NADH dehydrogenase subunit 1

Overview
NameNADH dehydrogenase subunit 1 (YP_008592433.1)
Smed IDSMED30012212
Length (bp)891
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NADH dehydrogenase subunit 1 (SMED30012212) t-SNE clustered cells

Violin plots show distribution of expression levels for NADH dehydrogenase subunit 1 (SMED30012212) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NADH dehydrogenase subunit 1 (SMED30012212) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NADH dehydrogenase subunit 1 (SMED30012212) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012212

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30012212 Contig28632uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012212 Contig28632newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012212 Contig30634uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012212 Contig30634newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012212 Contig26072uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012212 Contig26072newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30012212 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30012212 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012212 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012212 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012212 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012212 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30012212 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012212 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012212 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012212 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012212 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012212 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012212 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012212 Contig28632uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30012212 Contig28632uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30012212 Contig28632newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30012212 Contig28632newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Human
Match: MT-ND1 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 1 [Source:HGNC Symbol;Acc:HGNC:7455])

HSP 1 Score: 155.992 bits (393), Expect = 7.771e-45
Identity = 106/276 (38.41%), Postives = 161/276 (58.33%), Query Frame = 1
Query:   43 CVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXXS--YSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFN--------MVGGILISFRFILFRSTFPRFRYDLLMNLAWK 840
             + ++ + ERKI+ Y+Q RKGPN VG  GL   FADA+KL  K     + S+  L+  +P L + I   +   LP+    V  +LG L  L  + L V+S+L SGW+ NS Y L+G++R  +Q ISYE  L ++L+  L +S  ++LS L+      W LL  +PL++++ +  LAET R+PFD +EGESELVSGFN EY +  FA  F+ EY  I+ +  +   ++  T+    +        +   +L++  F+  R+ +PRFRYD LM+L WK
Sbjct:   16 AMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEPLKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWK 291          
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Celegans
Match: nduo-1 (pep chromosome:WBcel235:MtDNA:1763:2635:1 gene:WBGene00010959.1 transcript:MTCE.11.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:nduo-1)

HSP 1 Score: 131.339 bits (329), Expect = 3.538e-36
Identity = 96/265 (36.23%), Postives = 148/265 (55.85%), Query Frame = 1
Query:   46 VIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXXSYSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFF-FNMVGGILISFRFILFRSTFPRFRYDLLMNLAW 837
            + +IT+ ER ++   Q R GP KV F+GLA A  D +KLL K       SS + F   P ++  +++     LP    ++      L +LC    +V++ L SG    SKY ++G+IR +SQ ISYE    L ++  +  +   +F+        + L    + + FL++ +AE  R+PFDFSEGESELVSGFN E+ S+ F  LFL EYG ++F  ++      S+++FF F++     I    I  RS++PR+RYDL+M+L W
Sbjct:   19 IAFITLYERHLLGSSQNRLGPTKVTFMGLAQALLDGVKLLKKEQMTPLNSSEVSFLLVPGISFVVMYLEWFTLPYFFDFISFEYSVLFFLCLIGFSVYTTLISGIVSKSKYGMIGAIRASSQSISYEIAFSLYVLCIIIHNNVFNFV------SKFNLSLLIIYIPFLIMVIAELNRAPFDFSEGESELVSGFNVEFASVAFVLLFLSEYGSLIFFSVL------SSAMFFKFSIFMAFSIFSLLIFIRSSYPRYRYDLMMSLFW 271          
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Fly
Match: mt:ND1 (gene:FBgn0013679 transcript:FBtr0433499)

HSP 1 Score: 178.718 bits (452), Expect = 4.757e-54
Identity = 117/274 (42.70%), Postives = 175/274 (63.87%), Query Frame = 1
Query:   34 MLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXX--SYSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFNMV---GGILISFRFILFRSTFPRFRYDLLMNLAWK 840
            +LV V ++T+LERK++ YIQ RKGPNKVG +G+   F DA+KL  K      +S+ L +  SP+ ++++  FV   +P        +LG L +LC   L V++V+ +GWS NS Y LLG +R  +Q ISYE  L L+L+  + L  SY++ +  +     W+L++ FP++++++ + LAET R+PFDF+EGESELVSGFN EY S  FA +F+ EY  I+F+ +++ +++    +  FN++       ISF FI  R T PRFRYD LM LAWK
Sbjct:   17 VLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYISPIFSLFLSLFVWMCMPFFVKLYSFNLGGLFFLCCTSLGVYTVMVAGWSSNSNYALLGGLRAVAQTISYEVSLALILLSFIFLIGSYNMIYFFFYQVYMWFLIILFPMALVWMSISLAETNRTPFDFAEGESELVSGFNVEYSSGGFALIFMAEYASILFMSMLFCVIFLGCDV--FNLLFYMKLTFISFVFIWVRGTLPRFRYDKLMYLAWK 288          
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Zebrafish
Match: mt-nd1 (NADH dehydrogenase subunit 1 [Source:NCBI gene;Acc:140531])

HSP 1 Score: 158.303 bits (399), Expect = 6.332e-46
Identity = 107/281 (38.08%), Postives = 166/281 (59.07%), Query Frame = 1
Query:   28 VSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXXS--YSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTS--------IFFFNMVGGILISFRFILFRSTFPRFRYDLLMNLAWK 840
            V +L+ V ++T++ERK++ Y+Q RKGPN +G  GL  + AD +KL +K     S++S +LF  +P+L + +   +   +P+    +  +LG L  +  + L V+S+LGSGW+ NSKY L+G++R  +Q ISYE  L L+L+  +  S  Y+L          W LL  +PL++++ +  LAET R+PFD +EGESELVSGFN EY +  FA  FL EY  I+ +     +L+   S        +         ++S  F+  R+++PRFRYD LM+L WK
Sbjct:   17 VPVLIAVAFLTLVERKVLGYMQLRKGPNVMGPRGLLQSVADGVKLFIKEPIRPSMASPILFLTAPVLALILAMMLWAPMPMPYPVLDLNLGILFIMAISSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLSAVIFSGGYTLQTFNTTQEDTWLLLPLWPLAIMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYSNILLMNTHSTVLFLGASFTPDAPELMTISIATKTAMLSILFLWMRASYPRFRYDQLMHLIWK 297          
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Xenopus
Match: e2f1 (E2F transcription factor 1 [Source:Xenbase;Acc:XB-GENE-481741])

HSP 1 Score: 163.31 bits (412), Expect = 1.090e-47
Identity = 107/280 (38.21%), Postives = 163/280 (58.21%), Query Frame = 1
Query:   28 VSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXXS--YSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFNMVGGILISFR-------FILFRSTFPRFRYDLLMNLAWK 840
            V +L+ V ++T++ERK++ Y+Q RKGPN VG +GL    AD +KL VK     S SS+ LF  +P +   +   +   +P+       +LG L  L  + L V+++LGSGWS NSKY L+G++R  +Q ISYE  L L+L+  + L+  ++L          W ++  +P++ ++ +  LAET R+PFD +EGESELVSGFN EY    F   FL EY  I+ +  +  +L+  +S      +  I I F+       F+  R+++PRFRYD LM+L WK
Sbjct:   16 VPILLAVAFLTLIERKVLGYMQHRKGPNIVGPMGLLQPIADGVKLFVKEPIRPSTSSQALFLLAPTMAFALAMSIWAPIPMPFSLADLNLGILFILALSSLTVYTILGSGWSSNSKYALIGALRAVAQTISYEVTLGLILLCMIMLTGGFTLFNFNTTQEHMWLVIPGWPMAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFVLFFLAEYANILMMNTLSTILFLGSSFIDTPELTTISIMFKASLLSLLFLWVRASYPRFRYDQLMHLVWK 295          
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Mouse
Match: mt-Nd1 (mitochondrially encoded NADH dehydrogenase 1 [Source:MGI Symbol;Acc:MGI:101787])

HSP 1 Score: 174.866 bits (442), Expect = 2.579e-52
Identity = 109/282 (38.65%), Postives = 173/282 (61.35%), Query Frame = 1
Query:   28 VSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXX--SYSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFN---------MVGGILISFRFILFRSTFPRFRYDLLMNLAWK 840
            V +L+ + ++T++ERKI+ Y+Q RKGPN VG  G+   FADA+KL +K       +S  LF  +P L++ +   +   LP+    +  +LG L  L  + L+V+S+L SGW+ NSKY+L G++R  +Q ISYE  + ++L+  L +  SYSL  L+      W LL  +P+++++ +  LAET R+PFD +EGESELVSGFN EY +  FA  F+ EY  I+ +  +  +++    +++ N         M+  +L+S  F+  R+++PRFRYD LM+L WK
Sbjct:   11 VPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEPMRPLTTSMSLFIIAPTLSLTLALSLWVPLPMPHPLINLNLGILFILATSSLSVYSILWSGWASNSKYSLFGALRAVAQTISYEVTMAIILLSVLLMNGSYSLQTLITTQEHMWLLLPAWPMAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIILMNALTTIIFLG-PLYYINLPELYSTNFMMEALLLSSTFLWIRASYPRFRYDQLMHLLWK 291          
BLAST of NADH dehydrogenase subunit 1 vs. UniProt/SwissProt
Match: sp|P51937|NU1M_DROSU (NADH-ubiquinone oxidoreductase chain 1 OS=Drosophila subobscura OX=7241 GN=mt:ND1 PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 4.695e-54
Identity = 120/274 (43.80%), Postives = 175/274 (63.87%), Query Frame = 1
Query:   34 MLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXX--SYSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFNM---VGGILISFRFILFRSTFPRFRYDLLMNLAWK 840
            +LV V ++T+LERK++ YIQ RKGPNKVG +G+   F DA+KL  K      +S+ L +  SP+ ++++  FV   +P        +LG L +LC   L V++V+ +GWS NS Y LLG +R  +Q ISYE  L L+L+  + L  SY++ +  Y     W+L++ FP+++++L + LAET R+PFDF+EGESELVSGFN EY S  FA +F+ EY  I+F+ +++ +++    +  FN+   V    ISF FI  R T PRFRYD LM LAWK
Sbjct:   17 VLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYISPIFSLFLSLFVWMCMPFFVKLYSFNLGGLFFLCCTSLGVYTVMVAGWSSNSNYALLGGLRAVAQTISYEVSLALILLSFVFLIGSYNMVYFFYYQIYVWFLIILFPMALVWLTISLAETNRTPFDFAEGESELVSGFNVEYSSGGFALIFMAEYASILFMSMLFCVIFLGCDV--FNLLFYVKLTFISFIFIWARGTLPRFRYDKLMYLAWK 288          
BLAST of NADH dehydrogenase subunit 1 vs. UniProt/SwissProt
Match: sp|B0FWD8|NU1M_AEDAE (NADH-ubiquinone oxidoreductase chain 1 OS=Aedes aegypti OX=7159 GN=mt:ND1 PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 4.929e-54
Identity = 121/277 (43.68%), Postives = 177/277 (63.90%), Query Frame = 1
Query:   28 VSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXXSYSLSFL-VYCYFGY-WYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSI----FFFNMVGGILISFRFILFRSTFPRFRYDLLMNLAWK 840
            + ++V V ++T+LERK++ YIQ RKGPNKVGF+GL   F+DA+KL  K      +S+ + + FSP+ ++++   +   +P        +LG L +LC   L V++V+ +GWS NS Y LLG +R  +Q ISYE  L L+L+  + L  + +FL  + Y  Y W+++  FPL +++    LAET R+PFDF+EGESELVSGFN EY S  FA +FL EY  I+F+ +++ +++  + I    FFF +    +ISF FI  R T PRFRYD LM LAWK
Sbjct:   15 ICVMVGVAFLTLLERKVLGYIQIRKGPNKVGFMGLLQPFSDAVKLFTKEQTYPLLSNYIFYYFSPIFSLFLSLLIWMSMPYLIKLYSFNLGVLFFLCITSLGVYTVMVAGWSSNSNYALLGGLRAVAQTISYEVSLALILLSFIFLIGNYNFLNFFMYQKYMWFIVFCFPLGLVWFASCLAETNRTPFDFAEGESELVSGFNVEYSSGGFALIFLAEYSSILFMSMLFSVIFLGSDIYSILFFFKLT---IISFFFIWVRGTLPRFRYDKLMYLAWK 288          
BLAST of NADH dehydrogenase subunit 1 vs. UniProt/SwissProt
Match: sp|P33502|NU1M_ANOQU (NADH-ubiquinone oxidoreductase chain 1 OS=Anopheles quadrimaculatus OX=7166 GN=ND1 PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 5.343e-54
Identity = 126/285 (44.21%), Postives = 179/285 (62.81%), Query Frame = 1
Query:    4 LFGYLFIWVSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXXSYSLSFL-VYCYFGY-WYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSI----FFFNMVGGILISFRFILFRSTFPRFRYDLLMNLAWK 840
            L G L + + ++V V ++T+LERK++ YIQ RKGPNKVGF GL   F+DA+KL  K      +S+ + + FSP+ ++++   +   +P        +LG L +LC   L V++V+ +GWS NS Y LLG +R  +Q ISYE  L L+L+  + L  + +FL  Y Y  Y W++   FPL +++L   LAET R+PFDF+EGESELVSGFN EY S  FA +FL EY  I+F+ +++ +++  + I    FFF +     ISF FI  R T PRFRYD LM LAWK
Sbjct:    8 LIGSLLLVICVMVGVAFLTLLERKVLGYIQIRKGPNKVGFNGLLQPFSDAVKLFTKEQTYPLLSNYISYYFSPIFSLFLSLVIWMCIPYLIKLYSFNLGVLFFLCCTSLGVYTVMIAGWSSNSNYALLGGLRAVAQTISYEVSLALILLSFIFLIGNYNFLNFYSYQSYIWFIFFCFPLGLVWLASCLAETNRTPFDFAEGESELVSGFNVEYSSGGFALIFLAEYSSILFMSMLFVVIFLGSDIYSLMFFFKLT---FISFVFIWVRGTLPRFRYDKLMYLAWK 289          
BLAST of NADH dehydrogenase subunit 1 vs. UniProt/SwissProt
Match: sp|P84294|NU1M_DROPE (NADH-ubiquinone oxidoreductase chain 1 OS=Drosophila persimilis OX=7234 GN=mt:ND1 PE=3 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 5.373e-54
Identity = 120/274 (43.80%), Postives = 175/274 (63.87%), Query Frame = 1
Query:   34 MLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXX--SYSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFNM---VGGILISFRFILFRSTFPRFRYDLLMNLAWK 840
            +LV V ++T+LERK++ YIQ RKGPNKVG +G+   F DA+KL  K      +S+ L +  SP+ ++++  FV   +P        +LG L +LC   L V++V+ +GWS NS Y LLG +R  +Q ISYE  L L+L+  + L  SY++ +  Y     W+L++ FP+++++L + LAET R+PFDF+EGESELVSGFN EY S  FA +F+ EY  I+F+ +++ +++    +  FN+   V    ISF FI  R T PRFRYD LM LAWK
Sbjct:   20 VLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYISPIFSLFLSLFVWMCMPFFVKLYSFNLGGLFFLCCTSLGVYTVMIAGWSSNSNYALLGGLRAVAQTISYEVSLALILLSFVFLIGSYNMMYFFYYQIYIWFLIILFPMALVWLTISLAETNRTPFDFAEGESELVSGFNVEYSSGGFALIFMAEYASILFMSMLFCVIFLGCDV--FNLLFYVKLTFISFVFIWARGTLPRFRYDKLMYLAWK 291          
BLAST of NADH dehydrogenase subunit 1 vs. UniProt/SwissProt
Match: sp|P07710|NU1M_DROYA (NADH-ubiquinone oxidoreductase chain 1 OS=Drosophila yakuba OX=7245 GN=mt:ND1 PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 6.279e-54
Identity = 120/274 (43.80%), Postives = 175/274 (63.87%), Query Frame = 1
Query:   34 MLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXX--SYSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFNM---VGGILISFRFILFRSTFPRFRYDLLMNLAWK 840
            +LV V ++T+LERK++ YIQ RKGPNKVG +G+   F DA+KL  K      +S+ L +  SP+ ++++  FV   +P        +LG L +LC   L V++V+ +GWS NS Y LLG +R  +Q ISYE  L L+++  + L  SY++ +  Y     W+L++ FP+S+++L + LAET R+PFDF+EGESELVSGFN EY S  FA +F+ EY  I+F+ +++ +++    +  FN+   V    ISF FI  R T PRFRYD LM LAWK
Sbjct:   17 VLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYISPIFSLFLSLFVWMCMPFFVKLYSFNLGGLFFLCCTSLGVYTVMVAGWSSNSNYALLGGLRAVAQTISYEVSLALIMLSFIFLIGSYNMIYFFYYQIYMWFLIILFPMSLVWLTISLAETNRTPFDFAEGESELVSGFNVEYSSGGFALIFMAEYASILFMSMLFCVIFLGCDV--FNLLFYVKLTFISFVFIWARGTLPRFRYDKLMYLAWK 288          
BLAST of NADH dehydrogenase subunit 1 vs. TrEMBL
Match: T1PTD4 (NADH-ubiquinone oxidoreductase chain 1 OS=Schmidtea mediterranea OX=79327 GN=ND1 PE=3 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 6.593e-152
Identity = 276/282 (97.87%), Postives = 276/282 (97.87%), Query Frame = 1
Query:    1 MLFGYLFIWVSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXXSYSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFNMVGGILISFRFILFRSTFPRFRYDLLMNLAWK*G 846
            MLFGYLFIWVSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGFGVVSVSSRLLFSFSPLLTVYILFFV CLLPLSTVYVCSSLGFLIYLCFN LNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEALLLLVLIFPLALSYSLSFLVYCYFGYWYLLLFFPLSVLFLVVGLAET RSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFNMVGGILISF FILFRSTFPRFRYDLLMNLAW  G
Sbjct:    1 MLFGYLFIWVSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGFGVVSVSSRLLFSFSPLLTVYILFFVWCLLPLSTVYVCSSLGFLIYLCFNSLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEALLLLVLIFPLALSYSLSFLVYCYFGYWYLLLFFPLSVLFLVVGLAETNRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFNMVGGILISFSFILFRSTFPRFRYDLLMNLAWNWG 282          
BLAST of NADH dehydrogenase subunit 1 vs. TrEMBL
Match: A0A0B4VK88 (NADH-ubiquinone oxidoreductase chain 1 OS=Schmidtea mediterranea OX=79327 GN=ND1 PE=3 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 4.772e-150
Identity = 273/282 (96.81%), Postives = 274/282 (97.16%), Query Frame = 1
Query:    1 MLFGYLFIWVSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXXSYSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFNMVGGILISFRFILFRSTFPRFRYDLLMNLAWK*G 846
            MLFGYLFIWVSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGFGVVSVSSRLLFSFSPLLTVYILFFV CLLPLST YVCSSLGFLIYLCFN LNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEALLLLVLIFPLALSYSLSFLV+CYFGYWYLLLFFPLSVLFLVVGLAET RSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFF NMVGGILISF FILFRSTFPRFRYDLLMNLAW  G
Sbjct:    1 MLFGYLFIWVSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGFGVVSVSSRLLFSFSPLLTVYILFFVWCLLPLSTAYVCSSLGFLIYLCFNSLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEALLLLVLIFPLALSYSLSFLVFCYFGYWYLLLFFPLSVLFLVVGLAETNRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFLNMVGGILISFSFILFRSTFPRFRYDLLMNLAWNWG 282          
BLAST of NADH dehydrogenase subunit 1 vs. TrEMBL
Match: G9M8W7 (NADH-ubiquinone oxidoreductase chain 1 (Fragment) OS=Dugesia ryukyuensis OX=79738 GN=nd1 PE=3 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 7.048e-87
Identity = 157/279 (56.27%), Postives = 202/279 (72.40%), Query Frame = 1
Query:    1 MLFGYLFIWVSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXXSYSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFNMVGGILISFRFILFRSTFPRFRYDLLMNLAW 837
            +L GYLF+W+ +LV V++ TMLERK+M YIQ RKGPNK+GFLG+ T  +D +KL  K  G V  S+   F  SPL++V+ILFFV CL P S+     S GFLI++  N LNV+ VL SGWS NSKY+LLGSIRG++Q+ISYE L + + + P++  +S+S   + Y G+ YL LF   S+++ V  +AET RSPFDFSEGESELVSGFNTEYGS+EFACLFLGEYGQ++F+   W L+Y S    F  +  G+  S  FI FRS+FPRFRYDLLMN +W
Sbjct:    8 LLVGYLFVWLGLLVSVMFFTMLERKVMGYIQFRKGPNKIGFLGILTPISDTMKLFFKSSGKVVFSNYYFFWLSPLISVFILFFVWCLFPFSSSLNYVSYGFLIFMAINGLNVYCVLWSGWSSNSKYSLLGSIRGSAQIISYEVLFVFLSLLPISFQFSVSLFDFVYDGFIYLFLFPVFSLIWFVSLVAETNRSPFDFSEGESELVSGFNTEYGSLEFACLFLGEYGQVIFVSCFWVLMYISFYFDFLIIFLGVFFSLSFIFFRSSFPRFRYDLLMNFSW 286          
BLAST of NADH dehydrogenase subunit 1 vs. TrEMBL
Match: G9M8V6 (NADH-ubiquinone oxidoreductase chain 1 OS=Dugesia japonica OX=6161 GN=nd1 PE=3 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 4.678e-75
Identity = 152/282 (53.90%), Postives = 194/282 (68.79%), Query Frame = 1
Query:    1 MLFGYLFIWVSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXXSYSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFN---MVGGILISFRFILFRSTFPRFRYDLLMNLAW 837
            +LF Y  +W+ +LV V++ TMLERKIM YIQ RKGPNKVGFLG+    AD +KL  K    V  ++   F  SPL+ V IL F  CL PLS+ Y   S  FL+++  N LNV+ VL SGWS NSKY+LLG IRG++Q+ISYE L +   +FP+ L  S+SF  + Y G++Y  L    ++++ V  +AET RSPFDFSEGESELVSGFNTEYGS+EFACLFLGEYGQ++F+  +W L Y     FFF+   +  G   S  FI  RS+FPRFRYDLLM+L+W
Sbjct:    6 LLFYYSLVWLGVLVSVLFFTMLERKIMGYIQLRKGPNKVGFLGVLNPIADTIKLFFKSSSKVLNANYYFFWLSPLMAVLILLFAWCLFPLSSSYCYISYSFLLFMAINGLNVYCVLWSGWSSNSKYSLLGCIRGSAQIISYEVLFVFCSLFPVGLQMSVSFHSFVYDGFFYFFLVPFFALIWFVSLIAETNRSPFDFSEGESELVSGFNTEYGSLEFACLFLGEYGQVIFVSCLWILFYW---FFFFDWLILFFGSFFSLVFIFLRSSFPRFRYDLLMSLSW 284          
BLAST of NADH dehydrogenase subunit 1 vs. TrEMBL
Match: A0A0C4ZKG3 (NADH-ubiquinone oxidoreductase chain 1 (Fragment) OS=Girardia sp. ER-2015 OX=1608986 GN=ND1 PE=3 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 2.508e-74
Identity = 147/262 (56.11%), Postives = 184/262 (70.23%), Query Frame = 1
Query:   52 YITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXXSYSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFFFNMVGGILISFRFILFRSTFPRFRYDLLMNLAW 837
            + TMLERK+M YIQ RKGPNKVGFLG+    +D +KL VK    V  S+   F  SP L+V ILF V CL PL + +     GFLI+L  N LNV+ VL SGWS NSKY+LLGSIRGA+Q+ISYE L + + + P +  +S+SF  +   G+WY  L    S+L+ +  + ET RSPFDFSEGESELVSGFNTEYGS+EFACLFLGEYGQI+FI  ++ LLY S  + +  +  G+  S  FI FRS+FPRFRYDLLMN++W
Sbjct:   18 FFTMLERKVMGYIQLRKGPNKVGFLGILNPMSDTVKLFVKTSSKVVFSNYYFFWLSPFLSVLILFLVWCLFPLFSSFGHVGYGFLIFLAINGLNVYCVLWSGWSSNSKYSLLGSIRGAAQIISYEILFVFLSLLPFSFQFSVSFFSFVCDGFWYFFLIPIFSLLWFISLIVETNRSPFDFSEGESELVSGFNTEYGSVEFACLFLGEYGQIIFISCLFILLYFSLFLDYMILSFGVFFSLSFIFFRSSFPRFRYDLLMNVSW 279          
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Sea Lamprey
Match: ND1 (NADH dehydrogenase subunit 1 [Source:NCBI gene;Acc:807812])

HSP 1 Score: 172.555 bits (436), Expect = 4.391e-52
Identity = 110/290 (37.93%), Postives = 175/290 (60.34%), Query Frame = 1
Query:    1 MLFGYLFIWVSMLVCVIYITMLERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXX--XXXXXSYSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYC----STSIFFFNMVGGILISFRFILF----RSTFPRFRYDLLMNLAWK 840
            ML   L + + +L+ V ++TM+ERK + Y+Q RKGPN VGF+GL    AD +KL +K       +S +LF  +P++ + +   +  L+P+       ++  L+ +  + L+V+++LGSGW+ NSKY L+G++R  +Q ISYE  L L+L+    L  S+SL   +Y     W+LL  +PL+ ++ V  LAET R+PFD +EGESELVSGFN EY    FA  FL EY  I+F+  +  +++     S ++    ++  ++ +   I+     R+++PRFRYD LM+L WK
Sbjct:    4 MLTSTLILVLMVLLAVAFLTMVERKTLGYMQLRKGPNVVGFMGLLQPIADGVKLFLKEPVWPLAASPILFIVAPIMALTLALSLWMLIPMPQSISTINITLLVIMAISSLSVYAILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLCLVILTGSFSLQAFIYTQEHTWFLLSSWPLAAMWFVSTLAETNRTPFDLTEGESELVSGFNVEYAGGPFALFFLAEYSNILFMNTLTAIMFLGPLGSNNLNILPIINIMMKATPLIILFLWIRASYPRFRYDQLMHLMWK 293          
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Medaka
Match: ND1 (NADH dehydrogenase subunit 1 [Source:NCBI gene;Acc:805441])

HSP 1 Score: 168.703 bits (426), Expect = 6.121e-50
Identity = 112/268 (41.79%), Postives = 156/268 (58.21%), Query Frame = 1
Query:   67 ERKIMSYIQTRKGPNKVGFLGLATAFADALKLLVKGXXXXXXXXXXXXXXXXXXTVYILFFV*CLLPLSTVYVCSSLGFLIYLCFNRLNVFSVLGSGWSCNSKYTLLGSIRGASQVISYEAXXXXXXXXXXXXS--YSLSFLVYCYFGYWYXXXXXXXXXXXXXXXXAETKRSPFDFSEGESELVSGFNTEYGSMEFACLFLGEYGQIVFICIIWFLLYCSTSIFF--------FNMVGGILISFRFILFRSTFPRFRYDLLMNLAWK 840
            ERK++SY+Q RKGPN VG  GL   FAD LKL  K     S SS  LF  +P++ + +   +   LPL       +LG L  L  + L V+S+LGSGW+ NSKY L+G++R  +Q ISYE  L L+L+  +  +  ++L          W LL  +PL+ ++ +  LAET R+PFD +EGESELVSGFN EY    FA  FL EYG I+ +  +  +L+  TS +           M+   L+S  F+  R+++PRFRYD LM+L WK
Sbjct:   30 ERKVLSYMQLRKGPNVVGPYGLLQPFADGLKLFTKEPVRPSTSSPALFLITPIMALTLALTLWAPLPLPFPIADLNLGVLFILALSSLAVYSILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLNAIVFTGGFTLQTFSTAQEATWLLLPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYGNILLMNTLSAVLFLGTSTYHNLPELSATLLMLKATLLSVVFLWVRASYPRFRYDQLMHLIWK 297          
The following BLAST results are available for this feature:
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MT-ND17.771e-4538.41mitochondrially encoded NADH:ubiquinone oxidoreduc... [more]
back to top
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nduo-13.538e-3636.23pep chromosome:WBcel235:MtDNA:1763:2635:1 gene:WBG... [more]
back to top
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt:ND14.757e-5442.70gene:FBgn0013679 transcript:FBtr0433499[more]
back to top
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt-nd16.332e-4638.08NADH dehydrogenase subunit 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
e2f11.090e-4738.21E2F transcription factor 1 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt-Nd12.579e-5238.65mitochondrially encoded NADH dehydrogenase 1 [Sour... [more]
back to top
BLAST of NADH dehydrogenase subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51937|NU1M_DROSU4.695e-5443.80NADH-ubiquinone oxidoreductase chain 1 OS=Drosophi... [more]
sp|B0FWD8|NU1M_AEDAE4.929e-5443.68NADH-ubiquinone oxidoreductase chain 1 OS=Aedes ae... [more]
sp|P33502|NU1M_ANOQU5.343e-5444.21NADH-ubiquinone oxidoreductase chain 1 OS=Anophele... [more]
sp|P84294|NU1M_DROPE5.373e-5443.80NADH-ubiquinone oxidoreductase chain 1 OS=Drosophi... [more]
sp|P07710|NU1M_DROYA6.279e-5443.80NADH-ubiquinone oxidoreductase chain 1 OS=Drosophi... [more]
back to top
BLAST of NADH dehydrogenase subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1PTD46.593e-15297.87NADH-ubiquinone oxidoreductase chain 1 OS=Schmidte... [more]
A0A0B4VK884.772e-15096.81NADH-ubiquinone oxidoreductase chain 1 OS=Schmidte... [more]
G9M8W77.048e-8756.27NADH-ubiquinone oxidoreductase chain 1 (Fragment) ... [more]
G9M8V64.678e-7553.90NADH-ubiquinone oxidoreductase chain 1 OS=Dugesia ... [more]
A0A0C4ZKG32.508e-7456.11NADH-ubiquinone oxidoreductase chain 1 (Fragment) ... [more]
back to top
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ND14.391e-5237.93NADH dehydrogenase subunit 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ND16.121e-5041.79NADH dehydrogenase subunit 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of NADH dehydrogenase subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012212
GenBankYP_008592433.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012212 ID=SMED30012212|Name=NADH dehydrogenase subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=891bp
atgttgtttggttatttgtttatatgggttagtatgttagtgtgtgtaat
ttatattacaatgttagaacgtaagattatgagctacattcagactcgta
agggtccaaataaggttggttttttaggtttggctactgcttttgctgat
gctttgaagttgcttgttaagggttttggtgttgtttctgtttctagtcg
tttgttgtttagttttagtcctttgcttacagtttatatcttattttttg
tttgatgtctcttaccattaagtactgtttatgtttgttcttctttgggg
tttttgatttatttgtgttttaacaggctaaatgtttttagtgtgttggg
ttctggttggtcttgtaactccaagtatactcttttgggctctattcgtg
gtgcttcgcaggttatttcttatgaggctttgttgcttttagtgttgatt
tttcctttggctttaagttattctctttcttttttggtttattgttattt
tggatattggtatctacttttgttctttcctttatctgttttgtttctag
tggttgggttagcagagactaaacgttctccttttgatttttcagaaggt
gagagtgagttagtatcaggtttcaacactgagtatggttcaatggagtt
tgcttgtttgtttttaggagaatatgggcagattgtttttatttgtatta
tttggtttttattatattgttccacttctatttttttttttaatatggtt
ggtggtatattaatatcttttaggtttattctgtttcgttctacatttcc
tcgatttcgctatgacttgttgatgaatttagcatggaaatgaggtttgc
ttttagttagtatttattttttatacttacttttcttttaa
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000136whole organism
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001694NADH_UbQ_OxRdtase_su1/FPO
IPR018086NADH_UbQ_OxRdtase_su1_CS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0008137NADH dehydrogenase (ubiquinone) activity
GO:0016491oxidoreductase activity