MK NF +PE  ++ F+EI ++ELQ+ EA++L+++Y EE+K
Sbjct:  262 TVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFETDEVELSYAKNGQDLGVAFKISKEVLADRPLFPHVLCHNCAVEFNFGQKEKPYFPIP----------EDCTF--IQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGK-YNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEV-AECFDEITYVELQKEEAQKLLEQYKEESK 650          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Mouse
Match: Hnrnpu (heterogeneous nuclear ribonucleoprotein U [Source:MGI Symbol;Acc:MGI:1858195])

HSP 1 Score: 306.99 bits (785), Expect = 1.349e-88
Identity = 167/403 (41.44%), Postives = 235/403 (58.31%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKV-ELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKV-NASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V LD YN D++  IS + L    L  + F ++  G + +YGV  GKV FE+K+ +K  V  L +   D + +RIGWS     + LGE   SYGY   G    +    DYG K  E+DVI CF  F  D + LS++ NG D G AF+I    L D  L PH+   N   E NFG      F  P          ED T+  +  V L  R R  K P+ K +CEV+MM GLP  GKTTW  +   E+P K YN+L  N +++KM V   +K++ +  + ++ +  A QCL KF+EIA  ++RNFILDQTN    AQRR+M  F  F RKA++V P D++Y++R  +  + EGKD+PE AVL+MK NF +PE  ++ F+EI ++ELQ+ EA++L+++Y EE+K
Sbjct:  262 TVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFETDEVELSYAKNGQDLGVAFKISKEVLADRPLFPHVLCHNCAVEFNFGQKEKPYFPIP----------EDCTF--IQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGK-YNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEV-AECFDEITYVELQKEEAQKLLEQYKEESK 650          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Mouse
Match: Hnrnpu (heterogeneous nuclear ribonucleoprotein U [Source:MGI Symbol;Acc:MGI:1858195])

HSP 1 Score: 306.605 bits (784), Expect = 1.446e-88
Identity = 167/403 (41.44%), Postives = 235/403 (58.31%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKV-ELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKV-NASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V LD YN D++  IS + L    L  + F ++  G + +YGV  GKV FE+K+ +K  V  L +   D + +RIGWS     + LGE   SYGY   G    +    DYG K  E+DVI CF  F  D + LS++ NG D G AF+I    L D  L PH+   N   E NFG      F  P          ED T+  +  V L  R R  K P+ K +CEV+MM GLP  GKTTW  +   E+P K YN+L  N +++KM V   +K++ +  + ++ +  A QCL KF+EIA  ++RNFILDQTN    AQRR+M  F  F RKA++V P D++Y++R  +  + EGKD+PE AVL+MK NF +PE  ++ F+EI ++ELQ+ EA++L+++Y EE+K
Sbjct:  262 TVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFETDEVELSYAKNGQDLGVAFKISKEVLADRPLFPHVLCHNCAVEFNFGQKEKPYFPIP----------EDCTF--IQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGK-YNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEV-AECFDEITYVELQKEEAQKLLEQYKEESK 650          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. UniProt/SwissProt
Match: sp|Q9BUJ2|HNRL1_HUMAN (Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=2)

HSP 1 Score: 354.369 bits (908), Expect = 4.436e-104
Identity = 180/404 (44.55%), Postives = 255/404 (63.12%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFN-GDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V +D YN D++  ++ +     PL  +GF Y+  G + +YGV+ G+V FE+KI ++  V+ L S   D + +RIGWS D+    LGE   SYGY   GK  ++  F +YG K  E+DVIGCF +F  G+ + LSF+ NG   G AFRI    L    L PH+ VKN   E NFG    + +CS    + G        +T +  + L++R R    PK K ECE+LMM GLP+ GKTTW  +    +P K+YN+L  N +++KM+V  LR++ N A RWD  I  ATQCLN+ ++IA  ++RN+ILDQTN Y +AQRR+M+PFE F RKAI++ PTD++ + R  +   EEGKDVP+ AVL+MK NF +P+   D  +E++FIELQR EA++LV++YNEE +
Sbjct:  209 TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQ-RAEPYCS---VLPG--------FTFIQHLPLSERIRGTVGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTLPDV-GDFLDEVLFIELQREEADKLVRQYNEEGR 599          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. UniProt/SwissProt
Match: sp|Q8VDM6|HNRL1_MOUSE (Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Mus musculus OX=10090 GN=Hnrnpul1 PE=1 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 5.907e-104
Identity = 180/404 (44.55%), Postives = 255/404 (63.12%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFN-GDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V +D YN D++  ++ +     PL  +GF Y+  G + +YGV+ G+V FE+KI ++  V+ L S   D + +RIGWS D+    LGE   SYGY   GK  ++  F +YG K  E+DVIGCF +F  G+ + LSF+ NG   G AFRI    L    L PH+ VKN   E NFG    + +CS    + G        +T +  + L++R R    PK K ECE+LMM GLP+ GKTTW  +    +P K+YN+L  N +++KM+V  LR++ N A RWD  I  ATQCLN+ ++IA  ++RN+ILDQTN Y +AQRR+M+PFE F RKAI++ PTD++ + R  +   EEGKDVP+ AVL+MK NF +P+   D  +E++FIELQR EA++LV++YNEE +
Sbjct:  210 TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQ-RAEPYCS---VLPG--------FTFIQHLPLSERIRGTIGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTVKRTDEEGKDVPDHAVLEMKANFTLPDV-GDFLDEVLFIELQREEADKLVRQYNEEGR 600          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. UniProt/SwissProt
Match: sp|Q6IMY8|HNRPU_RAT (Heterogeneous nuclear ribonucleoprotein U OS=Rattus norvegicus OX=10116 GN=Hnrnpu PE=1 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 7.898e-88
Identity = 167/403 (41.44%), Postives = 235/403 (58.31%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKV-ELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKV-NASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V LD YN D++  IS + L    L  + F ++  G + +YGV  GKV FE+K+ +K  V  L +   D + +RIGWS     + LGE   SYGY   G    +    DYG K  E+DVI CF  F  D + LS++ NG D G AF+I    L D  L PH+   N   E NFG      F  P          ED T+  +  V L  R R  K P+ K +CEV+MM GLP  GKTTW  +   E+P K YN+L  N +++KM V   +K++ +  + ++ +  A QCL KF+EIA  ++RNFILDQTN    AQRR+M  F  F RKA++V P D++Y++R  +  + EGKD+PE AVL+MK NF +PE  ++ F+EI ++ELQ+ EA++L+++Y EE+K
Sbjct:  260 TVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFETDEVELSYAKNGQDLGVAFKISKEVLADRPLFPHVLCHNCAVEFNFGQKEKPYFPIP----------EDCTF--IQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGK-YNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEV-AECFDEITYVELQKEEAQKLLEQYKEESK 648          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. UniProt/SwissProt
Match: sp|Q8VEK3|HNRPU_MOUSE (Heterogeneous nuclear ribonucleoprotein U OS=Mus musculus OX=10090 GN=Hnrnpu PE=1 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 9.436e-88
Identity = 167/403 (41.44%), Postives = 235/403 (58.31%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKV-ELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKV-NASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V LD YN D++  IS + L    L  + F ++  G + +YGV  GKV FE+K+ +K  V  L +   D + +RIGWS     + LGE   SYGY   G    +    DYG K  E+DVI CF  F  D + LS++ NG D G AF+I    L D  L PH+   N   E NFG      F  P          ED T+  +  V L  R R  K P+ K +CEV+MM GLP  GKTTW  +   E+P K YN+L  N +++KM V   +K++ +  + ++ +  A QCL KF+EIA  ++RNFILDQTN    AQRR+M  F  F RKA++V P D++Y++R  +  + EGKD+PE AVL+MK NF +PE  ++ F+EI ++ELQ+ EA++L+++Y EE+K
Sbjct:  262 TVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFETDEVELSYAKNGQDLGVAFKISKEVLADRPLFPHVLCHNCAVEFNFGQKEKPYFPIP----------EDCTF--IQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGK-YNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEV-AECFDEITYVELQKEEAQKLLEQYKEESK 650          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. UniProt/SwissProt
Match: sp|Q00839|HNRPU_HUMAN (Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6)

HSP 1 Score: 307.375 bits (786), Expect = 1.342e-87
Identity = 164/403 (40.69%), Postives = 233/403 (57.82%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKV-ELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKV-NASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V LD YN D++  IS + L    L  + F ++  G + +YGV  GKV FE+K+ +K  V  L +   D + +RIGWS     + LGE   SYGY   G    +    DYG K  E+DVI CF  F  D + LS++ NG D G AF+I    L    L PH+   N   E NFG      F  P+             +T +  V L  R R  K P+ K +CEV+MM GLP  GKTTW  +   E+P K YN+L  N +++KM V   +K++ +  + ++ +  A QCL KF+EIA  ++RNFILDQTN    AQRR+M  F  F RKA++V P D++Y++R  +  + EGKD+PE AVL+MK NF +PE  ++ F+EI ++ELQ+ EA++L+++Y EE+K
Sbjct:  286 TVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELSYAKNGQDLGVAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEE------------YTFIQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGK-YNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEV-AECFDEITYVELQKEEAQKLLEQYKEESK 674          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. TrEMBL
Match: A0A564YDI9 (Uncharacterized protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5172 PE=4 SV=1)

HSP 1 Score: 430.639 bits (1106), Expect = 1.720e-128
Identity = 211/430 (49.07%), Postives = 289/430 (67.21%), Query Frame = 2
Query:  482 EHENWESRTDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDA--GDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDL-KDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNAS-RWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSD----LFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDINSDGKS 1747
            E ++WESR +V LDFYNSD++LVI+++     P+ +DGF  +  G + NYGVKSGK YFEV+++K+  ++   ++  G ++ +R GWS D   L+LGE   S+GY   GK  +DG F DYG+   E DV+G FLEF    +V++FS+NG DQGE FR+    L +D  L PH+YVKNV F VNFG  +  A+  P          E  +W L+G + + +R R L PP  K +CEV+MM GLP  GKT +    +K+HP+K YN+L  N +L+KMKV  L +K N S RWD+ I  ATQCLNK + IA  R+RN+ILDQTN YP+AQRR+M+PF+ F RKAI++VPTD+E++RR+ Q  +EEGK+VPE AVL+MK NF IP+  SD    +F+E+ F ELQR EAE+LVK+YN E K  + +D  S  +S
Sbjct:  245 EIDDWESRENVFLDFYNSDLSLVINQDCYSAKPMTDDGFSLMWAGTRANYGVKSGKTYFEVRVVKELSIDYTDESIEGATHVLRAGWSLDKSCLALGEEVNSFGYGGTGKKSTDGKFEDYGTTFKEGDVVGAFLEFTDSEVVMTFSVNGIDQGECFRLEKSSLGEDSALFPHVYVKNVEFSVNFGQNDQTAWFPP---------TEADSWKLIGTIPVEERVRGLLPP-AKEDCEVIMMIGLPGSGKTYYAANLLKDHPEKYYNVLGTNLILDKMKVMGLSRKRNYSGRWDALINKATQCLNKIISIACKRKRNYILDQTNVYPSAQRRKMRPFDGFQRKAIVIVPTDEEFKRRIEQRTKEEGKEVPEKAVLEMKANFEIPKPVSDDPASMFDEVTFTELQREEAEKLVKEYNAEGKASRSQDRRSRAES 664          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. TrEMBL
Match: A0A068Y516 (E1b 55 kDa associated protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000460500 PE=4 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 1.316e-121
Identity = 206/423 (48.70%), Postives = 277/423 (65.48%), Query Frame = 2
Query:  482 EHENWESRTDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSD--AGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLK-DHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIP----EENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKD 1726
            E  +WE + D+ LD YNSD++L+I+ +G    PL E+GF  +  G + NYGVK GK +FEVK+ K+  V+       G ++ +R+GWSAD   L+LGE   +YGY  M K  + G F DYG +  E DV+G FLE      V+SFS+NG +QGE +R+L   L  D  L PH+YVKNV F VNFG  N DA+  P    +        +W L+ +V L  R R+  PP  K ECEV+MM GLP  GKT +     K  P+K+YN+L  N +L+KMKV  L +K N   RWD  I  A QCLNK + IA  RRRN+ILDQTN YP+AQRR+M+PFE F R+AI++VPTD+E++RR++Q  +EEGK+VPE AVL+MK NF IP    E++S +F+E+IF ELQR+EAE+LVK+YN E K  ++ +
Sbjct:  250 EVNDWEKKEDILLDMYNSDISLIIARDGFSAKPLTEEGFSLMWAGARTNYGVKDGKCFFEVKVGKELSVDSAESLVGGATHVLRVGWSADKSGLALGEEVNTYGYGGMAKKSTGGKFEDYGCEFREGDVVGAFLEITDSEAVMSFSVNGANQGECYRVLKSSLGGDFALFPHVYVKNVDFMVNFGQENQDAWFPPSDDPD--------SWKLVNQVPLEGRVRAGLPPPSKAECEVIMMVGLPGAGKTVYANSLCKLKPEKQYNILGTNLILDKMKVTGLTRKRNYHGRWDVLIDKANQCLNKLISIACKRRRNYILDQTNVYPSAQRRKMRPFEGFQRRAIVIVPTDEEFKRRIDQRAKEEGKEVPEKAVLEMKANFEIPKSVVEDSSSVFDEVIFTELQRDEAEKLVKQYNAEGKAGRQAE 664          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. TrEMBL
Match: A0A5K3EWF6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 421.394 bits (1082), Expect = 2.811e-121
Identity = 217/436 (49.77%), Postives = 279/436 (63.99%), Query Frame = 2
Query:  482 EHENWESRTDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDS-NFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRI-LSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDV-TWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPE----ENSDLFNEIIFIELQRNEAEELVKKYNEEAK--NQKKKDINSDGKSKRD 1756
            E + WE +  V LD YNSD++LV+S++ L   PL E GF  +  G + NYGV  GK +FEVK++K+  VE L S  G S + +RIGWS +    +LGE   SYGY    K   DG F DYG K GE DVIG FLE       +SFS+NG  QGE +RI +S    D  L PHIYVKNV F VNFG  N  A+ SP          ED  +W L+ ++ L  R  + KPP  K ECE +MM GLP  GKT +     KE P+ RYN+L  N +L+KMKV  L +K N   RWD+ I  A QCLNK + IA  RRRN+ILDQTN YP+AQRR+M+PFE F RKAI++VPTD+E++RR++Q  +EEGK+VPE AVL+MK NF IP+    + S +F+E+IF ELQR++AE+L+K+YN E K   Q +K    D  S+RD
Sbjct:  204 ESDGWEQKDSVFLDIYNSDLSLVVSQDCLSAKPLTEGGFSLMWAGARANYGVNGGKSFFEVKVIKEISVENLESLVGGSTHVLRIGWSTEKTGFALGEEPFSYGYGGTAKKSCDGKFVDYGCKFGEGDVIGAFLEIANSEASMSFSVNGVQQGECYRIPVSSFGDDFALFPHIYVKNVEFSVNFGQDNQPAWFSP---------TEDADSWKLINEIPLTSRIHAQKPPPSKAECEAIMMIGLPGSGKTFFANNLCKEKPEMRYNVLGTNLILDKMKVTGLSRKRNYHGRWDALIDKANQCLNKLISIASKRRRNYILDQTNVYPSAQRRKMRPFEGFQRKAIVIVPTDEEFRRRIDQRTREEGKEVPEKAVLEMKANFEIPKAIDMDPSSVFDEVIFTELQRDDAEKLIKQYNVEGKASRQSEKRARMDSSSQRD 630          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. TrEMBL
Match: A0A0X3PRJ5 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR159823 PE=4 SV=1)

HSP 1 Score: 417.157 bits (1071), Expect = 3.436e-120
Identity = 202/421 (47.98%), Postives = 277/421 (65.80%), Query Frame = 2
Query:  482 EHENWESRTDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNS-DAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRI-LSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIED-VTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIP----EENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQK 1717
            E + WE + DV LD YN D++L++ ++G    P+   GF  +  GV+ NYG++ GKV+FEV++LK+  VE L+S   G ++ +R+GWS +    +LGE  LS+GY   GK   D  F+DYG K GE D +G FLE      V+SF++NG  QGE FR+ LS    + VL PHIYVKNV F VNFG +++ A+ +P          ED  +W ++ +  +  R     PP  K+ECEV MM GLP CGKT + E   KEH +K++N+L  N +L+KMKV  L +K N A RWD  I  AT CLN  + +A  RRRN+ILDQTN YP+AQRR+M+PFE F RKAI++VPTD+E++RR+ Q  +EEGK+VPE+AVL+MK NF IP    E+ S  F+++IF EL R EAE+LVKKYN E ++ +
Sbjct:  158 EADGWELKEDVFLDGYNCDLSLLVDKSGYSAKPMTTGGFSLMWAGVRANYGIRKGKVFFEVRLLKQIPVENLDSLSGGATHVLRVGWSTETTGFALGEEPLSFGYGGTGKKSCDNKFTDYGCKFGEGDTVGSFLELTDSEAVMSFAVNGVHQGECFRVSLSSLGSEPVLFPHIYVKNVEFSVNFGQSDMPAWFAPS--------FEDPASWKIMNETPIADRVHGRMPPASKSECEVTMMIGLPGCGKTYFAENLCKEHKEKQFNMLGTNLILDKMKVTGLNRKRNYAGRWDVLIEKATHCLNSLISLACKRRRNYILDQTNVYPSAQRRKMRPFEGFQRKAIVIVPTDEEFRRRIAQREKEEGKEVPENAVLEMKANFEIPKPSSEDPSSPFDDVIFTELPRKEAEDLVKKYNAEGRSNR 570          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. TrEMBL
Match: A0A068WGV4 (E1b 55 kDa associated protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000460500 PE=4 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 6.157e-120
Identity = 203/423 (47.99%), Postives = 275/423 (65.01%), Query Frame = 2
Query:  482 EHENWESRTDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSD--AGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLK-DHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIP----EENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKD 1726
            E  +WE + DV LD YNSD++L+I+ +G    PL E+GF  +  G + NYGVK GK +FEVK+ K+  V+       G ++ +R+GWS D   L+LGE   +YGY  M K  + G F +YG +  E DV+G FLE      V+SFS+NG +QGE +R+L   L  D  L PH+YVKNV F VNFG  N DA+  P    +        +W L+ +V L  R R+  PP  + ECE +MM GLP  GKT +     K  P+K+YN+L  N +L+KMKV  L +K N   RWD  I  A QCLNK + IA  RRRN+ILDQTN YP+AQRR+M+PFE F R+AI++VPTD+E++RR++Q  +EEGK+VPE AVL+MK NF IP    E++S +F+E+IF ELQR+EAE+LVK+YN E K  ++ +
Sbjct:  250 EVNDWEKKEDVLLDMYNSDISLIIARDGFSAKPLTEEGFSLMWAGARTNYGVKDGKCFFEVKVGKELSVDSAESLVGGATHVLRVGWSTDKSGLALGEEVNTYGYGGMAKKSTGGKFEEYGCEFREGDVVGAFLEITDSEAVMSFSVNGANQGECYRVLKSSLGGDFALFPHVYVKNVDFMVNFGQENQDAWFPPSDDPD--------SWKLVNQVPLEGRVRAGLPPPSRAECEAIMMVGLPGAGKTVYANSLCKLKPEKQYNILGTNLILDKMKVTGLTRKRNYHGRWDVLIDKANQCLNKLISIACKRRRNYILDQTNVYPSAQRRKMRPFEGFQRRAIVIVPTDEEFKRRIDQRAKEEGKEVPEKAVLEMKANFEIPKSVVEDSSSVFDEVIFTELQRDEAEKLVKQYNAEGKAGRQAE 664          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Cavefish
Match: ENSAMXT00000004746.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000044.1:1471864:1510447:1 gene:ENSAMXG00000004623.2 transcript:ENSAMXT00000004746.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 345.895 bits (886), Expect = 2.614e-103
Identity = 173/404 (42.82%), Postives = 252/404 (62.38%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEF-NGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V LD YN D++  +S +     PL  +GF Y+  G + +YGV  G+V FE+KI ++  V+ L S   D + +R+GWS D+    LGE   SYGY    K   +  F DYG K  E+D+IGC+++F + + + ++FS NG     A+R+   +L    L PH+ VKN   E NFG            K E   P+ +  +T +  V +  RTR    P+ K +CE+LMM GLP+CGKTTW  +  +++P+K+YN+L  N ++EKMKV  LR++ N A RWD  I  AT CLN+ ++IA  ++RN+ILDQTN Y +AQRR+M+PFE F RKAI++ PTD++ + R  +    EGKDVP+ AVL+MK NFV+PE   +  + + F+ELQ++EA +LVK+YNEE +
Sbjct:  154 TLVALDTYNCDLHFKVSRSRYGGCPLTIEGFAYLWSGARASYGVSKGRVCFEMKITEEISVKHLPSSEPDPHVVRVGWSLDSCSTQLGEEAFSYGYGGTAKKSCNCKFEDYGEKFAENDIIGCYIDFESSEEVEIAFSKNGKWLDVAYRVCKEELAGRALFPHVLVKNCAVEFNFGQ-----------KEEPFYPVRE-GYTFIHDVKIQDRTRGTVGPENKADCEILMMVGLPACGKTTWANKHAEKNPEKKYNILGTNAIMEKMKVMGLRRQKNYAGRWDVLIQQATLCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKERALKQTDVEGKDVPDHAVLEMKANFVLPEV-GEFLDGVTFVELQKDEAGKLVKQYNEEGR 544          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Cavefish
Match: HNRNPUL1 (heterogeneous nuclear ribonucleoprotein U like 1 [Source:HGNC Symbol;Acc:HGNC:17011])

HSP 1 Score: 348.206 bits (892), Expect = 1.197e-102
Identity = 176/402 (43.78%), Postives = 249/402 (61.94%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNG-DSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            V +D YNSD++  ++ N     PL  +GF Y+  G +  YGV  G++ +E+KI ++  V+ L S   D + +RIGWS D+    LGE  +SYGY   GK   +  F DYG K GE+DVIGC+++F   + + +SFS NG   G  + I   +L    L PHI VKN   E NFG            + E         +T + ++ L  RTR    P  K +CE+LMM GLP  GKTTW  +   ++P+K++N+L  N ++EKMKV  LR++ N A RWD  I  ATQCLN+ ++IA  ++RN+ILDQTN Y +AQRR+M+PFE F RKAI++ PTD++ + R  +   EEGKDVP+ AVL+MK NFV+PE   D  +E+I++E+QR EAE L+K+YNEE +
Sbjct:  275 VAIDTYNSDLHFKVARNRFSGYPLTIEGFAYLWAGARATYGVTKGRICYEMKINEEISVKHLPSSEPDPHVVRIGWSLDSCNTQLGEEPMSYGYGGTGKKSCNCKFEDYGEKFGENDVIGCYIDFESKEKVEMSFSKNGKWLGTCYSISRAELAGRALFPHILVKNCGVEFNFG------------QREEPFFPPPPGFTFIQQLPLQDRTRGSLGPATKADCEMLMMVGLPGSGKTTWANKYTMQNPEKKFNILGTNAIMEKMKVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKERTLKRTDEEGKDVPDHAVLEMKANFVLPEA-GDFLDEVIYVEMQREEAEPLIKQYNEEGR 663          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Cavefish
Match: si:ch211-107m4.1 (heterogeneous nuclear ribonucleoprotein U-like protein 1 [Source:NCBI gene;Acc:103029229])

HSP 1 Score: 277.715 bits (709), Expect = 3.233e-79
Identity = 148/404 (36.63%), Postives = 229/404 (56.68%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFK---VELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGC--FLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            V LD YNSD++  +  +G    P   + F  +  G +  +G   GKV FEVK +KK     V+L+ D  + + +R+GWS +   L LGE  LS+G+D+MGK V+ G    +G    E DV+GC  F+   G++ +L +  NG   GEAFRI S  L    L PH+  KN    +N     +  +  P              +  L  +   QRTR   PP  + +CEVLMM G+P+ GK+ W ++ + ++P+K YN+LS N++L  M++   + K      +  +  ATQCL   + IA ++RRNFILDQ N YP+AQ+ +M  F    R+A++VVP++ E++RR+ Q ++EEG  VP+ ++L+ K +F +PE+   L  E++F+EL   E ++L+  Y EEAK
Sbjct:  304 VRLDPYNSDLHFELGVDGCSGQPSLWEKFPLLRSGCRLTHGFTQGKVGFEVKFVKKLSAATVDLSFDP-EPHVLRVGWSVEGSSLQLGEEELSFGFDAMGKAVTGGKAGGFGEPFSEGDVLGCYAFISDCGEAELLYYK-NGRSLGEAFRISSSILAGRALYPHVLCKNCSIALNLDPEGVMWYPGPPD------------YCPLPVLPSAQRTRGPLPPPRRKDCEVLMMVGMPASGKSHWVQKHVAKNPEKHYNVLSTNSILHCMRLPGPQHK------ELLLQQATQCLTHLLRIAANKRRNFILDQANIYPSAQKHKMLLFHGHQRRAVVVVPSEAEWKRRLQQQLEEEGVQVPKLSLLKSKVSFTLPEQG-QLLEEVLFVELSSEEVQKLLTTYKEEAK 686          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Cavefish
Match: si:ch211-107m4.1 (heterogeneous nuclear ribonucleoprotein U-like protein 1 [Source:NCBI gene;Acc:103029229])

HSP 1 Score: 270.011 bits (689), Expect = 3.546e-76
Identity = 147/404 (36.39%), Postives = 227/404 (56.19%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFK---VELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGC--FLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            V LD YNSD++  +  +G    P   + F  +  G +  +G   GKV FEVK +KK     V+L+ D  + + +R+GWS +   L LGE  LS+G+D+MGK V+ G    +G    E DV+GC  F+   G++ +L +  NG   GEAFRI S  L    L PH+  KN    +N     +  +  P              +  L  +   QRTR   PP  + +CEVLMM G+P+ GK+ W ++ + ++P+K YN+LS N++L  M++   + K      +  +  ATQCL   + IA ++RRNFILDQ N YP+AQ+ +M  F    R+A++VVP++ E++RR+ Q +Q     VP+ ++L+ K +F +PE+   L  E++F+EL R E ++L+  Y EEAK
Sbjct:  304 VRLDPYNSDLHFELGVDGCSGQPSLWEKFPLLRSGCRLTHGFTQGKVGFEVKFVKKLSAATVDLSFDP-EPHVLRVGWSVEGSSLQLGEEELSFGFDAMGKAVTGGKAGGFGEPFSEGDVLGCYAFISDCGEAELLYYK-NGRSLGEAFRISSSILAGRALYPHVLCKNCSIALNLDPEGVMWYPGPPD------------YCPLPVLPSAQRTRGPLPPPRRKDCEVLMMVGMPASGKSHWVQKHVAKNPEKHYNVLSTNSILHCMRLPGPQHK------ELLLQQATQCLTHLLRIAANKRRNFILDQANIYPSAQKHKMLLFHGHQRRAVVVVPSEAEWKRRLQQGVQ-----VPKLSLLKSKVSFTLPEQG-QLLEEVLFVELCREEVQKLLTTYKEEAK 681          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Cavefish
Match: si:ch211-107m4.1 (heterogeneous nuclear ribonucleoprotein U-like protein 1 [Source:NCBI gene;Acc:103029229])

HSP 1 Score: 270.011 bits (689), Expect = 3.546e-76
Identity = 147/404 (36.39%), Postives = 227/404 (56.19%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFK---VELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGC--FLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            V LD YNSD++  +  +G    P   + F  +  G +  +G   GKV FEVK +KK     V+L+ D  + + +R+GWS +   L LGE  LS+G+D+MGK V+ G    +G    E DV+GC  F+   G++ +L +  NG   GEAFRI S  L    L PH+  KN    +N     +  +  P              +  L  +   QRTR   PP  + +CEVLMM G+P+ GK+ W ++ + ++P+K YN+LS N++L  M++   + K      +  +  ATQCL   + IA ++RRNFILDQ N YP+AQ+ +M  F    R+A++VVP++ E++RR+ Q +Q     VP+ ++L+ K +F +PE+   L  E++F+EL R E ++L+  Y EEAK
Sbjct:  304 VRLDPYNSDLHFELGVDGCSGQPSLWEKFPLLRSGCRLTHGFTQGKVGFEVKFVKKLSAATVDLSFDP-EPHVLRVGWSVEGSSLQLGEEELSFGFDAMGKAVTGGKAGGFGEPFSEGDVLGCYAFISDCGEAELLYYK-NGRSLGEAFRISSSILAGRALYPHVLCKNCSIALNLDPEGVMWYPGPPD------------YCPLPVLPSAQRTRGPLPPPRRKDCEVLMMVGMPASGKSHWVQKHVAKNPEKHYNVLSTNSILHCMRLPGPQHK------ELLLQQATQCLTHLLRIAANKRRNFILDQANIYPSAQKHKMLLFHGHQRRAVVVVPSEAEWKRRLQQGVQ-----VPKLSLLKSKVSFTLPEQG-QLLEEVLFVELCREEVQKLLTTYKEEAK 681          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Sea Lamprey
Match: HNRNPUL1 (heterogeneous nuclear ribonucleoprotein U like 1 [Source:HGNC Symbol;Acc:HGNC:17011])

HSP 1 Score: 352.443 bits (903), Expect = 3.900e-107
Identity = 181/403 (44.91%), Postives = 248/403 (61.54%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V LD YNSD++  ++ +     PL  +GF Y+  G +  +GV   KV FE+K+ +K  V+ L +     + +R+GWS D+    LGE   SYGY    K   D  F DYG +  E DVIGCF+ F G+ + LS   NG D G AF+I   +L    L PHI  KN   E NFG      F  P    EG        +  + +V L++R R    PK K +CEVLMM GLP  GK+TW E+  +E+P+K+YN++  NN++EKMK+  LR++ N A RWD  I  AT CLN+ ++IA  +RRN+ILDQTN Y +AQRR+M+PFE F RKAI++ PTD++ + R  +   EEGK+VP+SAVL+MK NF +PE  SD  NE++F+ELQ+ EAE+LV  Y EE +
Sbjct:   17 TLVVLDTYNSDLHFKVTRDRYSGFPLTFEGFAYLWSGARATFGVIKEKVGFEMKVTEKITVKHLPASEPCPHVVRVGWSLDSCSTQLGEEKFSYGYGGSAKKSVDCKFDDYGEEFSEGDVIGCFVNFEGEEVELSHYKNGKDLGVAFKISKEELAGRPLFPHILTKNCSMEFNFGQREEPFFPLP----EG--------FVFIQEVPLDKRIRGTVGPKTKADCEVLMMVGLPGVGKSTWAEKHCRENPEKKYNIMGTNNIMEKMKIMGLRRQRNYAGRWDVLIQEATHCLNRLLQIAARKRRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRSKKRTVEEGKEVPDSAVLEMKANFTLPEA-SDFLNEVVFVELQKEEAEKLVALYREEGR 406          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Nematostella
Match: EDO34873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN18])

HSP 1 Score: 282.722 bits (722), Expect = 5.138e-85
Identity = 153/403 (37.97%), Postives = 229/403 (56.82%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQK 1717
            V LD +NSD++ VI ++G+        GF Y+  G + ++GVKSGK++FEV +L K  V+L       + +R+GWS D+  L +GE  LSYGY    K      F DYG +   +D+I C+++ +     + F+ NG   G AFR L  +  +    PH+ VKN+   VNFG      F      I+G   IED    LL            + P  + +C+V+MM GLP  GKT W E+ +K+HP+K++N+L  N +++KMKV NL ++ N   RWD+ I  A+  LNK ++IA  + RN+ILDQTN YP A+RR+M  F  F R A ++V T++  + R  +    EGK VP  AV++MK NF +PE   ++FNE+ FIE  +  +  LV+++  E +  K
Sbjct:    1 VLLDDHNSDLHFVIEQDGVTGGNHSAPGFDYMWAGARASHGVKSGKIFFEVTVLDKLPVDLPETETTPHVVRVGWSVDSANLQVGEDALSYGYGGTAKCSVSNKFFDYGERYSSNDIITCYIDLDASPKCIFFAKNGLYLGVAFR-LGPEAYNKAFYPHVTVKNMRVRVNFG-----GFAPYFPPIQGFRMIEDAEQPLL--------IPGTRGPASQRDCQVIMMVGLPGAGKTYWAEKYVKDHPEKKFNILGTNAIMDKMKVMNLARRHNYHGRWDALIKQASDILNKVLKIAERKNRNYILDQTNVYPNARRRKMNNFRGFHRIAAVLVTTNEVLKERTERRENLEGKKVPVEAVMEMKANFTLPEV-GEIFNEVWFIEESKESSVRLVEQFRAEGQEFK 388          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Nematostella
Match: EDO33057 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST89])

HSP 1 Score: 275.018 bits (702), Expect = 1.127e-82
Identity = 146/361 (40.44%), Postives = 220/361 (60.94%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMK 1594
            V LD YNSD+ L I+   L +  L ++GF ++ GGV+  YG  SGK+ FE K+ +  +V+L       +F+R+GWS+D+  L LGE  LSYG+DS GK  ++  F+++G      DVI C+L+       +SFS NG+D G AF  L  D +   L PH+ +KN+   +NFG T  +A+ +PK   EG + I++       K  L   TR    P  K ECEV+MM GLP+ GKTTW    + EHPDK+YN+LS  +V+EKMK+    +K +   +   +  A + L++  EIA +++RN+ILDQTN Y  AQ+++M PFE F RKA++ +PT +E  +R+ +  ++EG ++P +A+  MK
Sbjct:   11 VVLDKYNSDLFLKIAPEALSLTILKDEGFPFMAGGVRATYGATSGKICFECKLTETAEVDLPDTEEPKHFVRVGWSSDSANLQLGEVALSYGFDSTGKKCTNNEFTEFGQTFTAGDVITCYLDLESSPKQISFSKNGEDLGSAFD-LPEDAQGKALFPHVMIKNIDCSLNFG-TQEEAWFAPK---EGFQFIQNAE-----KDTLEHGTRG---PASKEECEVIMMIGLPASGKTTWVNNHLNEHPDKKYNILSTYSVMEKMKILGAPRKQDVGGYSKLMDKAAKSLHRLFEIAPAKKRNYILDQTNVYLAAQKKKMNPFEGFNRKAVVCIPTMEELNKRVEER-KKEGVELPFNAICDMK 357          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Nematostella
Match: EDO37564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFI0])

HSP 1 Score: 182.956 bits (463), Expect = 2.392e-52
Identity = 98/232 (42.24%), Postives = 138/232 (59.48%), Query Frame = 2
Query:  605 VCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMK 1300
            + GGV+  YG  SGK+ FE K+ +  +V+L       +F+R+GWS+D+  L LGE  LSYG+DS GK  ++  F+++G      DVI C+L+       +SFS NG+D G AF  L  D +   L PH+ +KN+   +NFG T  +A+ +PK   EG + I++       K  L   TR    P  K ECEV+MM GLP+ GKTTW    + EHPDK+YN+LS  +V+EKMK
Sbjct:    1 MAGGVRATYGATSGKICFECKLTETAEVDLPDTEEPKHFVRVGWSSDSANLQLGEVALSYGFDSTGKKCTNNEFTEFGQAFTAGDVIACYLDLESSPKQISFSKNGEDLGSAFD-LPEDAQGKALFPHVMIKNIDCSLNFG-TQEEAWFAPK---EGFQFIQNAE-----KDTLEHGTRG---PASKEECEVIMMIGLPASGKTTWVNNHLNEHPDKKYNILSTYSVMEKMK 219          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Nematostella
Match: EDO28559 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T649])

HSP 1 Score: 58.5362 bits (140), Expect = 4.079e-10
Identity = 29/74 (39.19%), Postives = 45/74 (60.81%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAGDSNFIRIG 733
            V LD YNSD+ L I+   L +  L ++GF ++ GGV+  YG  SGK+ FE K+ +  +V+L       +F+R+G
Sbjct:   44 VVLDKYNSDLFLKIAPEALSLTILKDEGFPFMAGGVRATYGATSGKICFECKLTETAEVDLPDTEEPKHFVRVG 117          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Nematostella
Match: EDO47287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMK9])

HSP 1 Score: 53.9138 bits (128), Expect = 4.590e-7
Identity = 48/154 (31.17%), Postives = 70/154 (45.45%), Query Frame = 2
Query:  641 SGKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTK-IEGSEPIEDVT 1099
            SGK Y+E  +             D    R+GWS  +  L LG     +G+   GK   +  F  YG   G +D IGC++  N D+  + +S NG D G+AF I  + L        + +KN   + NFG ++    C PK   I  S+  +DVT
Sbjct:  143 SGKYYYEATVT------------DEGLCRVGWSTAHATLDLGTDEEGFGFGGTGKKSYNRQFDTYGEPFGINDTIGCYI--NLDNGTVKYSKNGVDFGKAFDI-PQALLGKTFFAAVVLKNAEMKFNFGDSSFQ--CPPKGDYIPLSKAPKDVT 279          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Medaka
Match: HNRNPUL1 (heterogeneous nuclear ribonucleoprotein U like 1 [Source:NCBI gene;Acc:101159602])

HSP 1 Score: 361.688 bits (927), Expect = 7.205e-108
Identity = 176/402 (43.78%), Postives = 254/402 (63.18%), Query Frame = 2
Query:  512 VHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEF-NGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVN-ASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            + +D YN D++  +S +     PL  +GF Y+  G +  +GV  G+V FE+KI ++ +V+ L S   D + +RIGWS D+    LGE   S+GY   GK  SD  F+DYG K GE+DVIGC+++F  GD + + +S NG + G AFR     L    L PH+ VKN   E NFG      F           P+E   +T +  + L ++ R  K P  K++CE+LMM GLP+CGKTTW  +  + +P K+YN+L  N +++KMKV  LR++ N A RWD  I  ATQCLN+ +EIA  +RRN+ILDQTN Y +A+RR+M+PFE F RKAI++ PTD++++ R  +   E+GKDVP+ AVL+MK NF +PE   D    + ++ELQR+EA++L+K+YNEE +
Sbjct:  253 ITIDTYNCDLHFKVSRDRYSGYPLTIEGFAYLWAGARATHGVAKGRVCFEMKINEEIQVKHLPSSEPDPHVVRIGWSLDHCSTQLGEEAFSFGYGGTGKKSSDCKFADYGEKFGENDVIGCYVDFETGDEVEIGYSKNGVNLGVAFRTTKEALAGRALFPHVLVKNCAVEFNFGQKREPYF----------PPME--GYTFIHNLPLEEKIRGSKGPASKSDCEILMMVGLPACGKTTWAIKHAEANPKKKYNILGTNAIMDKMKVMGLRRQKNYAGRWDVLIQQATQCLNRLIEIAARKRRNYILDQTNVYGSARRRKMRPFEGFQRKAIVICPTDEDFKERTLKQTNEQGKDVPDHAVLEMKANFTLPEP-CDFLEAVTYVELQRDEADKLLKQYNEEGR 641          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Medaka
Match: hnrnpub (heterogeneous nuclear ribonucleoprotein U [Source:NCBI gene;Acc:101165119])

HSP 1 Score: 282.337 bits (721), Expect = 4.945e-80
Identity = 147/403 (36.48%), Postives = 231/403 (57.32%), Query Frame = 2
Query:  506 TDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVE-LNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNL-RKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAK 1708
            T V LD YN D++  +S +      L  + F Y+  G K NYGV  GK  FE+KI +K  V+ + S   + + +++GWS     L LGE   SY Y    K  ++    D+G    E+DV+ C ++F GD +VLSFS NG +   AF +    L    L PH+   N   E NFG      F  P+             +T L K+ ++ R R LK P+ K +CE+++M GLP  GKTTW +  ++E+P K Y +L  + +++KM + +L R+  + ++  +    A   L KF+EIA  ++RN+ILD TN     Q+R+M  F  F RKA++V PT++EY++R+ + ++ +GK+VPE A+L+MK  + +PEE  + F+E+I+ EL ++EA  L+++Y EE+K
Sbjct:  203 TKVCLDTYNCDLHFKVSRDRYSASSLTMESFAYLWSGGKANYGVNKGKACFEMKITEKIPVKHITSKNMEIHDVQVGWSLVTGSLLLGEEEFSYAYSGKAKKTTNCVTEDFGEAFDENDVVCCLIDFEGDEVVLSFSKNGGEPSVAFHVKKDSLNGQALFPHVMCHNCAVEFNFGQMETPYFPEPEG------------YTFLQKIPISDRVRGLKGPQTKADCEIIVMVGLPGSGKTTWVKNHVQENPGKYY-ILGSDTIVDKMMINSLKRQSKDITKLTAISQRAPLFLGKFIEIAARKKRNYILDHTNLSAPGQKRKMCLFAGFQRKAVVVCPTEEEYKQRVQKKVESDGKEVPEHALLKMKGFYALPEE-GESFSEVIYAELPKDEASMLLEQYKEESK 591          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Medaka
Match: si:ch211-107m4.1 (heterogeneous nuclear ribonucleoprotein U-like protein 2 [Source:NCBI gene;Acc:105354862])

HSP 1 Score: 244.588 bits (623), Expect = 2.074e-68
Identity = 174/599 (29.05%), Postives = 274/599 (45.74%), Query Frame = 2
Query:   74 KQKMSMNYVE---LKVSELREECKIRNLDTTGLKVHLVDRL---NTYDKNQLLXXXXXXXXXXXXXXQSKENTVEESTASQNDPIDSNANQSNISENGSLHFNDVDLDKSPVMDKPTKNKTMSFESN-------------------------IKDYSKDNMYKLA---SCEHENWESRTDVH----LDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAG--DSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDINSDGKSK 1750
            K +++M   +   LKV+ELR       LD+ GLK  LVDRL    T  ++Q   +  E      +T  S  + VE+ T+S     D  A    +  +    F D      P  D P+   T   E                             ++ ++  YK A       EN  +   +H     D YN  ++  +  +G    P   D F  +  G +  +GV+ G V FEV++ +K  +    D    +   +R+GWSA +  L LGE  LS+ YD  GK V  G    +G    + D+IGC+  F+ D + LSF  NG   G AF      L+   L PH+  +         S ++  F  P        P     +T L  +   QR RS   P  KT+CEV+MM GLP  GK+ W +  +KEHPDK Y LL    +L  M        ++  + D+ +  A QCL + ++IA     N+ILDQ N   +A   +++ F  F R+ ++V P +DE++RR+ +  + +   +PE A+L+++ +  +PE +SDL  E+ ++EL +++A+ L+KKY +EA+      I    K +
Sbjct:   12 KSRLAMKLADIKKLKVTELRSRLVELGLDSKGLKAELVDRLWSATTTSESQQDGAPAEEAKQRNLTTSSPSSDVEDLTSSPPAEADVTAP---LKADRVREFTDCATQTEPDSDPPSALPTCGSEGETVCQAEGPQHAEDPGEHEDLGRGRAFYEFKEEIRYKRAKSPQAVQENDVTEQHIHDTLRFDPYNCHLHFEVGPDGCSGQPRFWDRFPLLWSGCRLTHGVQQGMVGFEVRVERKLLISQAEDGEVREPYGLRVGWSAADSSLLLGENELSFAYDGRGKKVQSGKEEMFGEPLTDGDIIGCYASFSADHVELSFHKNGRLMGVAFSFSVSRLRGRALFPHVLCR---------SCSVRLFSDPAAPEWYPGP---PGFTSLTALPTRQRIRSSSAPPSKTQCEVVMMVGLPGSGKSFWAQTHMKEHPDKHYKLLGTQELLTCM--------ISGGQKDNRLQQACQCLTELIKIAAQTPGNYILDQCNILFSALHYKLQLFAGFRRRVVVVFPPEDEWRRRLLEQQRNDKDHIPEIALLKLQVSCSLPETHSDLLEELQYVELPQDQAQTLLKKYKDEARRLLPPTIPKQPKKR 587          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Medaka
Match: si:ch211-107m4.1 (heterogeneous nuclear ribonucleoprotein U-like protein 2 [Source:NCBI gene;Acc:105354862])

HSP 1 Score: 243.817 bits (621), Expect = 2.530e-68
Identity = 172/587 (29.30%), Postives = 269/587 (45.83%), Query Frame = 2
Query:  101 ELKVSELREECKIRNLDTTGLKVHLVDRL---NTYDKNQLLXXXXXXXXXXXXXXQSKENTVEESTASQNDPIDSNANQSNISENGSLHFNDVDLDKSPVMDKPTKNKTMSFESN-------------------------IKDYSKDNMYKLA---SCEHENWESRTDVH----LDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAG--DSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDINSDGKSK 1750
            +LKV+ELR       LD+ GLK  LVDRL    T  ++Q   +  E      +T  S  + VE+ T+S     D  A    +  +    F D      P  D P+   T   E                             ++ ++  YK A       EN  +   +H     D YN  ++  +  +G    P   D F  +  G +  +GV+ G V FEV++ +K  +    D    +   +R+GWSA +  L LGE  LS+ YD  GK V  G    +G    + D+IGC+  F+ D + LSF  NG   G AF      L+   L PH+  +         S ++  F  P        P     +T L  +   QR RS   P  KT+CEV+MM GLP  GK+ W +  +KEHPDK Y LL    +L  M        ++  + D+ +  A QCL + ++IA     N+ILDQ N   +A   +++ F  F R+ ++V P +DE++RR+ +  + +   +PE A+L+++ +  +PE +SDL  E+ ++EL +++A+ L+KKY +EA+      I    K +
Sbjct:    8 KLKVTELRSRLVELGLDSKGLKAELVDRLWSATTTSESQQDGAPAEEAKQRNLTTSSPSSDVEDLTSSPPAEADVTAP---LKADRVREFTDCATQTEPDSDPPSALPTCGSEGETVCQAEGPQHAEDPGEHEDLGRGRAFYEFKEEIRYKRAKSPQAVQENDVTEQHIHDTLRFDPYNCHLHFEVGPDGCSGQPRFWDRFPLLWSGCRLTHGVQQGMVGFEVRVERKLLISQAEDGEVREPYGLRVGWSAADSSLLLGENELSFAYDGRGKKVQSGKEEMFGEPLTDGDIIGCYASFSADHVELSFHKNGRLMGVAFSFSVSRLRGRALFPHVLCR---------SCSVRLFSDPAAPEWYPGP---PGFTSLTALPTRQRIRSSSAPPSKTQCEVVMMVGLPGSGKSFWAQTHMKEHPDKHYKLLGTQELLTCM--------ISGGQKDNRLQQACQCLTELIKIAAQTPGNYILDQCNILFSALHYKLQLFAGFRRRVVVVFPPEDEWRRRLLEQQRNDKDHIPEIALLKLQVSCSLPETHSDLLEELQYVELPQDQAQTLLKKYKDEARRLLPPTIPKQPKKR 571          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Medaka
Match: si:ch211-107m4.1 (heterogeneous nuclear ribonucleoprotein U-like protein 2 [Source:NCBI gene;Acc:105354862])

HSP 1 Score: 243.817 bits (621), Expect = 2.683e-68
Identity = 172/587 (29.30%), Postives = 269/587 (45.83%), Query Frame = 2
Query:  101 ELKVSELREECKIRNLDTTGLKVHLVDRL---NTYDKNQLLXXXXXXXXXXXXXXQSKENTVEESTASQNDPIDSNANQSNISENGSLHFNDVDLDKSPVMDKPTKNKTMSFESN-------------------------IKDYSKDNMYKLA---SCEHENWESRTDVH----LDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAG--DSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDINSDGKSK 1750
            +LKV+ELR       LD+ GLK  LVDRL    T  ++Q   +  E      +T  S  + VE+ T+S     D  A    +  +    F D      P  D P+   T   E                             ++ ++  YK A       EN  +   +H     D YN  ++  +  +G    P   D F  +  G +  +GV+ G V FEV++ +K  +    D    +   +R+GWSA +  L LGE  LS+ YD  GK V  G    +G    + D+IGC+  F+ D + LSF  NG   G AF      L+   L PH+  +         S ++  F  P        P     +T L  +   QR RS   P  KT+CEV+MM GLP  GK+ W +  +KEHPDK Y LL    +L  M        ++  + D+ +  A QCL + ++IA     N+ILDQ N   +A   +++ F  F R+ ++V P +DE++RR+ +  + +   +PE A+L+++ +  +PE +SDL  E+ ++EL +++A+ L+KKY +EA+      I    K +
Sbjct:    8 KLKVTELRSRLVELGLDSKGLKAELVDRLWSATTTSESQQDGAPAEEAKQRNLTTSSPSSDVEDLTSSPPAEADVTAP---LKADRVREFTDCATQTEPDSDPPSALPTCGSEGETVCQAEGPQHAEDPGEHEDLGRGRAFYEFKEEIRYKRAKSPQAVQENDVTEQHIHDTLRFDPYNCHLHFEVGPDGCSGQPRFWDRFPLLWSGCRLTHGVQQGMVGFEVRVERKLLISQAEDGEVREPYGLRVGWSAADSSLLLGENELSFAYDGRGKKVQSGKEEMFGEPLTDGDIIGCYASFSADHVELSFHKNGRLMGVAFSFSVSRLRGRALFPHVLCR---------SCSVRLFSDPAAPEWYPGP---PGFTSLTALPTRQRIRSSSAPPSKTQCEVVMMVGLPGSGKSFWAQTHMKEHPDKHYKLLGTQELLTCM--------ISGGQKDNRLQQACQCLTELIKIAAQTPGNYILDQCNILFSALHYKLQLFAGFRRRVVVVFPPEDEWRRRLLEQQRNDKDHIPEIALLKLQVSCSLPETHSDLLEELQYVELPQDQAQTLLKKYKDEARRLLPPTIPKQPKKR 571          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Planmine SMEST
Match: SMESG000033768.1 (SMESG000033768.1)

HSP 1 Score: 2166.73 bits (5613), Expect = 0.000e+0
Identity = 1238/1247 (99.28%), Postives = 1241/1247 (99.52%), Query Frame = 2
Query:   83 MSMNYVELKVSELREECKIRNLDTTGLKVHLVDRLNTYDKNQLLXXXXXXXXXXXXXXQSKENTVEESTASQNDPIDSNANQSNISENGSLHFNDVDLDKSPVMDKPTKNKTMSFESNIKDYSKDNMYKLASCEHENWESRTDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDINSDGKSKRDVADESYGKWNSSPKSSEEAGPTAPKKSRWXXXXXXXXXXXXXXXXXXXXPESSSLPRKNDYKGGFCFSREASDNSKGGSRTSDGGFRSDSRHGDKSRDQRDRSGNRSINPPYRKPIETNDRRPKFDRDEPRFGNRNPMQGNRDSRPRDRGSESRGAGQFQGRERSRGNFNDRRQSDSYDNVDSRNKFPSGNYNDRNTGMGGNSNFGNQERGRFPMGGTQPEXXXXXXXXXXXXXXNNMGKDSFMDRRNAVPDNRDYQNYSEFNQFPDNRQANPTWQTDYKDESIMDRRSYGDVSNMNRSNQAPNYDQYGGTRNVMQGSSTRGKPLEKIPNQYDRKPVTAXXXXXXXXXXXXXXXXVESYSTDDYSYGTNKGYEGSSTKFGAKSYGDQSTGSYKEPLRSDTAPFGNPKPARGGYSRFGDAQKPHVAEVKPETGRGDYSSMQQPNSVPXXXXXXXXXXXXXXXXXXXXXTGDSGKDQSTAVGVGAQTYQASNPSSNRAPXXXXXXXXXXXXXXXXXXXXXXXXXXXNPPTGIVXXXXXXXXXXXXNTSNYSTNPASSVGGGYQANYPSTGTAAAGGYNTSNYPSANPSTAAPYQSAYPSSNPTSGSGGYTNPXXXXXXXXXXXXXXXXGQTNTYAQSGSYGDNTVASKYPDFSSKPPLDRAMXXXXXXXXXXXXXXXXXXXXXXXXXSWGT 3823
            MSMNYVELKVSELREECKIRNLDTTGLKVHLVDRLNTYDKNQLLKSKVESKTSTKVTEQSKENT+EESTASQNDPIDSNANQSNISENGSLHFNDVDLDKSPVMDKPTKNKTMSFESNIKDYSKDNMYKLASCEHENWESRTDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVL+PHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDINSDGKSKRDVADESYGKWNSSPKSSEEAGPTAPKKSRWNDQSDNRKDSKSRDRHDRSSPESSSLPRKNDYKGGFCFSREASDNSKGGSRTSDGGFRSDSRHGDKSRDQRDRSGNRSINPPYRKPIETNDRRPKFDRDEPRFGNRNPMQGNRDSRPRDRGSESRGAGQFQGRERSRGNFNDRRQSDSYDNVDSRNKFPSGNYNDRNTGMGGNSNFGNQERGRFPMGGTQPERGDFRGRGRGGP GNNMGKDSFMDRRNAVPDNRDYQNYSEFNQFPDNRQANPTWQTDYKDESIMDRRSYGDV NMNRSNQAPNYDQYGGTRNVMQGSS RGKPLEKIPNQYDRKPVTARGGLNSRGGGRGGFSSVESYSTDDYSYGTNKGYEGS+TKFGAKSYGDQSTGSYKEPLRSDTAPFGNPKPARGGYSRFGDAQKPHVAEVKPETGRGDYSSMQQPNSVPYDNYQSYDNSQYQNQGYYNYYTGDSGKDQSTAVGVGAQTYQASNPSSNRAPYQYQSSNTAAAAASSGSNYQSSVNSASNPPTGIVGGGGYQSSPYGSNTSNYSTNPASSVGGGYQANYPS GTAAAGGYNTSNYPSANPSTAAPYQSAYPSSNPTSGSGGYTNPYSAIYDSTSSYDSSYYGQTNTYAQSGSYGDNTVASKYPDFSSKPPLDRAMPP VAAAAAT AAVPPQAPANQNQASWGT
Sbjct:    1 MSMNYVELKVSELREECKIRNLDTTGLKVHLVDRLNTYDKNQLLKSKVESKTSTKVTEQSKENTIEESTASQNDPIDSNANQSNISENGSLHFNDVDLDKSPVMDKPTKNKTMSFESNIKDYSKDNMYKLASCEHENWESRTDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLMPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDINSDGKSKRDVADESYGKWNSSPKSSEEAGPTAPKKSRWNDQSDNRKDSKSRDRHDRSSPESSSLPRKNDYKGGFCFSREASDNSKGGSRTSDGGFRSDSRHGDKSRDQRDRSGNRSINPPYRKPIETNDRRPKFDRDEPRFGNRNPMQGNRDSRPRDRGSESRGAGQFQGRERSRGNFNDRRQSDSYDNVDSRNKFPSGNYNDRNTGMGGNSNFGNQERGRFPMGGTQPERGDFRGRGRGGPAGNNMGKDSFMDRRNAVPDNRDYQNYSEFNQFPDNRQANPTWQTDYKDESIMDRRSYGDVPNMNRSNQAPNYDQYGGTRNVMQGSSARGKPLEKIPNQYDRKPVTARGGLNSRGGGRGGFSSVESYSTDDYSYGTNKGYEGSTTKFGAKSYGDQSTGSYKEPLRSDTAPFGNPKPARGGYSRFGDAQKPHVAEVKPETGRGDYSSMQQPNSVPYDNYQSYDNSQYQNQGYYNYYTGDSGKDQSTAVGVGAQTYQASNPSSNRAPYQYQSSNTAAAAASSGSNYQSSVNSASNPPTGIVGGGGYQSSPYGSNTSNYSTNPASSVGGGYQANYPSAGTAAAGGYNTSNYPSANPSTAAPYQSAYPSSNPTSGSGGYTNPYSAIYDSTSSYDSSYYGQTNTYAQSGSYGDNTVASKYPDFSSKPPLDRAMPPSVAAAAATAAAVPPQAPANQNQASWGT 1247          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Planmine SMEST
Match: SMESG000033768.1 (SMESG000033768.1)

HSP 1 Score: 2162.5 bits (5602), Expect = 0.000e+0
Identity = 1236/1245 (99.28%), Postives = 1239/1245 (99.52%), Query Frame = 2
Query:   89 MNYVELKVSELREECKIRNLDTTGLKVHLVDRLNTYDKNQLLXXXXXXXXXXXXXXQSKENTVEESTASQNDPIDSNANQSNISENGSLHFNDVDLDKSPVMDKPTKNKTMSFESNIKDYSKDNMYKLASCEHENWESRTDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDINSDGKSKRDVADESYGKWNSSPKSSEEAGPTAPKKSRWXXXXXXXXXXXXXXXXXXXXPESSSLPRKNDYKGGFCFSREASDNSKGGSRTSDGGFRSDSRHGDKSRDQRDRSGNRSINPPYRKPIETNDRRPKFDRDEPRFGNRNPMQGNRDSRPRDRGSESRGAGQFQGRERSRGNFNDRRQSDSYDNVDSRNKFPSGNYNDRNTGMGGNSNFGNQERGRFPMGGTQPEXXXXXXXXXXXXXXNNMGKDSFMDRRNAVPDNRDYQNYSEFNQFPDNRQANPTWQTDYKDESIMDRRSYGDVSNMNRSNQAPNYDQYGGTRNVMQGSSTRGKPLEKIPNQYDRKPVTAXXXXXXXXXXXXXXXXVESYSTDDYSYGTNKGYEGSSTKFGAKSYGDQSTGSYKEPLRSDTAPFGNPKPARGGYSRFGDAQKPHVAEVKPETGRGDYSSMQQPNSVPXXXXXXXXXXXXXXXXXXXXXTGDSGKDQSTAVGVGAQTYQASNPSSNRAPXXXXXXXXXXXXXXXXXXXXXXXXXXXNPPTGIVXXXXXXXXXXXXNTSNYSTNPASSVGGGYQANYPSTGTAAAGGYNTSNYPSANPSTAAPYQSAYPSSNPTSGSGGYTNPXXXXXXXXXXXXXXXXGQTNTYAQSGSYGDNTVASKYPDFSSKPPLDRAMXXXXXXXXXXXXXXXXXXXXXXXXXSWGT 3823
            MNYVELKVSELREECKIRNLDTTGLKVHLVDRLNTYDKNQLLKSKVESKTSTKVTEQSKENT+EESTASQNDPIDSNANQSNISENGSLHFNDVDLDKSPVMDKPTKNKTMSFESNIKDYSKDNMYKLASCEHENWESRTDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVL+PHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDINSDGKSKRDVADESYGKWNSSPKSSEEAGPTAPKKSRWNDQSDNRKDSKSRDRHDRSSPESSSLPRKNDYKGGFCFSREASDNSKGGSRTSDGGFRSDSRHGDKSRDQRDRSGNRSINPPYRKPIETNDRRPKFDRDEPRFGNRNPMQGNRDSRPRDRGSESRGAGQFQGRERSRGNFNDRRQSDSYDNVDSRNKFPSGNYNDRNTGMGGNSNFGNQERGRFPMGGTQPERGDFRGRGRGGP GNNMGKDSFMDRRNAVPDNRDYQNYSEFNQFPDNRQANPTWQTDYKDESIMDRRSYGDV NMNRSNQAPNYDQYGGTRNVMQGSS RGKPLEKIPNQYDRKPVTARGGLNSRGGGRGGFSSVESYSTDDYSYGTNKGYEGS+TKFGAKSYGDQSTGSYKEPLRSDTAPFGNPKPARGGYSRFGDAQKPHVAEVKPETGRGDYSSMQQPNSVPYDNYQSYDNSQYQNQGYYNYYTGDSGKDQSTAVGVGAQTYQASNPSSNRAPYQYQSSNTAAAAASSGSNYQSSVNSASNPPTGIVGGGGYQSSPYGSNTSNYSTNPASSVGGGYQANYPS GTAAAGGYNTSNYPSANPSTAAPYQSAYPSSNPTSGSGGYTNPYSAIYDSTSSYDSSYYGQTNTYAQSGSYGDNTVASKYPDFSSKPPLDRAMPP VAAAAAT AAVPPQAPANQNQASWGT
Sbjct:    1 MNYVELKVSELREECKIRNLDTTGLKVHLVDRLNTYDKNQLLKSKVESKTSTKVTEQSKENTIEESTASQNDPIDSNANQSNISENGSLHFNDVDLDKSPVMDKPTKNKTMSFESNIKDYSKDNMYKLASCEHENWESRTDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLMPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQRTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINNVLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTNCYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAVLQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDINSDGKSKRDVADESYGKWNSSPKSSEEAGPTAPKKSRWNDQSDNRKDSKSRDRHDRSSPESSSLPRKNDYKGGFCFSREASDNSKGGSRTSDGGFRSDSRHGDKSRDQRDRSGNRSINPPYRKPIETNDRRPKFDRDEPRFGNRNPMQGNRDSRPRDRGSESRGAGQFQGRERSRGNFNDRRQSDSYDNVDSRNKFPSGNYNDRNTGMGGNSNFGNQERGRFPMGGTQPERGDFRGRGRGGPAGNNMGKDSFMDRRNAVPDNRDYQNYSEFNQFPDNRQANPTWQTDYKDESIMDRRSYGDVPNMNRSNQAPNYDQYGGTRNVMQGSSARGKPLEKIPNQYDRKPVTARGGLNSRGGGRGGFSSVESYSTDDYSYGTNKGYEGSTTKFGAKSYGDQSTGSYKEPLRSDTAPFGNPKPARGGYSRFGDAQKPHVAEVKPETGRGDYSSMQQPNSVPYDNYQSYDNSQYQNQGYYNYYTGDSGKDQSTAVGVGAQTYQASNPSSNRAPYQYQSSNTAAAAASSGSNYQSSVNSASNPPTGIVGGGGYQSSPYGSNTSNYSTNPASSVGGGYQANYPSAGTAAAGGYNTSNYPSANPSTAAPYQSAYPSSNPTSGSGGYTNPYSAIYDSTSSYDSSYYGQTNTYAQSGSYGDNTVASKYPDFSSKPPLDRAMPPSVAAAAATAAAVPPQAPANQNQASWGT 1245          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Planmine SMEST
Match: SMESG000019493.1 (SMESG000019493.1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.708e-10
Identity = 67/264 (25.38%), Postives = 118/264 (44.70%), Query Frame = 2
Query:  338 SENGSLHFNDVDLDKSPVMDKPTKNKTMSFESNIKDYSKDNMYKLASCEHENWESRTDVHLDFYNSD--MNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKS-GKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLG--EFGLSYGYDSMGK---------TVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPI 1087
            S+NG+     V L+ S +      N+  S + NI+  +++ + K    + E   +  ++H     +D  ++L + + GL V      G+Q    G + N GVK+ G+ ++E ++L            +   +R+GWS ++  L +G  E G  YG D +G+         T+ D    DYGS     D +GC +  N   +V  +  NG+  G  ++I    L+   + P + VK+   E NFG +    F  P +  E   P+
Sbjct:  451 SKNGTASKKGVVLNNSSI----ESNENHSTQLNIQKPNQNKISKTPLTDTER-PTLPNLHWRMSPADCTLSLGMDDKGLDVASQPGTGWQ----GCRSNKGVKTPGEYFYEARVL------------EDGLVRLGWSTNDASLKVGSDENGYGYGADEVGRGWGENVKGCTMHDSKIKDYGSGLFMGDYVGCRVNLNNGDVV--WYKNGESMGVGYKI-PEQLRKEPMFPTLSVKDGRIEFNFGDS---PFVYPPSDSETWIPV 687          

HSP 2 Score: 59.6918 bits (143), Expect = 1.830e-8
Identity = 56/194 (28.87%), Postives = 84/194 (43.30%), Query Frame = 2
Query:  482 EHENWESRTDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKS-GKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLG--EFGLSYGYD--------SMGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRI-LSRDLKDHVLIPHIYVKNVCFEVNFG 1027
            +H  W+      L+ Y++   + IS  GL+        +Q    G + N GVK  GK Y+EV  L+                R+GWS +   L LG  + G  YG D        + GK + + +  +YG    + DVIGCFL+   D   + +S+NG+    A+ I L          P + +KN   E NFG
Sbjct:  699 KHIGWK------LNAYDATKLIDISAEGLMAQSQMNAEWQ----GSRCNKGVKGRGKYYYEVSPLE-----------SGGLARVGWSTEAGSLDLGTDKCGFGYGADPDGFGLSGNQGKKMFNNDIENYGKSFNKGDVIGCFLDL--DEGKVQWSLNGEIYAPAYDIPLELRNGPSAFFPAVSLKNNTAEFNFG 869          
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Planmine SMEST
Match: SMESG000062476.1 (SMESG000062476.1)

HSP 1 Score: 62.003 bits (149), Expect = 3.343e-9
Identity = 59/201 (29.35%), Postives = 85/201 (42.29%), Query Frame = 2
Query:  449 SKDNMYKLASCEHENWESRTDVHLDFYNSDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKS-GKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNF-------SDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLIPHIYVKNVCFEVNFG 1027
            S DN  +      E W+   D      +S   + I   GL V      G+Q    G + N GVK  GK Y+E K++            +   IR+GW+ ++  L LG     +GY        +G F       + YG    E D+IGCFL+F+  +I   +S NG     AF+I   +LKD    P   +K+     NFG
Sbjct:  452 SLDNAIERPELLEEYWQMSID------DSTPEMGIDPLGLDVAGNKGSGWQ----GSRANKGVKGPGKYYYEGKVV------------EDGLIRLGWATNDASLDLGSDKEGFGYGDSQAGDKNGGFKRNCNKENGYGQPIKEGDLIGCFLDFDNGNI--QWSKNGATFEPAFKI-PDELKDEAFFPASSIKDGRVIFNFG 627          

HSP 2 Score: 56.9954 bits (136), Expect = 1.172e-7
Identity = 45/157 (28.66%), Postives = 70/157 (44.59%), Query Frame = 2
Query:  614 GVKGNYGV-KSGKVYFEVKILKKFKVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDS----------MGKTVSDGNFSDYGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKD-HVLIPHIYVKNVCFEVNFGSTNIDAF 1048
            G + N GV   GK Y+EV  L            +    R+GW+ D+  L+LG  G  +GY +           GK ++ G   +YG    + DVIGCFL+   D+  + +S NG    E + +L  DL +     P   + N   + NFG+   + +
Sbjct:  688 GCRANKGVFDCGKYYYEVIPL------------EDGLARVGWATDDGSLNLGSDGSGFGYGADNDGFGLKGNQGKKMNSGEIDNYGDPFMKGDVIGCFLDL--DNKYVKWSKNGQVYKEGY-VLPDDLVELRAFYPTASLINNTLDFNFGNKPFEFY 829          
The following BLAST results are available for this feature:
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPUL12.821e-10644.55heterogeneous nuclear ribonucleoprotein U like 1 [... [more]
HNRNPUL11.756e-10544.55heterogeneous nuclear ribonucleoprotein U like 1 [... [more]
HNRNPUL11.769e-10544.55heterogeneous nuclear ribonucleoprotein U like 1 [... [more]
HNRNPUL12.013e-10544.55heterogeneous nuclear ribonucleoprotein U like 1 [... [more]
HNRNPUL12.013e-10544.55heterogeneous nuclear ribonucleoprotein U like 1 [... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrpu-11.069e-4931.17Heterogeneous nuclear RibonucleoProtein U [Source... [more]
hrpu-11.069e-4931.17Heterogeneous nuclear RibonucleoProtein U [Source... [more]
hrpu-12.620e-4931.17Heterogeneous nuclear RibonucleoProtein U [Source... [more]
hrpu-12.620e-4931.17Heterogeneous nuclear RibonucleoProtein U [Source... [more]
hrpu-11.071e-4431.34Heterogeneous nuclear RibonucleoProtein U [Source... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG301225.112e-3736.82gene:FBgn0050122 transcript:FBtr0086660[more]
CG301225.381e-3736.82gene:FBgn0050122 transcript:FBtr0300924[more]
CG301225.386e-3736.82gene:FBgn0050122 transcript:FBtr0300923[more]
Ddx11.297e-1129.71gene:FBgn0015075 transcript:FBtr0078492[more]
RyR1.903e-634.91gene:FBgn0011286 transcript:FBtr0088638[more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpul11.144e-10744.20heterogeneous nuclear ribonucleoprotein U-like 1 [... [more]
hnrnpul1l2.895e-10443.78heterogeneous nuclear ribonucleoprotein U-like 1 l... [more]
hnrnpub2.095e-8540.35heterogeneous nuclear ribonucleoprotein Ub [Source... [more]
hnrnpua4.094e-8036.19heterogeneous nuclear ribonucleoprotein Ua [Source... [more]
si:ch211-107m4.11.916e-7436.97si:ch211-107m4.1 [Source:ZFIN;Acc:ZDB-GENE-081107-... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPUL13.045e-11146.65heterogeneous nuclear ribonucleoprotein U-like 1 [... [more]
HNRNPUL15.077e-11146.65heterogeneous nuclear ribonucleoprotein U-like 1 [... [more]
HNRNPUL11.508e-11046.65heterogeneous nuclear ribonucleoprotein U-like 1 [... [more]
HNRNPUL12.866e-10946.65heterogeneous nuclear ribonucleoprotein U-like 1 [... [more]
hnrnpu2.665e-8540.49heterogeneous nuclear ribonucleoprotein U (scaffol... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnrnpul11.306e-10544.55heterogeneous nuclear ribonucleoprotein U-like 1 [... [more]
Hnrnpul18.445e-10544.55heterogeneous nuclear ribonucleoprotein U-like 1 [... [more]
Hnrnpu1.349e-8841.44heterogeneous nuclear ribonucleoprotein U [Source:... [more]
Hnrnpu1.349e-8841.44heterogeneous nuclear ribonucleoprotein U [Source:... [more]
Hnrnpu1.446e-8841.44heterogeneous nuclear ribonucleoprotein U [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BUJ2|HNRL1_HUMAN4.436e-10444.55Heterogeneous nuclear ribonucleoprotein U-like pro... [more]
sp|Q8VDM6|HNRL1_MOUSE5.907e-10444.55Heterogeneous nuclear ribonucleoprotein U-like pro... [more]
sp|Q6IMY8|HNRPU_RAT7.898e-8841.44Heterogeneous nuclear ribonucleoprotein U OS=Rattu... [more]
sp|Q8VEK3|HNRPU_MOUSE9.436e-8841.44Heterogeneous nuclear ribonucleoprotein U OS=Mus m... [more]
sp|Q00839|HNRPU_HUMAN1.342e-8740.69Heterogeneous nuclear ribonucleoprotein U OS=Homo ... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YDI91.720e-12849.07Uncharacterized protein (Fragment) OS=Hymenolepis ... [more]
A0A068Y5161.316e-12148.70E1b 55 kDa associated protein OS=Echinococcus mult... [more]
A0A5K3EWF62.811e-12149.77Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PRJ53.436e-12047.98Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A068WGV46.157e-12047.99E1b 55 kDa associated protein OS=Echinococcus gran... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000004746.22.614e-10342.82pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
HNRNPUL11.197e-10243.78heterogeneous nuclear ribonucleoprotein U like 1 [... [more]
si:ch211-107m4.13.233e-7936.63heterogeneous nuclear ribonucleoprotein U-like pro... [more]
si:ch211-107m4.13.546e-7636.39heterogeneous nuclear ribonucleoprotein U-like pro... [more]
si:ch211-107m4.13.546e-7636.39heterogeneous nuclear ribonucleoprotein U-like pro... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
HNRNPUL13.900e-10744.91heterogeneous nuclear ribonucleoprotein U like 1 [... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348735.138e-8537.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330571.127e-8240.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375642.392e-5242.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO285594.079e-1039.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472874.590e-731.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPUL17.205e-10843.78heterogeneous nuclear ribonucleoprotein U like 1 [... [more]
hnrnpub4.945e-8036.48heterogeneous nuclear ribonucleoprotein U [Source:... [more]
si:ch211-107m4.12.074e-6829.05heterogeneous nuclear ribonucleoprotein U-like pro... [more]
si:ch211-107m4.12.530e-6829.30heterogeneous nuclear ribonucleoprotein U-like pro... [more]
si:ch211-107m4.12.683e-6829.30heterogeneous nuclear ribonucleoprotein U-like pro... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein U-like 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000033768.10.000e+099.28SMESG000033768.1[more]
SMESG000033768.10.000e+099.28SMESG000033768.1[more]
SMESG000019493.11.708e-1025.38SMESG000019493.1[more]
SMESG000062476.13.343e-929.35SMESG000062476.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012216 ID=SMED30012216|Name=Heterogeneous nuclear ribonucleoprotein U-like 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3952bp
TCTAATTTCACCTTGTTTAAATGATATTCTAATTGTTTTAATTTCTTATT
AATATTAGTAAACAAAACTTATTAAACAAAAAATGTCCATGAATTATGTA
GAGTTAAAAGTTTCAGAATTGCGCGAAGAATGCAAAATAAGAAATTTGGA
TACTACCGGTTTAAAAGTGCATTTGGTTGATAGATTAAATACATATGATA
AAAACCAGCTCCTTAAAAGCAAAGTTGAAAGTAAAACTTCTACAAAGGTC
ACTGAACAAAGTAAAGAAAATACCGTTGAAGAATCGACAGCTAGTCAAAA
CGATCCAATTGATTCAAATGCTAATCAGTCGAATATTTCTGAAAATGGAT
CTTTACATTTCAATGATGTGGATTTAGATAAGTCACCTGTAATGGATAAG
CCTACCAAAAATAAAACCATGTCATTTGAATCCAATATCAAAGATTACAG
TAAAGACAATATGTACAAGCTAGCTTCTTGTGAACATGAGAATTGGGAAA
GTCGTACTGATGTGCATTTAGATTTTTACAACAGTGACATGAATTTGGTT
ATCAGTGAAAATGGTTTATTAGTAATACCGTTATGTGAGGATGGATTCCA
ATATGTATGTGGTGGTGTTAAAGGAAATTATGGTGTTAAAAGTGGAAAAG
TTTATTTTGAAGTAAAAATTCTGAAAAAATTCAAAGTCGAATTAAACAGT
GATGCTGGAGATTCTAATTTTATTCGCATTGGATGGTCAGCAGATAATGA
ACCACTGTCACTAGGAGAATTTGGGTTATCTTACGGGTATGATTCCATGG
GTAAAACGGTAAGCGATGGAAATTTTTCTGATTATGGTTCCAAATCAGGC
GAGGATGATGTTATTGGCTGCTTTTTGGAATTTAATGGTGACAGTATTGT
ATTAAGTTTTTCAATTAACGGGGATGATCAAGGAGAAGCATTTAGAATTT
TAAGTAGAGATTTGAAGGATCATGTATTGATACCTCATATATATGTTAAA
AATGTATGTTTTGAAGTAAACTTCGGATCTACAAATATAGATGCTTTTTG
TTCACCAAAAACAAAAATTGAGGGTTCTGAGCCAATAGAAGATGTTACAT
GGACCTTATTAGGAAAAGTTAATTTGAATCAAAGGACAAGATCTTTAAAA
CCTCCTAAAATCAAAACTGAATGTGAAGTTTTAATGATGTGTGGATTACC
AAGTTGCGGTAAAACTACCTGGACAGAGCAACAAATTAAAGAACATCCCG
ACAAAAGATACAATTTATTAAGCATTAACAATGTTTTAGAAAAAATGAAA
GTGTGCAATTTGAGGAAAAAAGTTAATGCAAGTAGATGGGATTCCTTTAT
TTTGTCAGCAACTCAATGTCTCAATAAATTTATGGAAATTGCTGTTTCAA
GACGAAGAAATTTTATTTTAGATCAGACAAATTGTTACCCAACGGCTCAA
CGCCGTAGAATGAAGCCATTTGAAGAATTCATACGAAAAGCAATTATAGT
TGTGCCAACTGATGATGAATATCAAAGACGCATGAATCAAGTTATTCAAG
AGGAAGGCAAAGATGTACCAGAGAGTGCAGTACTACAAATGAAAGAAAAT
TTCGTGATTCCTGAAGAAAACAGCGATCTATTTAATGAGATTATTTTCAT
CGAATTGCAAAGAAATGAAGCTGAAGAATTAGTTAAAAAGTATAATGAAG
AAGCGAAAAATCAAAAGAAAAAAGATATTAATTCCGATGGAAAAAGTAAA
CGTGATGTAGCCGATGAAAGCTATGGAAAATGGAATTCATCTCCGAAGTC
CAGTGAAGAAGCCGGTCCGACGGCCCCAAAAAAATCTAGATGGAATGATC
AGTCTGATAATAGGAAAGACTCCAAAAGCAGAGATAGGCATGATCGTTCA
TCTCCAGAATCGTCATCGCTCCCACGGAAAAATGATTATAAAGGAGGATT
TTGTTTTTCAAGAGAAGCGTCCGACAATAGTAAAGGTGGCTCGCGAACTA
GTGATGGAGGATTCAGATCTGATAGTAGACATGGGGATAAATCAAGGGAT
CAGAGAGACAGATCAGGCAACCGATCAATAAATCCTCCTTATCGTAAACC
GATCGAAACCAATGATAGAAGACCAAAATTTGATAGAGATGAACCGAGGT
TTGGAAATAGAAATCCAATGCAAGGTAATCGTGATAGCAGACCTAGAGAT
CGTGGGAGCGAATCGAGAGGTGCTGGCCAATTTCAAGGTAGAGAAAGATC
TAGAGGAAACTTCAATGATCGACGACAATCGGATTCTTATGATAATGTTG
ATAGTCGTAATAAATTTCCCTCGGGTAATTATAATGATCGGAACACTGGA
ATGGGAGGAAATTCTAATTTTGGAAATCAAGAGCGAGGAAGGTTTCCAAT
GGGTGGTACACAACCTGAAAGAGGTGATTTCAGGGGTAGAGGACGTGGTG
GACCGACAGGAAATAATATGGGAAAAGATTCATTTATGGATCGCCGCAAT
GCTGTTCCTGACAATCGAGACTATCAGAACTACTCGGAATTTAATCAGTT
TCCCGATAATCGACAAGCCAATCCTACTTGGCAAACGGATTACAAAGATG
AATCGATAATGGATAGAAGGAGTTACGGTGATGTATCTAATATGAATCGA
TCAAATCAAGCTCCTAATTATGATCAATATGGTGGTACAAGAAACGTAAT
GCAAGGAAGCAGTACTCGTGGAAAACCATTGGAAAAAATTCCTAATCAAT
ATGATAGGAAACCGGTTACTGCTCGTGGCGGACTAAACAGTCGGGGTGGG
GGACGCGGAGGATTTTCTTCTGTGGAGAGTTATTCGACCGATGATTACTC
ATATGGAACAAATAAAGGCTACGAAGGATCTAGCACTAAATTCGGTGCCA
AATCATATGGTGATCAATCTACTGGATCATACAAAGAACCACTCAGATCC
GACACCGCGCCATTCGGTAATCCAAAACCAGCTAGGGGGGGATATTCTAG
ATTTGGCGATGCTCAGAAACCCCACGTTGCTGAAGTCAAACCGGAAACTG
GCAGGGGAGATTATTCCAGCATGCAGCAACCTAATTCAGTCCCATACGAC
AATTACCAATCATACGACAACTCTCAATATCAGAATCAAGGCTATTATAA
TTACTATACGGGGGATTCAGGAAAGGACCAATCAACTGCTGTCGGAGTAG
GAGCGCAAACTTACCAAGCTAGTAATCCATCATCTAATCGGGCTCCATAT
CAATATCAATCGAGTAATACTGCAGCTGCTGCAGCATCGTCGGGATCAAA
TTATCAATCATCGGTAAATTCTGCATCAAACCCACCAACAGGAATTGTTG
GTGGTGGTGGGTATCAATCATCTCCCTACGGATCAAATACGTCCAATTAT
TCCACAAATCCAGCGTCTTCTGTCGGGGGTGGCTACCAAGCTAATTATCC
TTCAACTGGGACAGCAGCGGCAGGGGGTTACAACACCTCGAATTACCCAT
CAGCAAATCCATCTACCGCTGCACCTTACCAATCGGCTTATCCCTCATCT
AATCCGACAAGTGGAAGTGGTGGTTATACAAATCCATATAGTGCAATTTA
TGACAGTACTAGCAGTTATGATTCAAGTTATTATGGGCAAACCAATACAT
ATGCCCAATCAGGATCTTATGGTGACAACACGGTAGCCTCGAAATACCCC
GATTTCTCTTCGAAACCCCCATTGGACAGGGCTATGCCACCACCAGTTGC
GGCTGCGGCGGCAACAACTGCTGCAGTGCCTCCACAAGCACCAGCCAATC
AAAATCAAGCCAGTTGGGGTACTGGATATGGAGATTATCCTCAGTACTAT
GGTCAATATTATGGTCAATAATTACAACATGATTGATGTGGAATGATTAT
TGTATTTATTGTTTTAGTGTTCATTATAGTTTATTGCTTTTTAAAATACA
AT
back to top

protein sequence of SMED30012216-orf-1

>SMED30012216-orf-1 ID=SMED30012216-orf-1|Name=SMED30012216-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1263bp
MSMNYVELKVSELREECKIRNLDTTGLKVHLVDRLNTYDKNQLLKSKVES
KTSTKVTEQSKENTVEESTASQNDPIDSNANQSNISENGSLHFNDVDLDK
SPVMDKPTKNKTMSFESNIKDYSKDNMYKLASCEHENWESRTDVHLDFYN
SDMNLVISENGLLVIPLCEDGFQYVCGGVKGNYGVKSGKVYFEVKILKKF
KVELNSDAGDSNFIRIGWSADNEPLSLGEFGLSYGYDSMGKTVSDGNFSD
YGSKSGEDDVIGCFLEFNGDSIVLSFSINGDDQGEAFRILSRDLKDHVLI
PHIYVKNVCFEVNFGSTNIDAFCSPKTKIEGSEPIEDVTWTLLGKVNLNQ
RTRSLKPPKIKTECEVLMMCGLPSCGKTTWTEQQIKEHPDKRYNLLSINN
VLEKMKVCNLRKKVNASRWDSFILSATQCLNKFMEIAVSRRRNFILDQTN
CYPTAQRRRMKPFEEFIRKAIIVVPTDDEYQRRMNQVIQEEGKDVPESAV
LQMKENFVIPEENSDLFNEIIFIELQRNEAEELVKKYNEEAKNQKKKDIN
SDGKSKRDVADESYGKWNSSPKSSEEAGPTAPKKSRWNDQSDNRKDSKSR
DRHDRSSPESSSLPRKNDYKGGFCFSREASDNSKGGSRTSDGGFRSDSRH
GDKSRDQRDRSGNRSINPPYRKPIETNDRRPKFDRDEPRFGNRNPMQGNR
DSRPRDRGSESRGAGQFQGRERSRGNFNDRRQSDSYDNVDSRNKFPSGNY
NDRNTGMGGNSNFGNQERGRFPMGGTQPERGDFRGRGRGGPTGNNMGKDS
FMDRRNAVPDNRDYQNYSEFNQFPDNRQANPTWQTDYKDESIMDRRSYGD
VSNMNRSNQAPNYDQYGGTRNVMQGSSTRGKPLEKIPNQYDRKPVTARGG
LNSRGGGRGGFSSVESYSTDDYSYGTNKGYEGSSTKFGAKSYGDQSTGSY
KEPLRSDTAPFGNPKPARGGYSRFGDAQKPHVAEVKPETGRGDYSSMQQP
NSVPYDNYQSYDNSQYQNQGYYNYYTGDSGKDQSTAVGVGAQTYQASNPS
SNRAPYQYQSSNTAAAAASSGSNYQSSVNSASNPPTGIVGGGGYQSSPYG
SNTSNYSTNPASSVGGGYQANYPSTGTAAAGGYNTSNYPSANPSTAAPYQ
SAYPSSNPTSGSGGYTNPYSAIYDSTSSYDSSYYGQTNTYAQSGSYGDNT
VASKYPDFSSKPPLDRAMPPPVAAAAATTAAVPPQAPANQNQASWGTGYG
DYPQYYGQYYGQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
GO:0009615response to virus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036361SAP_dom_sf
IPR043136B30.2/SPRY_sf
IPR035778SPRY_hnRNP_U
IPR003877SPRY_dom
IPR003034SAP_dom
IPR027417P-loop_NTPase
IPR001870B30.2/SPRY
IPR013320ConA-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0019013viral nucleocapsid
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 520..547
NoneNo IPR availablePFAMPF13671AAA_33coord: 366..509
e-value: 2.2E-21
score: 76.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 346..540
e-value: 6.1E-22
score: 80.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 541..563
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 63..78
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 541..794
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 723..738
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 942..999
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 878..909
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 739..767
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 643..662
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 50..78
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 587..611
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 673..691
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1045..1081
NoneNo IPR availablePANTHERPTHR12381RIBONUCLEOPROTEINcoord: 1..708
IPR003034SAP domainSMARTSM00513sap_9coord: 5..39
e-value: 8.3E-8
score: 41.9
IPR003034SAP domainPFAMPF02037SAPcoord: 8..39
e-value: 1.7E-9
score: 37.2
IPR003034SAP domainPROSITEPS50800SAPcoord: 5..39
score: 10.925
IPR036361SAP domain superfamilyGENE3DG3DSA:1.10.720.30coord: 1..54
e-value: 5.8E-11
score: 43.8
IPR036361SAP domain superfamilySUPERFAMILYSSF68906SAP domaincoord: 3..40
IPR043136B30.2/SPRY domain superfamilyGENE3DG3DSA:2.60.120.920coord: 141..341
e-value: 1.5E-39
score: 137.7
IPR003877SPRY domainPFAMPF00622SPRYcoord: 189..315
e-value: 6.0E-13
score: 49.0
IPR001870B30.2/SPRY domainPROSITEPS50188B302_SPRYcoord: 124..319
score: 12.964
IPR035778Heterogeneous nuclear ribonucleoprotein U, SPRY domainCDDcd12884SPRY_hnRNPcoord: 144..315
e-value: 1.11245E-64
score: 214.76
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 136..316
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 362..542