ATP-binding cassette sub-family A member 7-like protein

Overview
NameATP-binding cassette sub-family A member 7-like protein
Smed IDSMED30012205
Length (bp)2001
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-binding cassette sub-family A member 7-like protein (SMED30012205) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-binding cassette sub-family A member 7-like protein (SMED30012205) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-binding cassette sub-family A member 7-like protein (SMED30012205) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-binding cassette sub-family A member 7-like protein (SMED30012205) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012205

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012205SMESG000068605.1 SmedASXL_013101SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30012205SMESG000068605.1 SmedASXL_005273SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30012205SMESG000068605.1 dd_Smed_v4_21124_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30012205SMESG000068605.1 dd_Smed_v4_20782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30012205SMESG000068605.1 dd_Smed_v6_21124_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30012205SMESG000068605.1 dd_Smed_v6_20782_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30012205SMESG000068605.1 OX_Smed_1.0.08391ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Human
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:29])

HSP 1 Score: 483.411 bits (1243), Expect = 1.697e-150
Identity = 255/585 (43.59%), Postives = 363/585 (62.05%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER+S AK  QF+SGV P +YW+SNF+WD+  Y++P  +V++IF+ F  +SY+ + N     +LLL YG +I P MYP SFV   PSTA+V+L + NL +G   ++ATF L+L    D  L   ND+LK +FLIFP + LGRG++D+  N    +     G      P  W+  G+ L ++ +  + ++ +   I+     R    R  N KL      ++ED DV  ER+R+       D+L++  LTKIY                      KRK AV+ IC G+  GECFGLLGVNGAGK++TFKMLTG+  +T GDAF+N +SI++ + + H+NMG+CPQFDA+  LLT  E + F+  +RG+P   +    E +++ L L+ + +K     SGGNKRKLSTA+A+IG P +VFLDEPT+GMD  ARRFLWN   ++  E ++ V+LTSH+MEECE LC R++IMVNG  +CLG+VQHLK++FGD Y + +R+     +   ++      FP G  LK+++   LQY+   SL  L+ IF      K    I DYSVSQT+LD+VF+NFAK++
Sbjct: 1670 ASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--DNKLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRP---RPVNAKLSPL---NDEDEDVRRERQRILDGGGQNDILEIKELTKIYR--------------------RKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRS-VVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQDFFGLAFP-GSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQ 2224          

HSP 2 Score: 165.622 bits (418), Expect = 7.095e-42
Identity = 104/344 (30.23%), Postives = 178/344 (51.74%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQT--LSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIE----------------------------------NESD-------KIKAIMKTQFPQGVSLKD---ENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAK 1758
            K+AV+ +     EG+    LG NGAGKTTT  +LTG    T G A+I    I +EM    +N+G CPQ + L  +LT EE ++FY R++G+   H+K  +E    ++ L P +K  ++T  LSGG +RKLS A+A +G  K+V LDEPT+G+D  +RR +W ++  +       +IL++H+M+E +VL  R++I+ +G++ C+G+   LK++ G  Y++ +    +E                                  +ESD        I  +++    +   ++D   E    L Y          +FH  ++  ++  I+ Y +S+T+L+E+F+  A+
Sbjct:  913 KVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGL-PSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELL--LKYRQGRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAE 1253          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Human
Match: ABCA4 (ATP binding cassette subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:34])

HSP 1 Score: 457.218 bits (1175), Expect = 1.386e-147
Identity = 244/589 (41.43%), Postives = 369/589 (62.65%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGI-INRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIEN----ESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV++LI+ER++ +K  QF+SGV+P  YW++NF+WD++ Y +   +V+ IF+ F  ++Y   +N  A + LLL YG A+IP MYP SF+   PSTA+V L   NL +G  ++  TF L+L + ++ +L   N VL+K+ ++FP + LGRG++DL+ +    ++    G + + +PF W+  G+ L ++++  + ++ +   ++    +++ I    K       E   +ED DV  ER+R+       D+L++  LTKIY                   SS     AV+ +C GV+ GECFGLLGVNGAGKTTTFKMLTG+  +T GDA +   SI+  + + H+NMG+CPQFDA+  LLT  E LY Y R+RG+P + I+     S+K+L L  +   L  T SGGNKRKLSTAIA+IG P +V LDEPT+GMD  ARR LWNVI ++  E + AV+LTSH+MEECE LC RL+IMV G  +C+G +QHLKSKFGD Y V +++   ++    + + ++   +  FP  V  ++ ++  LQ++ + S  L+ IF    + K + +I +YSV+QT+LD+VF+NFAK +
Sbjct:  487 ASFVLYLIQERVNKSKHLQFISGVSPTTYWVTNFLWDIMNYSVSAGLVVGIFIGFQKKAYTSPENLPALVALLLLYGWAVIPMMYPASFLFDVPSTAYVALSCANLFIGINSSAITFILELFE-NNRTLLRFNAVLRKLLIVFPHFCLGRGLIDLALSQAVTDVYARFGEEHSANPFHWDLIGKNLFAMVVEGVVYFLLTLLVQRHFFLSQWIAEPTK-------EPIVDEDDDVAEERQRIITGGNKTDILRLHELTKIY----------------PGTSSP----AVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTNISEVHQNMGYCPQFDAIDELLTGREHLYLYARLRGVPAEEIEKVANWSIKSLGLTVYADCLAGTYSGGNKRKLSTAIALIGCPPLVLLDEPTTGMDPQARRMLWNVIVSIIREGR-AVVLTSHSMEECEALCTRLAIMVKGAFRCMGTIQHLKSKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQ-RERHYNMLQFQVSSS-SLARIFQLLLSHKDSLLIEEYSVTQTTLDQVFVNFAKQQ 1044          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Human
Match: ABCA2 (ATP binding cassette subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:32])

HSP 1 Score: 466.848 bits (1200), Expect = 1.672e-144
Identity = 242/586 (41.30%), Postives = 354/586 (60.41%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFN-YL-QYNISGGKV--TYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCS-LKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FL+ E+ + AK  QFVSG NP +YW++N++WD++ Y++P    ++I  +F+  +Y    N  A + L L YG +I P MYP SF    PS+A+V L   NL +G   T+ATF L L +  D  LK  N  LK  FLIFP Y+LG G+M++++N Y+ +Y    G+      PF W+   + L ++ +  +  + +    +   + R     +    +       E+D DV  ER+R+ +   + D++K+ NLTK+Y            R +        R LAV+ +C GV+ GECFGLLGVNGAGKT+TFKMLTG+E  T G+AF+N HS++ E++   +++G+CPQ DAL   LT  E L  Y R+RGI        V+ +L+ L L  +  K   T SGGNKRKLSTAIA+IG+P  +FLDEPT+GMD  ARRFLWN+I  +    ++ V+LTSH+MEECE LC RL+IMVNG ++CLG++QHLK++FGD Y + +R    ++  D ++      FP+ + LK+ +   +QY+     + L+ +F   E +     I DYSVSQT+LD VF+NFAK +
Sbjct: 1807 ASFVVFLVAEKSTKAKHLQFVSGCNPIIYWLANYVWDMLNYLVPATCCVIILFVFDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITATVATFLLQLFE-HDKDLKVVNSYLKSCFLIFPNYNLGHGLMEMAYNEYINEYYAKIGQFDKMKSPFEWDIVTRGLVAMAVEGVVGFLLTIMCQYNFLRRPQRMPVSTKPV-------EDDVDVASERQRVLRGDADNDMVKIENLTKVYK----------SRKIG-------RILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKMLTGDESTTGGEAFVNGHSVLKELLQVQQSLGYCPQCDALFDELTAREHLQLYTRLRGISWKDEARVVKWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGRS-VVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVRTKSSQSVKDVVR-FFNRNFPEAM-LKERHHTKVQYQLKSEHISLAQVFSKMEQVSGVLGIEDYSVSQTTLDNVFVNFAKKQ 2364          

HSP 2 Score: 175.637 bits (444), Expect = 4.343e-45
Identity = 88/218 (40.37%), Postives = 135/218 (61.93%), Query Frame = 1
Query:  856 EKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDY 1509
            + +KLA+N +   + E +    LG NGAGKTTT  +LTG    T G A I  H I  EM +  KN+G CPQ + L   LT EE L+FY R++ +  + I+  ++  +++L L      L QTLSGG KRKLS AIA +G  + + LDEPT+G+D  ARR +W++I  +  +    ++L++H+M+E ++L  R++I+ +G++KC G+   LK  +GD Y
Sbjct: 1001 DDKKLALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDRLTVEEHLWFYSRLKSMAQEEIRREMDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLI--LKYKPGRTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGTYGDGY 1216          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Human
Match: ABCA2 (ATP binding cassette subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:32])

HSP 1 Score: 466.848 bits (1200), Expect = 1.757e-144
Identity = 242/586 (41.30%), Postives = 354/586 (60.41%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFN-YL-QYNISGGKV--TYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCS-LKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FL+ E+ + AK  QFVSG NP +YW++N++WD++ Y++P    ++I  +F+  +Y    N  A + L L YG +I P MYP SF    PS+A+V L   NL +G   T+ATF L L +  D  LK  N  LK  FLIFP Y+LG G+M++++N Y+ +Y    G+      PF W+   + L ++ +  +  + +    +   + R     +    +       E+D DV  ER+R+ +   + D++K+ NLTK+Y            R +        R LAV+ +C GV+ GECFGLLGVNGAGKT+TFKMLTG+E  T G+AF+N HS++ E++   +++G+CPQ DAL   LT  E L  Y R+RGI        V+ +L+ L L  +  K   T SGGNKRKLSTAIA+IG+P  +FLDEPT+GMD  ARRFLWN+I  +    ++ V+LTSH+MEECE LC RL+IMVNG ++CLG++QHLK++FGD Y + +R    ++  D ++      FP+ + LK+ +   +QY+     + L+ +F   E +     I DYSVSQT+LD VF+NFAK +
Sbjct: 1808 ASFVVFLVAEKSTKAKHLQFVSGCNPIIYWLANYVWDMLNYLVPATCCVIILFVFDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITATVATFLLQLFE-HDKDLKVVNSYLKSCFLIFPNYNLGHGLMEMAYNEYINEYYAKIGQFDKMKSPFEWDIVTRGLVAMAVEGVVGFLLTIMCQYNFLRRPQRMPVSTKPV-------EDDVDVASERQRVLRGDADNDMVKIENLTKVYK----------SRKIG-------RILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKMLTGDESTTGGEAFVNGHSVLKELLQVQQSLGYCPQCDALFDELTAREHLQLYTRLRGISWKDEARVVKWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGRS-VVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVRTKSSQSVKDVVR-FFNRNFPEAM-LKERHHTKVQYQLKSEHISLAQVFSKMEQVSGVLGIEDYSVSQTTLDNVFVNFAKKQ 2365          

HSP 2 Score: 175.637 bits (444), Expect = 4.383e-45
Identity = 88/218 (40.37%), Postives = 135/218 (61.93%), Query Frame = 1
Query:  856 EKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDY 1509
            + +KLA+N +   + E +    LG NGAGKTTT  +LTG    T G A I  H I  EM +  KN+G CPQ + L   LT EE L+FY R++ +  + I+  ++  +++L L      L QTLSGG KRKLS AIA +G  + + LDEPT+G+D  ARR +W++I  +  +    ++L++H+M+E ++L  R++I+ +G++KC G+   LK  +GD Y
Sbjct: 1002 DDKKLALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDRLTVEEHLWFYSRLKSMAQEEIRREMDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLI--LKYKPGRTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGTYGDGY 1217          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Human
Match: ABCA2 (ATP binding cassette subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:32])

HSP 1 Score: 466.848 bits (1200), Expect = 1.917e-144
Identity = 242/586 (41.30%), Postives = 354/586 (60.41%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFN-YL-QYNISGGKV--TYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCS-LKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FL+ E+ + AK  QFVSG NP +YW++N++WD++ Y++P    ++I  +F+  +Y    N  A + L L YG +I P MYP SF    PS+A+V L   NL +G   T+ATF L L +  D  LK  N  LK  FLIFP Y+LG G+M++++N Y+ +Y    G+      PF W+   + L ++ +  +  + +    +   + R     +    +       E+D DV  ER+R+ +   + D++K+ NLTK+Y            R +        R LAV+ +C GV+ GECFGLLGVNGAGKT+TFKMLTG+E  T G+AF+N HS++ E++   +++G+CPQ DAL   LT  E L  Y R+RGI        V+ +L+ L L  +  K   T SGGNKRKLSTAIA+IG+P  +FLDEPT+GMD  ARRFLWN+I  +    ++ V+LTSH+MEECE LC RL+IMVNG ++CLG++QHLK++FGD Y + +R    ++  D ++      FP+ + LK+ +   +QY+     + L+ +F   E +     I DYSVSQT+LD VF+NFAK +
Sbjct: 1808 ASFVVFLVAEKSTKAKHLQFVSGCNPIIYWLANYVWDMLNYLVPATCCVIILFVFDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITATVATFLLQLFE-HDKDLKVVNSYLKSCFLIFPNYNLGHGLMEMAYNEYINEYYAKIGQFDKMKSPFEWDIVTRGLVAMAVEGVVGFLLTIMCQYNFLRRPQRMPVSTKPV-------EDDVDVASERQRVLRGDADNDMVKIENLTKVYK----------SRKIG-------RILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKMLTGDESTTGGEAFVNGHSVLKELLQVQQSLGYCPQCDALFDELTAREHLQLYTRLRGISWKDEARVVKWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGRS-VVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVRTKSSQSVKDVVR-FFNRNFPEAM-LKERHHTKVQYQLKSEHISLAQVFSKMEQVSGVLGIEDYSVSQTTLDNVFVNFAKKQ 2365          

HSP 2 Score: 175.637 bits (444), Expect = 4.423e-45
Identity = 88/218 (40.37%), Postives = 135/218 (61.93%), Query Frame = 1
Query:  856 EKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDY 1509
            + +KLA+N +   + E +    LG NGAGKTTT  +LTG    T G A I  H I  EM +  KN+G CPQ + L   LT EE L+FY R++ +  + I+  ++  +++L L      L QTLSGG KRKLS AIA +G  + + LDEPT+G+D  ARR +W++I  +  +    ++L++H+M+E ++L  R++I+ +G++KC G+   LK  +GD Y
Sbjct: 1002 DDKKLALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDRLTVEEHLWFYSRLKSMAQEEIRREMDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLI--LKYKPGRTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGTYGDGY 1217          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 318.546 bits (815), Expect = 9.124e-94
Identity = 204/604 (33.77%), Postives = 322/604 (53.31%), Query Frame = 1
Query:   28 FVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGT-QNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLG----RGMM-----DLSFNYLQYNISGGKVTYDPF----GWETTG-QKLCSLIILFIAWWFVIFTI--ESGIINRSICGRIKNY--KLKERELQHEEDADVFLERERMTK---RKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKN---MGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRF-NCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
            F ++L+E+RI  A   Q V G+    YW++++++D+V Y + + ++++I++ F    +        AF++L   +G++ I + Y F    S  + +FV++   +  VG +  +    L+ L V DPSL PA+ V   +FL+ PQY+LG    RG+M      +  N+LQ       +   P      ++  G   +C  I + IA   +IF+   E G + +    R +N    +  RE    +D DV  ER+R+        +   L V NL K YNP L                     LAV  I F V+ GECFGLLG+NGAGKTTTF MLT +    HG   + +  I        +N   +G+CPQFDAL+  L+  E L FY RIRGI    I   ++  L  L L P+    T +LSGGN+RKLS A+A++  P ++FLDEP++GMD G+++FLW VI+ +    K AV+LTSH+MEECE LC R++IM  G ++CLG  QHLKSK+G    + ++M   EN + +I  IM+++   G  ++  +  T+       +  ++ +      +K    + D++++Q++LD VF + A++
Sbjct: 1539 FTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLGIAIFRGLMIYQVRAIGSNFLQQMNRPDMINQLPLPSLLAFDQMGIHIMCLFIHVIIATICLIFSQMDEFGFVRK----RERNLTDAMMLREPSTCDDEDVVKERQRVDAIPMDSSDNHALIVRNLAKAYNPEL---------------------LAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSDVRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGK-AVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKGSMLTMKMGKDEN-AKEIAGIMRSKLGDGSRVEAIHCSTIFIHIEQGTASVARVLEIVNQVKKMYDVDDFTLTQSTLDNVFQSIAES 2115          

HSP 2 Score: 136.346 bits (342), Expect = 8.054e-33
Identity = 74/191 (38.74%), Postives = 112/191 (58.64%), Query Frame = 1
Query:  871 AVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIM 1443
            A++ +   + EG+  GLLG NGAGKTTT  +L G    + G A I    I  ++      +G CPQ + L S LT  EQL  +  ++G+P   +   V+  L ++SL     KL  TLSGG KR+L   IA IG  + V LDEPT+G+D  AR+ +W ++Q    E +T ++L++H+M+E +VL  R++I+
Sbjct:  944 ALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQR-NKEGRT-ILLSTHHMDEADVLSDRIAIL 1132          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Celegans
Match: abt-2 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q1RS86])

HSP 1 Score: 318.161 bits (814), Expect = 1.300e-93
Identity = 204/604 (33.77%), Postives = 322/604 (53.31%), Query Frame = 1
Query:   28 FVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGT-QNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLG----RGMM-----DLSFNYLQYNISGGKVTYDPF----GWETTG-QKLCSLIILFIAWWFVIFTI--ESGIINRSICGRIKNY--KLKERELQHEEDADVFLERERMTK---RKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKN---MGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRF-NCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
            F ++L+E+RI  A   Q V G+    YW++++++D+V Y + + ++++I++ F    +        AF++L   +G++ I + Y F    S  + +FV++   +  VG +  +    L+ L V DPSL PA+ V   +FL+ PQY+LG    RG+M      +  N+LQ       +   P      ++  G   +C  I + IA   +IF+   E G + +    R +N    +  RE    +D DV  ER+R+        +   L V NL K YNP L                     LAV  I F V+ GECFGLLG+NGAGKTTTF MLT +    HG   + +  I        +N   +G+CPQFDAL+  L+  E L FY RIRGI    I   ++  L  L L P+    T +LSGGN+RKLS A+A++  P ++FLDEP++GMD G+++FLW VI+ +    K AV+LTSH+MEECE LC R++IM  G ++CLG  QHLKSK+G    + ++M   EN + +I  IM+++   G  ++  +  T+       +  ++ +      +K    + D++++Q++LD VF + A++
Sbjct: 1502 FTVYLVEDRICEALHLQLVGGLRKVTYWVTSYLYDMVVYTLVIIVIMLIYLCFRVSDFTADGATFFAFLLLFFVHGMSTILYAYVFQKAFSVAALSFVLIAIGSYFVGIVCALTVIMLESLMVQDPSLIPAHTVCSIVFLVLPQYNLGIAIFRGLMIYQVRAIGSNFLQQMNRPDMINQLPLPSLLAFDQMGIHIMCLFIHVIIATICLIFSQMDEFGFVRK----RERNLTDAMMLREPSTCDDEDVVKERQRVDAIPMDSSDNHALIVRNLAKAYNPEL---------------------LAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEMQNTRINTGSFSDVRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRLLIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKSGK-AVVLTSHSMEECEALCTRIAIMDRGRIRCLGGKQHLKSKYGKGSMLTMKMGKDEN-AKEIAGIMRSKLGDGSRVEAIHCSTIFIHIEQGTASVARVLEIVNQVKKMYDVDDFTLTQSTLDNVFQSIAES 2078          

HSP 2 Score: 136.346 bits (342), Expect = 7.732e-33
Identity = 74/191 (38.74%), Postives = 112/191 (58.64%), Query Frame = 1
Query:  871 AVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIM 1443
            A++ +   + EG+  GLLG NGAGKTTT  +L G    + G A I    I  ++      +G CPQ + L S LT  EQL  +  ++G+P   +   V+  L ++SL     KL  TLSGG KR+L   IA IG  + V LDEPT+G+D  AR+ +W ++Q    E +T ++L++H+M+E +VL  R++I+
Sbjct:  907 ALDCLNLRLYEGQITGLLGHNGAGKTTTMSILCGLYAPSSGTAKIYQRDIRTDLRRVRDVLGICPQHNVLFSHLTVSEQLRLFAALKGVPDSELTSQVDEILASVSLTEKANKLASTLSGGMKRRLCIGIAFIGGSRFVILDEPTAGVDVTARKDIWKLLQR-NKEGRT-ILLSTHHMDEADVLSDRIAIL 1095          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Celegans
Match: abt-4 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q9TXV8])

HSP 1 Score: 308.916 bits (790), Expect = 1.866e-90
Identity = 202/618 (32.69%), Postives = 319/618 (51.62%), Query Frame = 1
Query:   37 FLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVL---LLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIF-LIFPQYDLGRGMMDLSFNYLQYNISGGKV--TYDPFGW-----ETTGQKLCSLIILFIA------------------WWFVIFTIESGIINRSI----CGRIKNY--------KLKERELQHEEDADVFLERERMTK-RKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRF-NCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
            FLI ER   +K  Q +SG+ P+++W++ F+WD   ++I +     IF +FN  +Y  T + G  ++L    L YG   +P  Y F F   +    F+++  Y++L G I +IA   +      D     A  +   IF  +FP Y++ + +  ++F      I+  K+  T   F        T  ++L    +LF+                   +W  +F  E+    +      C +  N         K+ ER++   ED+DV  E+  + +    N   L   NL K Y    N N                   AV  + F V   +CFGLLGVNGAGKT+TF+MLTGE  I+ GDA++N  S+ N   +A  N G+CPQ+DA+   ++ EE LY + RIRGIP   I   V   +  + +  +  +  +T SGGNKR+LS  IAI+G P ++ LDEPTSG+D  ARR +WN++  +  +  TA++LTSH+M+ECE LC  L+IMV G+ +C G+ QH+KS++G  Y + IR+    N+++K K+ +K  F +G  +K+E+ + L +         S +F   E +  +    DYS+SQT+L++VFI F+++
Sbjct: 1177 FLITERKKKSKHMQLLSGIRPWMFWLTAFIWDAAWFVIRILCFDAIFYIFNITAY--THDFGVMLILTLSFLLYGWTALPFTYWFQFFFESAPKGFMMVTMYHILTGMIGSIAVPIISQTSSLD-----AGYLWSIIFAWLFPTYNISQ-IATVTFQNENVRIACKKLDCTIPMFKAVTACCGTASERLYVDNVLFVGNRKGILVYVIFLAVQGFIYWIWVFMRENDQFTKLFALIRCRKADNPIWDITDTDKVDERDV---EDSDVIAEKSVVQRLANNNKTALVSNNLVKWYG---NFN-------------------AVKGVNFHVNSKDCFGLLGVNGAGKTSTFQMLTGENSISSGDAYVNGWSVKNNWREAGANTGYCPQYDAIIKEMSGEETLYMFARIRGIPEKDIPKKVNAVIHAIGIGMYASRQIKTYSGGNKRRLSLGIAIVGLPDVLLLDEPTSGVDPKARRIIWNILNRL-RDLGTALVLTSHSMDECEALCTELAIMVYGKFRCYGSCQHIKSRYGSGYTLLIRLK-NRNDAEKTKSTIKQTF-RGSVIKEEHVLQLNFDIPRDGDSWSRLFEKLETVSTSLNWDDYSLSQTTLEQVFIEFSRD 1758          

HSP 2 Score: 184.496 bits (467), Expect = 1.891e-48
Identity = 163/587 (27.77%), Postives = 278/587 (47.36%), Query Frame = 1
Query:   46 EERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYN-ISGGKVTYDPFGWE--TTGQKLCSLI----ILFIAWWFVIFTIESG--IINRSICGRIKNYKLKERELQHEEDADVFLE---RERMTKRKENVDVL---KVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIEN-ESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIF-HFFENLKANGV---IADYSVSQTSLDEVFI 1746
            E+R+    R   V G++ ++ W+++F+ +  K    V ++ ++      +S     +     V L+ Y   ++   +  S  +++ ++A +I   + +L   +     FF  + Q +   L       + I  I P   L  G+  L+    Q + +  G++   P      T G  L +LI    I+ I  W++   I  G  +  +     + +Y       +  + +D F +    + +   KE  D++    V+NLTK Y  S       CK       S EKR  AV+N+   +  G+C  LLG NGAGK+TTF MLTG    + G A++ND  I   +    + MG CPQ++ L   +T  E L F+ +++    D  +   E+ L  L +      +   LSGG KRKLS AIA+IG  ++V LDEPTSGMD GAR   W +IQ    + +  ++LT+H MEE ++L  R++IM +G+++C G+   LK ++GD Y + I  +     +  K   I++   P+       ++I  +  +  S     IF   F+ L+ +     I  + VS T+++EVF+
Sbjct:  346 EDRLKEYMR---VMGLSQFINWVAHFIINYAKLTFAVIVLTILMHFVALKS-----DMTLMFVFLMIYAFDVVYFAFMISSFMNSATSATLISVVFWML---LYFWYAFFSSIDQTNPYPLG-----YRLINCINPDIALNYGLQLLAAYETQADGLKWGELFTPPSPDNNLTFGHALIALIVDGIIMIILTWYIEAVIPGGEGVPQKPWFFVLPSYWFPNSGSKTVDSSDQFQQIQYADHVKLEKEPTDLIPTINVVNLTKTYGTSFFKKLFDCKFGK----SGEKR--AVSNLNLKMYPGQCTVLLGHNGAGKSTTFSMLTGVASPSSGSAYVNDFDIRTSLPKIRREMGLCPQYNTLFGFMTVMEHLEFFAKLKERTWDP-EEAREI-LARLRIDFKADFMAGALSGGQKRKLSLAIALIGGSEVVMLDEPTSGMDPGARHETWTLIQ--REKERRTILLTTHFMEEADLLGDRIAIMAHGQLECCGSPMFLKQQYGDGYHLTIVYDTTSTPDVSKTTDIIREYIPEAHVF---SYIGQEATYLLSATHRPIFPKLFKELEDHQTQCGITSFGVSITTMEEVFL 903          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 249.21 bits (635), Expect = 4.048e-70
Identity = 176/589 (29.88%), Postives = 303/589 (51.44%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLF-YGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFL-IFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFG---WETTGQKLCSL-IILFIAWWFV-IFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLK----LSTIFHFFENLKANGVIADYSVSQTSLDEVFINFA 1755
            ++FV+FLIEER      QQF++G++P  ++ ++ ++D + Y +   I L +F+ F++       +  A ++L  F Y  + +P +Y  SF+  +PS A V+L  + +++     +A F + ++   D  LK    +L  IF+ + P Y  G  ++ ++  Y     S   + +D  G   W      +CS  + + + + FV  F  +   + RS      N +    +L   E   V  ERER+ +       L + +LTK +                       R  AVN +C  V + ECFGLLGVNGAGKTTTF +LTG+   + G+A I     V E+I    ++G+CPQFDAL   LT  E L    ++ G   ++ K   EL L+ + +I H  KL +  SGG KRK+S  +A++   +++ LDEPT+G+D  ARR +W ++      + +A++LTSH+M+ECE LC R++++  G +  +G+ Q LKS +G++Y + + + +  N+ D +  +++T+ P  V        TL  ++    +     S  F   + L  +  + D+ ++Q+SL+E F+  A
Sbjct: 1124 STFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLK---SILVNIFMFLLPSYAFGSAIITIN-TYGMILPSEELMNWDHCGKNAWLMGTFGVCSFALFVLLQFKFVRRFLSQVWTVRRS---SHNNVQPMMGDLPVCE--SVSEERERVHRVNSQNSALVIKDLTKTFG----------------------RFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRD-VTELI----SIGYCPQFDALMLDLTGRESLEILAQMHG--FENYKAKAELILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSL-YEPNQRDMVVQLVQTRLPNSVLKTTSTNKTLNLKWQIPKEKEDCWSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLA 1668          

HSP 2 Score: 134.42 bits (337), Expect = 3.549e-32
Identity = 80/230 (34.78%), Postives = 127/230 (55.22%), Query Frame = 1
Query:  871 AVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIK 1560
            AV+ +      G+C  LLG NGAGK+TTF  + G    T+G   I  + + NE  +  +++G CPQ++ L+  LT  E L     ++G      K  ++  L ++ L     +    LSGG KRKL   +A+IG  ++V LDEPT+GMD GAR+ +  +++     N+T ++LT+H M+E E L   + IM +G++   G  Q+LK KFG  Y + +    +++  DK K
Sbjct:  549 AVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVER-EKANRT-ILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTV---VLDHNGDKRK 773          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 249.21 bits (635), Expect = 4.054e-70
Identity = 176/589 (29.88%), Postives = 303/589 (51.44%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLF-YGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFL-IFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFG---WETTGQKLCSL-IILFIAWWFV-IFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLK----LSTIFHFFENLKANGVIADYSVSQTSLDEVFINFA 1755
            ++FV+FLIEER      QQF++G++P  ++ ++ ++D + Y +   I L +F+ F++       +  A ++L  F Y  + +P +Y  SF+  +PS A V+L  + +++     +A F + ++   D  LK    +L  IF+ + P Y  G  ++ ++  Y     S   + +D  G   W      +CS  + + + + FV  F  +   + RS      N +    +L   E   V  ERER+ +       L + +LTK +                       R  AVN +C  V + ECFGLLGVNGAGKTTTF +LTG+   + G+A I     V E+I    ++G+CPQFDAL   LT  E L    ++ G   ++ K   EL L+ + +I H  KL +  SGG KRK+S  +A++   +++ LDEPT+G+D  ARR +W ++      + +A++LTSH+M+ECE LC R++++  G +  +G+ Q LKS +G++Y + + + +  N+ D +  +++T+ P  V        TL  ++    +     S  F   + L  +  + D+ ++Q+SL+E F+  A
Sbjct: 1193 STFVMFLIEERTCQFAHQQFLTGISPITFYSASLIYDGILYSLICLIFLFMFLAFHWM-----YDHLAIVILFWFLYFFSSVPFIYAVSFLFQSPSKANVLLIIWQVVISGAALLAVFLIFMIFNIDEWLK---SILVNIFMFLLPSYAFGSAIITIN-TYGMILPSEELMNWDHCGKNAWLMGTFGVCSFALFVLLQFKFVRRFLSQVWTVRRS---SHNNVQPMMGDLPVCE--SVSEERERVHRVNSQNSALVIKDLTKTFG----------------------RFTAVNELCLAVDQKECFGLLGVNGAGKTTTFNILTGQSFASSGEAMIGGRD-VTELI----SIGYCPQFDALMLDLTGRESLEILAQMHG--FENYKAKAELILECVGMIAHADKLVRFYSGGQKRKISVGVALLAPTQMIILDEPTAGIDPKARREVWELLLWCREHSNSALMLTSHSMDECEALCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSL-YEPNQRDMVVQLVQTRLPNSVLKTTSTNKTLNLKWQIPKEKEDCWSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLA 1737          

HSP 2 Score: 134.42 bits (337), Expect = 3.638e-32
Identity = 80/230 (34.78%), Postives = 127/230 (55.22%), Query Frame = 1
Query:  871 AVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIK 1560
            AV+ +      G+C  LLG NGAGK+TTF  + G    T+G   I  + + NE  +  +++G CPQ++ L+  LT  E L     ++G      K  ++  L ++ L     +    LSGG KRKL   +A+IG  ++V LDEPT+GMD GAR+ +  +++     N+T ++LT+H M+E E L   + IM +G++   G  Q+LK KFG  Y + +    +++  DK K
Sbjct:  616 AVDGLSLRAVRGQCSILLGHNGAGKSTTFSSIAGIIRPTNGRITICGYDVGNEPGETRRHIGMCPQYNPLYDQLTVSEHLKLVYGLKGAREKDFKQDMKRLLSDVKLDFKENEKAVNLSGGMKRKLCVCMALIGDSEVVLLDEPTAGMDPGARQDVQKLVER-EKANRT-ILLTTHYMDEAERLGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTV---VLDHNGDKRK 840          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332488)

HSP 1 Score: 324.709 bits (831), Expect = 7.358e-96
Identity = 211/625 (33.76%), Postives = 313/625 (50.08%), Query Frame = 1
Query:   28 FVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDP----------------FGWETTG--QKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNY--KLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRK-LAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRM---------------------------NFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAK 1758
            +++FLI+ER S AK  QFV GV  + +W+S F+ D   YI+   IV++  V F           G + +LLL +G A++P +Y  S     P+T F  +   N+  G    I    +     D    K   D+L  IF IFP + L   +  +  N    N         P                F WE  G   +   + +  + ++ +I  +E  +IN  +  +I+    K      + + D DV  ERER+ +                    ++ N    K  V D ++    + +AVN +   V+E ECFGLLGVNGAGKTTTFKM+TG+E I+ G A++   S+ + M   +K +G+CPQFDAL   LT  E L  +C +RG+    I+   E   K+   + H  K T   SGGNKRKLSTAIA+IG P +++LDEPT+GMD  ARR LWN++  +    K+ ++LTSH+MEECE LC RL+IMVNGE KC+G+ QHLK+KF     +KI++                              + + D +K  ++T++P  +  ++   I   Y     +K S IF   E+ +    + DYSVSQT+L+E+F+ FAK
Sbjct: 1083 YILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCGMALFIVVVVMSSELFDT---KDTADILGWIFRIFPHFSLAMSLNKVYTNTATRNACAKAGALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINE-LMFKIRQLISKPPPPPTEGQLDDDVANERERILQ--------------------MSSNELATKNLVLDRVTKYYGQFMAVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKS-IVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFAK 1682          

HSP 2 Score: 160.614 bits (405), Expect = 1.507e-40
Identity = 103/304 (33.88%), Postives = 155/304 (50.99%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRF----NCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
            K+ V  +   + E E   LLG NGAGKTTT  MLTG    T G A IN   I   +  A  ++G CPQ + L   ++    + F+ R++G+    ++  V   LK + L       +  LSGG KRKLS   A+ G  K+V  DEP+SGMD  ARR LW+++Q         ++LT+H M+E +VL  R++IM +GE+KC G    LK ++G  Y + I +   + E++++ A++    P    LK E  I  +  +    + S K   +F   E       +  Y V  TS++EVF+     K
Sbjct:  528 KMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQQEKVGR--TLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGYRL-ICVKRDDCETNEVTALLNKYIP---GLKPECDIGAELSYQLPDSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEK 825          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0306679)

HSP 1 Score: 324.324 bits (830), Expect = 1.028e-95
Identity = 211/625 (33.76%), Postives = 313/625 (50.08%), Query Frame = 1
Query:   28 FVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDP----------------FGWETTG--QKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNY--KLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRK-LAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRM---------------------------NFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAK 1758
            +++FLI+ER S AK  QFV GV  + +W+S F+ D   YI+   IV++  V F           G + +LLL +G A++P +Y  S     P+T F  +   N+  G    I    +     D    K   D+L  IF IFP + L   +  +  N    N         P                F WE  G   +   + +  + ++ +I  +E  +IN  +  +I+    K      + + D DV  ERER+ +                    ++ N    K  V D ++    + +AVN +   V+E ECFGLLGVNGAGKTTTFKM+TG+E I+ G A++   S+ + M   +K +G+CPQFDAL   LT  E L  +C +RG+    I+   E   K+   + H  K T   SGGNKRKLSTAIA+IG P +++LDEPT+GMD  ARR LWN++  +    K+ ++LTSH+MEECE LC RL+IMVNGE KC+G+ QHLK+KF     +KI++                              + + D +K  ++T++P  +  ++   I   Y     +K S IF   E+ +    + DYSVSQT+L+E+F+ FAK
Sbjct: 1105 YILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCGMALFIVVVVMSSELFDT---KDTADILGWIFRIFPHFSLAMSLNKVYTNTATRNACAKAGALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINE-LMFKIRQLISKPPPPPTEGQLDDDVANERERILQ--------------------MSSNELATKNLVLDRVTKYYGQFMAVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKS-IVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFAK 1704          

HSP 2 Score: 160.614 bits (405), Expect = 1.651e-40
Identity = 103/304 (33.88%), Postives = 155/304 (50.99%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRF----NCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
            K+ V  +   + E E   LLG NGAGKTTT  MLTG    T G A IN   I   +  A  ++G CPQ + L   ++    + F+ R++G+    ++  V   LK + L       +  LSGG KRKLS   A+ G  K+V  DEP+SGMD  ARR LW+++Q         ++LT+H M+E +VL  R++IM +GE+KC G    LK ++G  Y + I +   + E++++ A++    P    LK E  I  +  +    + S K   +F   E       +  Y V  TS++EVF+     K
Sbjct:  550 KMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQQEKVGR--TLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGYRL-ICVKRDDCETNEVTALLNKYIP---GLKPECDIGAELSYQLPDSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEK 847          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332489)

HSP 1 Score: 324.324 bits (830), Expect = 1.130e-95
Identity = 211/625 (33.76%), Postives = 313/625 (50.08%), Query Frame = 1
Query:   28 FVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDP----------------FGWETTG--QKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNY--KLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRK-LAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRM---------------------------NFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAK 1758
            +++FLI+ER S AK  QFV GV  + +W+S F+ D   YI+   IV++  V F           G + +LLL +G A++P +Y  S     P+T F  +   N+  G    I    +     D    K   D+L  IF IFP + L   +  +  N    N         P                F WE  G   +   + +  + ++ +I  +E  +IN  +  +I+    K      + + D DV  ERER+ +                    ++ N    K  V D ++    + +AVN +   V+E ECFGLLGVNGAGKTTTFKM+TG+E I+ G A++   S+ + M   +K +G+CPQFDAL   LT  E L  +C +RG+    I+   E   K+   + H  K T   SGGNKRKLSTAIA+IG P +++LDEPT+GMD  ARR LWN++  +    K+ ++LTSH+MEECE LC RL+IMVNGE KC+G+ QHLK+KF     +KI++                              + + D +K  ++T++P  +  ++   I   Y     +K S IF   E+ +    + DYSVSQT+L+E+F+ FAK
Sbjct: 1083 YILFLIKERESRAKLLQFVGGVKVWTFWLSQFICDFASYIVTALIVVITIVCFQETGLSTFGELGRYYLLLLLFGFAVLPFIYIMSLFFREPATGFARVSIVNIFCGMALFIVVVVMSSELFDT---KDTADILGWIFRIFPHFSLAMSLNKVYTNTATRNACAKAGALPPILLCELVPQCCNLKPYFAWEEPGVLPETVYMAVTGVVFFLIIIVLEFRLINE-LMFKIRQLISKPPPPPTEGQLDDDVANERERILQ--------------------MSSNELATKNLVLDRVTKYYGQFMAVNQVSLCVQEVECFGLLGVNGAGKTTTFKMMTGDERISSGAAYVQGLSLESNMNSIYKMIGYCPQFDALLDDLTGREVLRIFCMLRGVQESRIRQLSEDLAKSFGFMKHIDKQTHAYSGGNKRKLSTAIAVIGSPSVIYLDEPTTGMDPAARRQLWNMVCRIRDSGKS-IVLTSHSMEECEALCTRLAIMVNGEFKCIGSTQHLKNKFSKGLILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTGVKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFAK 1682          

HSP 2 Score: 160.614 bits (405), Expect = 1.718e-40
Identity = 103/304 (33.88%), Postives = 155/304 (50.99%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRF----NCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
            K+ V  +   + E E   LLG NGAGKTTT  MLTG    T G A IN   I   +  A  ++G CPQ + L   ++    + F+ R++G+    ++  V   LK + L       +  LSGG KRKLS   A+ G  K+V  DEP+SGMD  ARR LW+++Q         ++LT+H M+E +VL  R++IM +GE+KC G    LK ++G  Y + I +   + E++++ A++    P    LK E  I  +  +    + S K   +F   E       +  Y V  TS++EVF+     K
Sbjct:  528 KMVVKGLSMNMFEDEITVLLGHNGAGKTTTISMLTGMFPPTSGTAIINGSDIRTNIEGARMSLGICPQHNVLFDEMSVSNHIRFFSRMKGLRGKAVEQEVAKYLKMIELEDKANVASSKLSGGMKRKLSVCCALCGDTKVVLCDEPSSGMDPSARRQLWDLLQQEKVGR--TLLLTTHFMDEADVLGDRIAIMCDGELKCQGTSFFLKKQYGSGYRL-ICVKRDDCETNEVTALLNKYIP---GLKPECDIGAELSYQLPDSASAKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEK 825          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Fly
Match: CG6052 (gene:FBgn0036747 transcript:FBtr0075195)

HSP 1 Score: 286.574 bits (732), Expect = 1.028e-82
Identity = 199/645 (30.85%), Postives = 309/645 (47.91%), Query Frame = 1
Query:   28 FVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNY-LQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESG---IINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFG-----------------------------------DDYFVKIRMNFIENESDKIKAI---MKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNKXXXXXXXXXIRNSVPLFDGQVNEC 1836
            + I +I ER + AK  QF+SGV+   YW S+ +WD + +++     ++    F    YI   +   +  +LL +G   I   Y  S   S+ +T F  +   N L+G  T +   F+ L   +   LK   + L   F + P Y L      +   Y ++   S G +   P         +C  I  +  W      +E     ++  ++   I  +  K   L  E+  + F +R+R+ +   +++   V+   ++    +N   K     V       + KLAV  I F V   ECFGLLG+NGAGKT+TFKML G+E+IT G+A+I+  +I    +  ++ +G+CPQFDAL   LT  E L  YC +RG+   H+ P       +     H  K T+  SGGN+RKLSTAI+++G P +++LDEPTSGMD  ARR LW +I  + T  K+ ++LTSH+M+ECE LC RL+IMV+GE KCLG+VQ LK++F                                    D  F+++      +++D+I  +   +  + P    LK+E    + Y    S  LS IF   E       I DY + QT L+E+F++FA             R+S  +F  ++  C
Sbjct: 1069 YAIPIIRERETRAKLLQFLSGVDVCAYWTSHIVWDYLVFVLSALSSILTIAAFKEIGYITPLDLSRYFYMLLIFGFPGIMLSYAASGCFSDAATGFTRISIINTLMG--TGLFLMFMTL-NFEAFQLKDVAEKLAWYFRLSPHYSLASSTHSIHIGYNIRRGCSIGGIRKLPKQLRCRNVPICCDIPGYYGWRKPGVLVEITYMIMLGSTLFLLIVMHDAKVCNLIAEKLGNCFSKRKRV-EGGTSIENDSVVAEQRVVREMINSGRKDVPLLVYKISKRYRSKLAVKAISFHVPHAECFGLLGINGAGKTSTFKMLAGDEKITSGEAYIDGTNISTHKV--YRKIGYCPQFDALFEDLTGRETLNIYCLLRGVQRRHVTPICWGLAISFGFAKHMDKQTKHYSGGNRRKLSTAISVLGNPSVLYLDEPTSGMDPAARRQLWQIIGLIRTAGKS-IVLTSHSMDECEALCSRLAIMVDGEFKCLGSVQSLKNQFSKGLILKVKVKHKKKTFQRVVEDSSSSNDKKSISETDLKFLQMASVMESSQADRILKVNRFISKEIPDA-ELKEEYNGLITYYIPHSKTLSKIFQLLETNSHKLNIEDYLIMQTRLEEIFLDFASK-----------RDSSDIFTKRIYSC 1694          

HSP 2 Score: 151.369 bits (381), Expect = 1.522e-37
Identity = 155/589 (26.32%), Postives = 267/589 (45.33%), Query Frame = 1
Query:   88 GVNPYLYWISNFMWDLVKYIIPVAIVLVI--FVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHM---YPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTY-DPFGWETTGQKLCSLIILFIAWWFVIFTIESG-IINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNI------------NNKCCKRAVAD-----SLSSEKRKL-AVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGI-PLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFI--TLQYRFNC--SLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
            GV+ +L+W++   W +  YI+ + +V +I   ++  + + +      +++ +LLF    ++  +   +  + + S  STA  +   +  L     +   ++ + L +    L         I LIF    LG G+  +    + +  +G  +T+ + F   +T   L     LF    ++I T+  G I+  SIC  ++                VF   E    R+ N    K  N  + Y PSLNI              K C+RA        +L     KL AV  I   +   E   LLG NGAGKTTT  M+TG  + T G A +N + I   +  A +++G CPQ + L   ++  + + F+ +++GI     ++  V   +  L L   +    + LSGG KRKLS   A+ G  K+V  DEP+SG+DA  RR LW+++Q  + ++   ++LT+H M+E +VL  R++I+  G+++C G   +LK +FG  Y +   M    +     + I K   P    +K E  +   L YR     S K + +    +   A   +  Y +S  +L++VF+    +K
Sbjct:  285 GVHNWLHWVA---WFVKSYIMLMLVVFLIMSLIMVKFYASVAVLTFSSWVPVLLFLHTYVVTSVCLCFMLAVLFSKASTASAVAAIFWFLTYIPYSFGYYYYERLSLMSKLL---------ISLIFSNSALGFGIHVI----VMWEGTGEGITWRNMFHPVSTDDSLT----LF----YIIMTMSFGSIMFISICLYVEQ---------------VF-PGEYGVPRRWNFMCHK--NYWRQYVPSLNIVPSFQTILHGSAKAKSCRRAREVGIQLFNLQKNYGKLKAVKGISLKMHRNEITVLLGHNGAGKTTTINMITGIVKPTSGTAIVNGYDIRTHLAKARESLGICPQNNILFKEMSVRDHIIFFSKLKGIRGTKAVENEVGKYMTMLKLQDKSYVAAKNLSGGMKRKLSLCCALCGNAKVVLCDEPSSGIDAAGRRSLWDLLQ--SEKDGRTILLTTHYMDEADVLGDRIAILSEGKLQCQGTSFYLKKRFGTGYLLVCIMQSGCDVGAVTQLIRKYVPP----IKPERVLGTELTYRLPTEYSKKFAELLQDLDEKCAQLQLVGYGLSGATLEDVFMAVNTDK 825          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Fly
Match: CG34120 (gene:FBgn0083956 transcript:FBtr0299591)

HSP 1 Score: 221.09 bits (562), Expect = 1.379e-60
Identity = 153/505 (30.30%), Postives = 247/505 (48.91%), Query Frame = 1
Query:   34 IFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYL------QYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIP-----LDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFV 1515
            ++L+ ER++G K QQ + GV+   YW+   +WD +  ++ + + LV+ ++F    ++  Q     I L L +  A +P ++    + S+ S A V +   NL+V  +T      L ++  D P+       L + FLIFP + LG G ++L  NY+      +Y+I   K    P   +  G+   +L+++ +A   +   IE  ++ R        ++  ER L      D    RE      + +  LK++N+  I+   ++       RA    L+  +   AV N+ F V+ GECFGLLG NGAGK+T FK+LTG+ +   G  +     I            +CPQ + L  LLT  E + FY R+RGI      LD +  T EL        P+     + LSGGN+RKL+ A+   G    V +DEPTS MD   R  ++  I+ +    + AV+LTSH++ E E LC R++++  G++    + Q LKS+ G  Y V
Sbjct: 1388 VYLVNERVNGEKLQQRLCGVSAVTYWLVALVWDYLVMVLGLIVCLVVILMFGMPVFVDRQQLVGIIGLSLAFSFACVPSVHVAEKIFSDSSIAIVSIFCANLIVPLVTMGIILILGVVG-DGPAWDDWRHALNQAFLIFPIHALGDGFLELCKNYMVALVFRRYDIDSYK---HPLASDLLGRHFTALLLVGVAALIINVLIEWHLLRRL-------WQRVERLL------DCTYRRE-----LDKLGQLKLVNIQSIFKSCVDTGEAV--RAENLWLAYRRGHYAVRNVNFSVQRGECFGLLGKNGAGKSTIFKLLTGQLQPDVGQIYFEQPGI-----------SYCPQSNPLDPLLTTTECIRFYGRLRGIRDLDQFLDRVLDTYELR-------PYKDVQVRNLSGGNRRKLTVAVTCCGCTPTVLMDEPTSDMDPVTRDMVYATIEQLLLARR-AVVLTSHSVSEIEHLCQRVAVLRAGQVIASDSPQRLKSEHGGYYAV 1849          

HSP 2 Score: 115.931 bits (289), Expect = 3.172e-26
Identity = 87/314 (27.71%), Postives = 151/314 (48.09%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIP-----LDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIR------MNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKAN---GVIADYSV-SQTSLDEVFINFAKN 1761
            K AV+N+       +   LLG NGAGK+T  K+LTG+   + G            ++     +G C Q + L   LT  E L  Y +I+  P     ++ I+  V  +L++L+   H    +  LSGG +R+L  AIA I  P +V LDEP +G+DA AR+ +W +I+ +      AVI  +H M+E + L   L IM NG +    +   L+     +Y +++R      + F+  ++ ++  + +TQ     +    + +T+   +   L    +  F E L++    G I+D  + + +SL++ F    +N
Sbjct:  853 KCAVSNLSLDFARNQVSCLLGRNGAGKSTLIKLLTGQIRQSSGKV----------LLAGEHQVGVCWQDNILIPTLTAREHLQLYAQIKIPPGGSGGVEEIRSEVAQTLQSLNFGKHESYPSWQLSGGYRRRLCVAIAFIASPSVVILDEPCNGVDAKARKDIWQLIERL--RQGRAVIFATHFMDEAKYLSDSLVIMRNGRIIAQHSRDSLQRLCTSNYSIRLRCADATGVTFVIQKAQQL--LPQTQVTHSGAADYPHSLTINASYAEHLTPGAV-EFLELLQSQVTAGSISDVELTTSSSLEQEFEQLNRN 1151          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Zebrafish
Match: abca1a (ATP-binding cassette, sub-family A (ABC1), member 1A [Source:ZFIN;Acc:ZDB-GENE-031006-12])

HSP 1 Score: 476.093 bits (1224), Expect = 5.119e-148
Identity = 249/585 (42.56%), Postives = 373/585 (63.76%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER++ AK  QF+SGV P+LYW++NF+WD+  YI+P  +V++IFV F  ++Y+ + N     +LLL YG +I P MYP SF    PSTA+V+L + N+L+G   +++TF L+L   ++  +   ND+LK +FLIFP + LGRG++D+  N    +     G      P  W+  G+ L ++ I  +    + F+I + +I    C + ++   K + +  EED DV  ER+R+       D+L++  LTK+Y           KR         K+K AV+ +C G+  GECFGLLGVNGAGKT+TFKMLTG+  +T G+A++  +S++ E+ + H+NMG+CPQFDA++ LLT  E L FY  +RG+P   +    +  ++ L L+ +  K   + SGGN RKLSTA+A+IG P +VFLDEPT+GMD  ARR LWN I ++  E ++ V+LTSH+MEECE LC R++IMVNG  +CLG+VQHLK+KFGD Y + +R+   +   + +   ++ + P G +LK+++   LQY+ + SL  L+ IF+     K    I DYSVSQT+LD+VF+NFAK++
Sbjct: 1677 ASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAIEGV----IFFSI-TVLIQYRFCIKARSLSTKLKPI-GEEDEDVARERQRILGGGGQTDILELRQLTKVY-----------KR---------KQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTSGEAYLAGNSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCKVADWGIRKLGLMKYVDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGRS-VVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNKFGDGYTIILRVAGADPRLEPVMEFIERELP-GSTLKEKHRNMLQYQLSSSLTSLARIFNILSKNKEQLHIEDYSVSQTTLDQVFVNFAKDQ 2231          

HSP 2 Score: 168.703 bits (426), Expect = 4.859e-43
Identity = 84/220 (38.18%), Postives = 139/220 (63.18%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTK-KLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI 1521
            K+AV+ +  G  EG+    LG NGAGKTTT  +LTG    T G A+I    I  ++    +N+G CPQ + L S+LT EE ++FY R++G+  + +K  +E  + +L L PH +   +  LSGG +RKLS A+A +G  K+V LDEPT+G+D  ARR +W+++  +       +IL++H+M+E ++L  R++I+ +G++ C+G+   LK++ G  Y++ +
Sbjct:  917 KVAVDGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIQGKDIRTDLNAIRQNLGVCPQHNVLFSMLTVEEHIWFYARLKGLSAEKVKSEMEQIVMDLGL-PHKRTSRSNQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLL--LKYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTL 1133          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Zebrafish
Match: abca1a (ATP-binding cassette, sub-family A (ABC1), member 1A [Source:ZFIN;Acc:ZDB-GENE-031006-12])

HSP 1 Score: 476.093 bits (1224), Expect = 5.119e-148
Identity = 249/585 (42.56%), Postives = 373/585 (63.76%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER++ AK  QF+SGV P+LYW++NF+WD+  YI+P  +V++IFV F  ++Y+ + N     +LLL YG +I P MYP SF    PSTA+V+L + N+L+G   +++TF L+L   ++  +   ND+LK +FLIFP + LGRG++D+  N    +     G      P  W+  G+ L ++ I  +    + F+I + +I    C + ++   K + +  EED DV  ER+R+       D+L++  LTK+Y           KR         K+K AV+ +C G+  GECFGLLGVNGAGKT+TFKMLTG+  +T G+A++  +S++ E+ + H+NMG+CPQFDA++ LLT  E L FY  +RG+P   +    +  ++ L L+ +  K   + SGGN RKLSTA+A+IG P +VFLDEPT+GMD  ARR LWN I ++  E ++ V+LTSH+MEECE LC R++IMVNG  +CLG+VQHLK+KFGD Y + +R+   +   + +   ++ + P G +LK+++   LQY+ + SL  L+ IF+     K    I DYSVSQT+LD+VF+NFAK++
Sbjct: 1677 ASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAIEGV----IFFSI-TVLIQYRFCIKARSLSTKLKPI-GEEDEDVARERQRILGGGGQTDILELRQLTKVY-----------KR---------KQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTSGEAYLAGNSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCKVADWGIRKLGLMKYVDKAAGSYSGGNMRKLSTAMALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGRS-VVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNKFGDGYTIILRVAGADPRLEPVMEFIERELP-GSTLKEKHRNMLQYQLSSSLTSLARIFNILSKNKEQLHIEDYSVSQTTLDQVFVNFAKDQ 2231          

HSP 2 Score: 168.703 bits (426), Expect = 4.859e-43
Identity = 84/220 (38.18%), Postives = 139/220 (63.18%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTK-KLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI 1521
            K+AV+ +  G  EG+    LG NGAGKTTT  +LTG    T G A+I    I  ++    +N+G CPQ + L S+LT EE ++FY R++G+  + +K  +E  + +L L PH +   +  LSGG +RKLS A+A +G  K+V LDEPT+G+D  ARR +W+++  +       +IL++H+M+E ++L  R++I+ +G++ C+G+   LK++ G  Y++ +
Sbjct:  917 KVAVDGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIQGKDIRTDLNAIRQNLGVCPQHNVLFSMLTVEEHIWFYARLKGLSAEKVKSEMEQIVMDLGL-PHKRTSRSNQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLL--LKYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTL 1133          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 471.085 bits (1211), Expect = 2.718e-146
Identity = 248/585 (42.39%), Postives = 365/585 (62.39%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGII--NRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAK 1758
             SFV+FLI+ER++ AK  QF+SGV PYLYW++NF+WD+  Y++P  +V++IFV F  ++Y+   N     +LLL YG +I P MYP SF+   PSTA+V+L + N+L+G   +I+TF ++L    +  +   ND+LK + LIFP + LGRG++D+  N    +     G      P  W+  G+ L ++ +  + ++ +   I+       +S+C ++            EED DV  ER+R+       D+L++  LTK+Y           KR         K+K AV+ +C G+  GECFGLLGVNGAGKT+TFKMLTG+  +T G+AFI   SI+ E+ + H+NMG+CPQFDA++ LLT  E L FY  +RG+P + +    E  ++ L L+ +  K   + SGGN RKLSTAI++IG P +VFLDEPT+GMD  ARR LWN I ++  E ++ V+LTSH+MEECE LC R++IMVNG  +CLG+VQHLK++FGD Y + +R+   + +   +   ++++ P G +LK+++   LQY+   SL  L+ IF      K    I DYSVSQT+LD+VF+NFAK
Sbjct: 1690 ASFVVFLIQERVNKAKHMQFISGVQPYLYWLANFLWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFKIPSTAYVVLTSVNILIGINGSISTFVMELF--GNHEIGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITVLIQYRFFFEPKSLCPKLSPIG--------EEDEDVARERQRIMSGAGQGDILELRQLTKVY-----------KR---------KQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTKGEAFIAGKSILREIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPENEVCAVAEWGIRKLGLVKYVDKNAGSYSGGNMRKLSTAISLIGAPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGRS-VVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVAGPDPDLQPVMKFIESELP-GSTLKEKHRNMLQYQLPSSLTSLAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFAK 2242          

HSP 2 Score: 173.711 bits (439), Expect = 1.043e-44
Identity = 110/358 (30.73%), Postives = 180/358 (50.28%), Query Frame = 1
Query:  862 RKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKK-LTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDY------------------------FVKIRMNFIENESDK------------------------------IKAIMKTQFPQGVSLKDENF---ITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
            +KLAV+ +  G  EG+    LG NGAGKTTT  +LTG    T G A+I    I +E+    +++G CPQ + L S+LT EE ++FY R++G+  + +K  +E  L +  L PH +K  T  LSGG +RKLS A+A +G  K+V LDEPT+G+D  ARR +W+++  +       ++L++H+M+E ++L  R++I+ +G++ C+G+   LK++ G  Y                        FVK   N  E+ SD                               I  ++    P    ++D+       L Y    +     +FH  ++  A+  I+ Y VS T+L+E+F+  A++
Sbjct:  915 KKLAVDGLTLGFHEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSSIRQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLSEEEVKAEMEQILSDTGL-PHKRKSRTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLL--LKYRAGRTILLSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIGTSWPESPVVPVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAED 1269          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 470.7 bits (1210), Expect = 3.251e-146
Identity = 248/585 (42.39%), Postives = 365/585 (62.39%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGII--NRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAK 1758
             SFV+FLI+ER++ AK  QF+SGV PYLYW++NF+WD+  Y++P  +V++IFV F  ++Y+   N     +LLL YG +I P MYP SF+   PSTA+V+L + N+L+G   +I+TF ++L    +  +   ND+LK + LIFP + LGRG++D+  N    +     G      P  W+  G+ L ++ +  + ++ +   I+       +S+C ++            EED DV  ER+R+       D+L++  LTK+Y           KR         K+K AV+ +C G+  GECFGLLGVNGAGKT+TFKMLTG+  +T G+AFI   SI+ E+ + H+NMG+CPQFDA++ LLT  E L FY  +RG+P + +    E  ++ L L+ +  K   + SGGN RKLSTAI++IG P +VFLDEPT+GMD  ARR LWN I ++  E ++ V+LTSH+MEECE LC R++IMVNG  +CLG+VQHLK++FGD Y + +R+   + +   +   ++++ P G +LK+++   LQY+   SL  L+ IF      K    I DYSVSQT+LD+VF+NFAK
Sbjct: 1679 ASFVVFLIQERVNKAKHMQFISGVQPYLYWLANFLWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFKIPSTAYVVLTSVNILIGINGSISTFVMELF--GNHEIGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITVLIQYRFFFEPKSLCPKLSPIG--------EEDEDVARERQRIMSGAGQGDILELRQLTKVY-----------KR---------KQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVVTKGEAFIAGKSILREIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPENEVCAVAEWGIRKLGLVKYVDKNAGSYSGGNMRKLSTAISLIGAPPVVFLDEPTTGMDPKARRALWNCIHSVIKEGRS-VVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVAGPDPDLQPVMKFIESELP-GSTLKEKHRNMLQYQLPSSLTSLAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFAK 2231          

HSP 2 Score: 177.948 bits (450), Expect = 4.920e-46
Identity = 110/347 (31.70%), Postives = 180/347 (51.87%), Query Frame = 1
Query:  862 RKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKK-LTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDY------------------------FVKIRMNFIENESDK-------------------IKAIMKTQFPQGVSLKDENF---ITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
            +KLAV+ +  G  EG+    LG NGAGKTTT  +LTG    T G A+I    I +E+    +++G CPQ + L S+LT EE ++FY R++G+  + +K  +E  L +  L PH +K  T  LSGG +RKLS A+A +G  K+V LDEPT+G+D  ARR +W+++  +       ++L++H+M+E ++L  R++I+ +G++ C+G+   LK++ G  Y                        FVK   N  E+ SD                    I  ++    P    ++D+       L Y    +     +FH  ++  A+  I+ Y VS T+L+E+F+  A++
Sbjct:  915 KKLAVDGLTLGFHEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSELSSIRQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLSEEEVKAEMEQILSDTGL-PHKRKSRTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLL--LKYRAGRTILLSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAED 1258          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Zebrafish
Match: abca2 (ATP-binding cassette, sub-family A (ABC1), member 2 [Source:ZFIN;Acc:ZDB-GENE-050517-1])

HSP 1 Score: 468.003 bits (1203), Expect = 4.208e-145
Identity = 247/586 (42.15%), Postives = 356/586 (60.75%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFN-YL-QYNISGGKV--TYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNC-SLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FL+ E+ + AK  QFVSG +P  YW++N++WD++ Y++P    ++I  +F+  +Y    N  A + L L YG +I P MYP SF    PSTA+V L   NL +G   T+ATF L L + D   LK  N  LK  FLIFP Y+LG G+M++++N Y+ +Y    G+      PF W+   + L ++ I     + +    +   + ++    + +  +++      +D DV  ER R+ +   + D+LK+ NLTK+Y            R +        R LAV+ +C GV+ GECFGLLGVNGAGKTTTFKMLTG+E  T G+AFI +HSI+ E++   +++G+CPQFDAL   LT  E L  Y R+RGIP    +  V+ +L+ L L  +  K   T SGGNKRKLSTAIA+IG+P ++FLDEPT+GMD  ARRFLWN+I  +    ++ V+LTSH+MEECE LC RL IMVNG  KCLG++QHLK++FGD Y + +R     +  + I+      FP+ + LK+ +   +QY+    ++ L+ +F   E +     I DYSVSQT+LD VF+NFAK +
Sbjct: 1788 ASFVVFLVAEKSTKAKHLQFVSGCDPVTYWLANYIWDMLNYLVPATCCVLILFVFDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSTAYVFLIVINLFIGITATVATFLLQLFERDK-DLKLVNSYLKSCFLIFPNYNLGHGLMEMAYNEYINEYYAKIGQFDKVKSPFEWDIVTRGLVAMTIEGFVGFLITILCQYNFLRKAQRVPVNSQPVED------DDVDVACERRRVLRGDADNDMLKIDNLTKVYK----------SRKMG-------RILAVDRLCLGVRPGECFGLLGVNGAGKTTTFKMLTGDESTTGGEAFIQEHSILRELLRVQQSIGYCPQFDALFDDLTAREHLELYTRLRGIPWKDEERVVQWALEKLELSKYADKPAGTYSGGNKRKLSTAIALIGYPSLIFLDEPTTGMDPKARRFLWNLILDIIKTGRS-VVLTSHSMEECEALCTRLGIMVNGRFKCLGSIQHLKNRFGDGYMITVRTKTTASVKEVIR-FFNRNFPEAI-LKERHHTKIQYQLKSENISLAQVFSKMEQVVEVLSIEDYSVSQTTLDNVFVNFAKKQ 2346          

HSP 2 Score: 178.333 bits (451), Expect = 3.992e-46
Identity = 92/233 (39.48%), Postives = 142/233 (60.94%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKA 1563
            KLA+N +   + E +    LG NGAGKTTT  +LTG    T G A I  H I  EM    +N+G CPQ + L   L+ EE L+FY R++G+  + I+  ++  +++L L      L QTLSGG KRKLS AIA +G  + V LDEPT+G+D  ARR +W++I  +  +    ++L++H+M+E ++L  R++I+ +G++KC G+   LKS +GD Y    ++  ++ +SD   A
Sbjct:  970 KLALNKLSLNLHENQVVSFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMERIRQNLGMCPQHNVLFDKLSVEEHLWFYSRLKGMAEEDIRKEMDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAVILDEPTAGVDPYARRAIWDLI--LKYKQGRTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKSTYGDGY----KLTLVKKQSDSHTA 1196          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 483.797 bits (1244), Expect = 6.475e-158
Identity = 259/588 (44.05%), Postives = 368/588 (62.59%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNF----IENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV++LI+ER+S AK  QFVSGV P +YW++NF WD++ Y I VA+V++IF+ F+ ++Y  + N  A I LL FYG A+IP MYP S++ + PSTA+V L   NL +G  ++  TF LDL + ++ SL   N+ LK + LIFP + LGRG++DL+ N    ++    G +   +PF WE  G+ + ++ +  +    V FT+   I +R        +    + L   ED DV  ER+R+ K     D+LK+  LTK Y                      K+  AV+ +C GV+ GECFGLLGVNGAGKTTTFKMLTG+ ++T GDA +  +SI+ ++ D H+N G+CPQFDA+  LLT  E L  Y R+RG+P D I    +  ++ L L  +   LT T SGGNKRKLSTAIA+IG P +V LDEPT+GMD  +RRFLWN I ++  E + AV+LTSH+MEECEVLC RL+IMV G  KCLG +QHLK KFGD Y V +++      +  +   ++  ++T FP  V  +++++  LQY+ + S  L+ +F    + K +  I +YSVSQT+LD+VF+NFAK +
Sbjct:  474 ASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFE-NNRSLLKFNEKLKDLLLIFPHFCLGRGLIDLAMNQAVTDVYARFGEEHVSNPFQWEFLGRNIFAMAVEGV----VYFTLNLLIQHRFFFSTW--FSEPPKGLVEGEDEDVAQERQRVIKGGGKNDILKLKELTKTY--------------------PGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGR-AVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIVTMKVRASKPGLAPDPGPVEKFIQTNFPGSVQ-REKHYNMLQYQLSSS-SLARVFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQ 1031          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 483.026 bits (1242), Expect = 1.954e-150
Identity = 259/588 (44.05%), Postives = 368/588 (62.59%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNF----IENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV++LI+ER+S AK  QFVSGV P +YW++NF WD++ Y I VA+V++IF+ F+ ++Y  + N  A I LL FYG A+IP MYP S++ + PSTA+V L   NL +G  ++  TF LDL + ++ SL   N+ LK + LIFP + LGRG++DL+ N    ++    G +   +PF WE  G+ + ++ +  +    V FT+   I +R        +    + L   ED DV  ER+R+ K     D+LK+  LTK Y                      K+  AV+ +C GV+ GECFGLLGVNGAGKTTTFKMLTG+ ++T GDA +  +SI+ ++ D H+N G+CPQFDA+  LLT  E L  Y R+RG+P D I    +  ++ L L  +   LT T SGGNKRKLSTAIA+IG P +V LDEPT+GMD  +RRFLWN I ++  E + AV+LTSH+MEECEVLC RL+IMV G  KCLG +QHLK KFGD Y V +++      +  +   ++  ++T FP  V  +++++  LQY+ + S  L+ +F    + K +  I +YSVSQT+LD+VF+NFAK +
Sbjct: 1641 ASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFE-NNRSLLKFNEKLKDLLLIFPHFCLGRGLIDLAMNQAVTDVYARFGEEHVSNPFQWEFLGRNIFAMAVEGV----VYFTLNLLIQHRFFFSTW--FSEPPKGLVEGEDEDVAQERQRVIKGGGKNDILKLKELTKTY--------------------PGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGR-AVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIVTMKVRASKPGLAPDPGPVEKFIQTNFPGSVQ-REKHYNMLQYQLSSS-SLARVFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQ 2198          

HSP 2 Score: 149.058 bits (375), Expect = 2.013e-36
Identity = 82/233 (35.19%), Postives = 135/233 (57.94%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKK-LTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI--RMNFIENESDK 1554
            K AV+ +     EG+    LG NGAGKTTT  ++TG    T G  ++    I   M    +++G CPQ + L   LT EE + FY +++G      +   E+ L+++  IPH +    Q LSGG +RKLS A+A +G  K+V LDEPTSG+D  +RR +W+++  +   +   +IL++H+M+E ++L  R++I+  G++ C G+   LK+ FG  +++ +  RM  I++   K
Sbjct:  919 KPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMG-IPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLL--LKYRSGRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKK 1148          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 483.026 bits (1242), Expect = 2.058e-150
Identity = 259/588 (44.05%), Postives = 368/588 (62.59%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNF----IENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV++LI+ER+S AK  QFVSGV P +YW++NF WD++ Y I VA+V++IF+ F+ ++Y  + N  A I LL FYG A+IP MYP S++ + PSTA+V L   NL +G  ++  TF LDL + ++ SL   N+ LK + LIFP + LGRG++DL+ N    ++    G +   +PF WE  G+ + ++ +  +    V FT+   I +R        +    + L   ED DV  ER+R+ K     D+LK+  LTK Y                      K+  AV+ +C GV+ GECFGLLGVNGAGKTTTFKMLTG+ ++T GDA +  +SI+ ++ D H+N G+CPQFDA+  LLT  E L  Y R+RG+P D I    +  ++ L L  +   LT T SGGNKRKLSTAIA+IG P +V LDEPT+GMD  +RRFLWN I ++  E + AV+LTSH+MEECEVLC RL+IMV G  KCLG +QHLK KFGD Y V +++      +  +   ++  ++T FP  V  +++++  LQY+ + S  L+ +F    + K +  I +YSVSQT+LD+VF+NFAK +
Sbjct: 1646 ASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFE-NNRSLLKFNEKLKDLLLIFPHFCLGRGLIDLAMNQAVTDVYARFGEEHVSNPFQWEFLGRNIFAMAVEGV----VYFTLNLLIQHRFFFSTW--FSEPPKGLVEGEDEDVAQERQRVIKGGGKNDILKLKELTKTY--------------------PGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGR-AVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIVTMKVRASKPGLAPDPGPVEKFIQTNFPGSVQ-REKHYNMLQYQLSSS-SLARVFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQ 2203          

HSP 2 Score: 149.058 bits (375), Expect = 1.669e-36
Identity = 82/233 (35.19%), Postives = 135/233 (57.94%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKK-LTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI--RMNFIENESDK 1554
            K AV+ +     EG+    LG NGAGKTTT  ++TG    T G  ++    I   M    +++G CPQ + L   LT EE + FY +++G      +   E+ L+++  IPH +    Q LSGG +RKLS A+A +G  K+V LDEPTSG+D  +RR +W+++  +   +   +IL++H+M+E ++L  R++I+  G++ C G+   LK+ FG  +++ +  RM  I++   K
Sbjct:  920 KPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMG-IPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLL--LKYRSGRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKK 1149          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 482.256 bits (1240), Expect = 2.899e-150
Identity = 259/588 (44.05%), Postives = 368/588 (62.59%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNF----IENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV++LI+ER+S AK  QFVSGV P +YW++NF WD++ Y I VA+V++IF+ F+ ++Y  + N  A I LL FYG A+IP MYP S++ + PSTA+V L   NL +G  ++  TF LDL + ++ SL   N+ LK + LIFP + LGRG++DL+ N    ++    G +   +PF WE  G+ + ++ +  +    V FT+   I +R        +    + L   ED DV  ER+R+ K     D+LK+  LTK Y                      K+  AV+ +C GV+ GECFGLLGVNGAGKTTTFKMLTG+ ++T GDA +  +SI+ ++ D H+N G+CPQFDA+  LLT  E L  Y R+RG+P D I    +  ++ L L  +   LT T SGGNKRKLSTAIA+IG P +V LDEPT+GMD  +RRFLWN I ++  E + AV+LTSH+MEECEVLC RL+IMV G  KCLG +QHLK KFGD Y V +++      +  +   ++  ++T FP  V  +++++  LQY+ + S  L+ +F    + K +  I +YSVSQT+LD+VF+NFAK +
Sbjct: 1630 ASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFE-NNRSLLKFNEKLKDLLLIFPHFCLGRGLIDLAMNQAVTDVYARFGEEHVSNPFQWEFLGRNIFAMAVEGV----VYFTLNLLIQHRFFFSTW--FSEPPKGLVEGEDEDVAQERQRVIKGGGKNDILKLKELTKTY--------------------PGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGR-AVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIVTMKVRASKPGLAPDPGPVEKFIQTNFPGSVQ-REKHYNMLQYQLSSS-SLARVFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQ 2187          

HSP 2 Score: 149.443 bits (376), Expect = 1.216e-36
Identity = 85/244 (34.84%), Postives = 141/244 (57.79%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKK-LTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI--RMNFIEN--ESDKIKAIMKTQF 1581
            K AV+ +     EG+    LG NGAGKTTT  ++TG    T G  ++    I   M    +++G CPQ + L   LT EE + FY +++G      +   E+ L+++  IPH +    Q LSGG +RKLS A+A +G  K+V LDEPTSG+D  +RR +W+++  +   +   +IL++H+M+E ++L  R++I+  G++ C G+   LK+ FG  +++ +  RM  I++  + D I A+  + F
Sbjct:  910 KPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMG-IPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLL--LKYRSGRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKKDSISALNGSVF 1150          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Xenopus
Match: klf9 (Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-483889])

HSP 1 Score: 482.256 bits (1240), Expect = 3.118e-150
Identity = 259/588 (44.05%), Postives = 368/588 (62.59%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNF----IENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV++LI+ER+S AK  QFVSGV P +YW++NF WD++ Y I VA+V++IF+ F+ ++Y  + N  A I LL FYG A+IP MYP S++ + PSTA+V L   NL +G  ++  TF LDL + ++ SL   N+ LK + LIFP + LGRG++DL+ N    ++    G +   +PF WE  G+ + ++ +  +    V FT+   I +R        +    + L   ED DV  ER+R+ K     D+LK+  LTK Y                      K+  AV+ +C GV+ GECFGLLGVNGAGKTTTFKMLTG+ ++T GDA +  +SI+ ++ D H+N G+CPQFDA+  LLT  E L  Y R+RG+P D I    +  ++ L L  +   LT T SGGNKRKLSTAIA+IG P +V LDEPT+GMD  +RRFLWN I ++  E + AV+LTSH+MEECEVLC RL+IMV G  KCLG +QHLK KFGD Y V +++      +  +   ++  ++T FP  V  +++++  LQY+ + S  L+ +F    + K +  I +YSVSQT+LD+VF+NFAK +
Sbjct: 1627 ASFVLYLIQERVSNAKHLQFVSGVTPAIYWLTNFAWDIINYAISVAMVVIIFIAFDKKAYTSSSNLPALIALLFFYGWAVIPMMYPASYLFNVPSTAYVALSCINLFIGINSSAITFILDLFE-NNRSLLKFNEKLKDLLLIFPHFCLGRGLIDLAMNQAVTDVYARFGEEHVSNPFQWEFLGRNIFAMAVEGV----VYFTLNLLIQHRFFFSTW--FSEPPKGLVEGEDEDVAQERQRVIKGGGKNDILKLKELTKTY--------------------PGKQSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDIQVTSGDASVAGYSILQDIADVHQNTGYCPQFDAIDDLLTGREHLQLYGRLRGVPEDEIDMVADWGIEKLGLGKYADNLTGTYSGGNKRKLSTAIALIGCPPVVLLDEPTTGMDPQSRRFLWNSIVSIIKEGR-AVVLTSHSMEECEVLCTRLAIMVKGTFKCLGTIQHLKYKFGDGYIVTMKVRASKPGLAPDPGPVEKFIQTNFPGSVQ-REKHYNMLQYQLSSS-SLARVFQLLISNKDSLNIEEYSVSQTTLDQVFVNFAKQQ 2184          

HSP 2 Score: 148.673 bits (374), Expect = 2.082e-36
Identity = 82/233 (35.19%), Postives = 135/233 (57.94%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKK-LTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI--RMNFIENESDK 1554
            K AV+ +     EG+    LG NGAGKTTT  ++TG    T G  ++    I   M    +++G CPQ + L   LT EE + FY +++G      +   E+ L+++  IPH +    Q LSGG +RKLS A+A +G  K+V LDEPTSG+D  +RR +W+++  +   +   +IL++H+M+E ++L  R++I+  G++ C G+   LK+ FG  +++ +  RM  I++   K
Sbjct:  901 KPAVDRMNITFYEGQITAFLGHNGAGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQSLGMCPQHNILFRHLTVEEHILFYAQLKGKSRKQAERQAEVMLEDMG-IPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPYSRRSIWDLL--LKYRSGRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGTGFYLTLVRRMRNIKDTGKK 1130          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Mouse
Match: Abca1 (ATP-binding cassette, sub-family A (ABC1), member 1 [Source:MGI Symbol;Acc:MGI:99607])

HSP 1 Score: 482.256 bits (1240), Expect = 3.401e-150
Identity = 256/585 (43.76%), Postives = 364/585 (62.22%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER+S AK  QF+SGV P +YW+SNF+WD+  Y++P  +V++IF+ F  +SY+ + N     +LLL YG +I P MYP SFV   PSTA+V+L + NL +G   ++ATF L+L    +  L   ND+LK +FLIFP + LGRG++D+  N    +     G      P  W+  G+ L ++ +       V+F + + +I      R +  K K   L ++ED DV  ER+R+       D+L++  LTKIY                      KRK AV+ IC G+  GECFGLLGVNGAGK+TTFKMLTG+  +T GDAF+N +SI++ + + H+NMG+CPQFDA+  LLT  E + F+  +RG+P   +    E +++ L L+ + +K     SGGNKRKLSTA+A+IG P +VFLDEPT+GMD  ARRFLWN   ++  E ++ V+LTSH+MEECE LC R++IMVNG  +CLG+VQHLK++FGD Y + +R+     +   ++      FP G  LK+++   LQY+   SL  L+ IF      K    I DYSVSQT+LD+VF+NFAK++
Sbjct: 1670 ASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--NNKLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEG-----VVFFLITVLIQYRFFIRPRPVKAKLPPL-NDEDEDVRRERQRILDGGGQNDILEIKELTKIYR--------------------RKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGRS-VVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQEFFGLAFP-GSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQ 2224          

HSP 2 Score: 168.703 bits (426), Expect = 5.685e-43
Identity = 103/343 (30.03%), Postives = 175/343 (51.02%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHT-KKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIE----------------------------------NESD-------KIKAIMKTQFPQGVSLKD---ENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAK 1758
            K+AV+ +     EG+    LG NGAGKTTT  +LTG    T G A+I    I +EM    +N+G CPQ + L  +LT EE ++FY R++G+   H+K  +E    ++ L P   K  T  LSGG +RKLS A+A +G  K+V LDEPT+G+D  +RR +W ++  +       +IL++H+M+E ++L  R++I+ +G++ C+G+   LK++ G  Y++ +    +E                                  +ESD        I  +++    +   ++D   E    L Y          +FH  ++  ++  I+ Y +S+T+L+E+F+  A+
Sbjct:  913 KVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELL--LKYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAE 1253          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Mouse
Match: Abca4 (ATP-binding cassette, sub-family A (ABC1), member 4 [Source:MGI Symbol;Acc:MGI:109424])

HSP 1 Score: 463.766 bits (1192), Expect = 6.061e-150
Identity = 243/592 (41.05%), Postives = 360/592 (60.81%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFN------YLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGI-INRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIEN----ESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV++LI+ER++ AK  QF+SGV+P  YW++NF+WD++ Y +   +V+ IF+ F  ++Y    N  A + LL+ YG A+IP MYP SF+   PSTA+V L   NL +G  ++  TF L+L + ++ +L   N +L+K+ ++FP + LGRG++DL+ +      Y Q+   G + + +PF W+  G+ L ++ I  + ++ +   I+    + R I           RE   +ED DV  ER+R+       D+LK+  LTK+Y                    S     AV+ +C GV+ GECFGLLGVNGAGKTTTFKMLTG+  +T GDA +   SI+  + D H+NMG+CPQFDA+  LLT  E LY Y R+RG+P   I+      +++L L  +  +L  T SGGNKRKLSTAIA+ G P ++ LDEPT+GMD  ARR LWN I ++  E + AV+LTSH+MEECE LC RL+IMV G  +CLG +QHLK KFGD Y V +++   ++    + + ++   +  FP  V  ++ +   LQ++   S  L+ IF    + K + +I +YSV+QT+LD+VF+NFAK +
Sbjct:  486 ASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFE-NNRTLLRFNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQF---GEEYSANPFQWDLIGKNLVAMAIEGVVYFLLTLLIQHHFFLTRWIAE-------PAREPVFDEDDDVAEERQRVMSGGNKTDILKLNELTKVY--------------------SGSSSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTSISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPSKEIEKVANWGIQSLGLSLYADRLAGTYSGGNKRKLSTAIALTGCPPLLLLDEPTTGMDPQARRMLWNTIVSIIREGR-AVVLTSHSMEECEALCTRLAIMVKGTFQCLGTIQHLKYKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQ-RERHHSMLQFQVPSS-SLARIFQLLISHKDSLLIEEYSVTQTTLDQVFVNFAKQQ 1043          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Mouse
Match: Abca2 (ATP-binding cassette, sub-family A (ABC1), member 2 [Source:MGI Symbol;Acc:MGI:99606])

HSP 1 Score: 473.396 bits (1217), Expect = 7.814e-147
Identity = 245/586 (41.81%), Postives = 356/586 (60.75%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFN-YL-QYNISGGKV--TYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCS-LKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FL+ E+ + AK  QFVSG NP +YW++N++WD++ Y++P    ++I  +F+  +Y    N  A + L L YG +I P MYP SF    PS+A+V L   NL +G   T+ATF L L +  D  LK  N  LK  FLIFP Y+LG G+M++++N Y+ +Y    G+      PF W+   + L ++ +     +F+    +   + +         +L       E+D DV  ER+R+ +   + D++K+ NLTK+Y            R +        R LAV+ +C GV+ GECFGLLGVNGAGKT+TFKMLTG+E  T G+AF+N HS++ +++   +++G+CPQFDAL   LT  E L  Y R+RGIP       V+ +L+ L L  +  K   T SGGNKRKLSTAIA+IG+P  +FLDEPT+GMD  ARRFLWN+I  +    ++ V+LTSH+MEECE LC RL+IMVNG ++CLG++QHLK++FGD Y + +R    +N  D ++      FP+ + LK+ +   +QY+     + L+ +F   E +     I DYSVSQT+LD VF+NFAK +
Sbjct: 1807 ASFVVFLVAEKSTKAKHLQFVSGCNPVIYWLANYVWDMLNYLVPATCCVIILFVFDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITATVATFLLQLFE-HDKDLKVVNSYLKSCFLIFPNYNLGHGLMEMAYNEYINEYYAKIGQFDKMKSPFEWDIVTRGLVAMTVEGFVGFFLTIMCQYNFLRQP-------QRLPVSTKPVEDDVDVASERQRVLRGDADNDMVKIENLTKVYK----------SRKIG-------RILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKMLTGDESTTGGEAFVNGHSVLKDLLQVQQSLGYCPQFDALFDELTAREHLQLYTRLRGIPWKDEAQVVKWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGRS-VVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVRTKSSQNVKDVVR-FFNRNFPEAM-LKERHHTKVQYQLKSEHISLAQVFSKMEQVVGVLGIEDYSVSQTTLDNVFVNFAKKQ 2364          

HSP 2 Score: 174.866 bits (442), Expect = 5.340e-45
Identity = 88/230 (38.26%), Postives = 139/230 (60.43%), Query Frame = 1
Query:  862 RKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESD 1551
            +K+A+N +   + E +    LG NGAGKTTT  +LTG    T G A I  H I  EM +  KN+G CPQ + L   LT EE L+FY R++ +  + I+   +  +++L L      L QTLSGG KRKLS AIA +G  + + LDEPT+G+D  ARR +W++I  +  +    ++L++H+M+E ++L  R++I+ +G++KC G+   LK  +GD Y    R+  ++  ++
Sbjct: 1002 KKMALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDRLTVEEHLWFYSRLKSMAQEEIRKETDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLI--LKYKPGRTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGAYGDGY----RLTLVKQPAE 1225          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Mouse
Match: Abca4 (ATP-binding cassette, sub-family A (ABC1), member 4 [Source:MGI Symbol;Acc:MGI:109424])

HSP 1 Score: 461.84 bits (1187), Expect = 5.187e-143
Identity = 243/592 (41.05%), Postives = 361/592 (60.98%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFN------YLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGI-INRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIEN----ESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV++LI+ER++ AK  QF+SGV+P  YW++NF+WD++ Y +   +V+ IF+ F  ++Y    N  A + LL+ YG A+IP MYP SF+   PSTA+V L   NL +G  ++  TF L+L + ++ +L   N +L+K+ ++FP + LGRG++DL+ +      Y Q+   G + + +PF W+  G+ L ++ I  + ++ +   I+    + R I           RE   +ED DV  ER+R+       D+LK+  LTK+Y+ S                       AV+ +C GV+ GECFGLLGVNGAGKTTTFKMLTG+  +T GDA +   SI+  + D H+NMG+CPQFDA+  LLT  E LY Y R+RG+P   I+      +++L L  +  +L  T SGGNKRKLSTAIA+ G P ++ LDEPT+GMD  ARR LWN I ++  E + AV+LTSH+MEECE LC RL+IMV G  +CLG +QHLK KFGD Y V +++   ++    + + ++   +  FP  V  ++ +   LQ++   S  L+ IF    + K + +I +YSV+QT+LD+VF+NFAK +
Sbjct: 1694 ASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDIMNYAVSAGLVVGIFIGFQKKAYTSPDNLPALVSLLMLYGWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFE-NNRTLLRFNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQF---GEEYSANPFQWDLIGKNLVAMAIEGVVYFLLTLLIQHHFFLTRWIAE-------PAREPVFDEDDDVAEERQRVMSGGNKTDILKLNELTKVYSGS--------------------SSPAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTSISDVHQNMGYCPQFDAIDDLLTGREHLYLYARLRGVPSKEIEKVANWGIQSLGLSLYADRLAGTYSGGNKRKLSTAIALTGCPPLLLLDEPTTGMDPQARRMLWNTIVSIIREGR-AVVLTSHSMEECEALCTRLAIMVKGTFQCLGTIQHLKYKFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQ-RERHHSMLQFQVPSS-SLARIFQLLISHKDSLLIEEYSVTQTTLDQVFVNFAKQQ 2251          

HSP 2 Score: 140.969 bits (354), Expect = 5.554e-34
Identity = 101/336 (30.06%), Postives = 163/336 (48.51%), Query Frame = 1
Query:  592 IAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDAD---------VFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI--RMNFIENESDKIKAI 1566
            + W+F++   ES  +    C   +   L++ E   EE  D          F ERE        V  + V NL K++ PS         R   D L          NI F   E +    LG NGAGKTTT  +LTG    T G   I    I   +    +++G CPQ + L   LT  E + FY +++G   +  +  +E  L++  L     +  Q LSGG +RKLS AIA +G  K+V LDEPTSG+D  +RR +W+++  +   +   +I+++H+M+E ++L  R++I+  G + C G    LK+ FG  +++ +  +M  I+++    + +
Sbjct:  869 LPWYFLL--QESYWLGGEGCSTREERALEKTEPLTEEMEDPEHPEGMNDSFFEREL----PGLVPGVCVKNLVKVFEPS--------GRPAVDRL----------NITF--YENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLIGGKDIETNLDVVRQSLGMCPQHNILFHHLTVAEHILFYAQLKGRSWEEAQLEMEAMLEDTGLHHKRNEEAQDLSGGMQRKLSVAIAFVGDSKVVVLDEPTSGVDPYSRRSIWDLL--LKYRSGRTIIMSTHHMDEADLLGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGV 1176          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 420.624 bits (1080), Expect = 9.678e-129
Identity = 238/588 (40.48%), Postives = 353/588 (60.03%), Query Frame = 1
Query:   25 SFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQ---YNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQ--HEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGV---IADYSVSQTSLDEVFINFAKNK 1764
            SF + LIEERI+ AK  Q VSG+   LYW+ NF+WD+  Y++ V IV+ IF+ F  ++Y+  +N  A ++LLL YG +I P MYP SF  S PSTA+V+L   NL +G  +++ATF L+LL   D +L+  + +LK++FLIFP + LGRG++D+  N      +   G K    P  W+  G+ L +++     +  +   ++    NR +       + K R L    EED DV  ERER+TK     DVL + +LTK+Y                      +R  AV+ +C G+  GECFGLLGVNGAGKT+TF+M+TG+   + G+A +  H++  E   AH++MG+CPQ DA+  LLT  E L  + R+RG+P   +  T    L  L L  +  +   T SGGNKRKL+TA+A++G P +VFLDEPT+GMD  ARRFLWN + ++  E ++ V+LTSH+MEECE LC RL+IMVNG  +CLG+ QHLK +FG  + + +R+    ++ +   A ++  FP G  L++ +   L+++     +  T+   F  L A G    + D+SVSQT+L+EVF+ F+K++
Sbjct: 1566 SFTLVLIEERITRAKHLQLVSGLPQTLYWLGNFLWDMCNYLVAVCIVVFIFLAFQQRAYVAPENLPALLLLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINSSMATFVLELLS--DQNLQEVSRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDKQFQSPLRWDIIGKNLLAMMAQGPLFLLITLLLQHR--NRLLP------QSKPRLLPPLGEEDEDVAQERERVTKGATQGDVLVLRDLTKVYR--------------------GQRNPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHNVAQERSAAHRSMGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADRPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGRS-VVLTSHSMEECEALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVP--PDQPEPAIAFIRITFP-GAELREVHGSRLRFQLPPGGR-CTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQ 2118          

HSP 2 Score: 144.436 bits (363), Expect = 4.620e-35
Identity = 71/207 (34.30%), Postives = 120/207 (57.97%), Query Frame = 1
Query:  901 EGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI 1521
            EG     LG NGAGKTTT  +L+G    + G A I  H +   M     ++G CPQ++ L  +LT EE ++FY R++G+    + P  E  ++++ L       T+ LSGG +RKLS AIA +G  ++V +DEPT+G+D  +RR +W ++  +       +IL++H+++E E+L  R++++  G + C G+   L+   G  Y++ +
Sbjct:  830 EGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILGHDVQTNMAAIRPHLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAMGPERERLIRDVGLTLKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELL--LKYREGRTLILSTHHLDEAELLGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTL 1034          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. UniProt/SwissProt
Match: sp|O95477|ABCA1_HUMAN (Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3)

HSP 1 Score: 483.411 bits (1243), Expect = 8.150e-150
Identity = 255/585 (43.59%), Postives = 363/585 (62.05%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER+S AK  QF+SGV P +YW+SNF+WD+  Y++P  +V++IF+ F  +SY+ + N     +LLL YG +I P MYP SFV   PSTA+V+L + NL +G   ++ATF L+L    D  L   ND+LK +FLIFP + LGRG++D+  N    +     G      P  W+  G+ L ++ +  + ++ +   I+     R    R  N KL      ++ED DV  ER+R+       D+L++  LTKIY                      KRK AV+ IC G+  GECFGLLGVNGAGK++TFKMLTG+  +T GDAF+N +SI++ + + H+NMG+CPQFDA+  LLT  E + F+  +RG+P   +    E +++ L L+ + +K     SGGNKRKLSTA+A+IG P +VFLDEPT+GMD  ARRFLWN   ++  E ++ V+LTSH+MEECE LC R++IMVNG  +CLG+VQHLK++FGD Y + +R+     +   ++      FP G  LK+++   LQY+   SL  L+ IF      K    I DYSVSQT+LD+VF+NFAK++
Sbjct: 1670 ASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--DNKLNNINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEGVVFFLITVLIQYRFFIRP---RPVNAKLSPL---NDEDEDVRRERQRILDGGGQNDILEIKELTKIYR--------------------RKRKPAVDRICVGIPPGECFGLLGVNGAGKSSTFKMLTGDTTVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYAGNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVVKEGRS-VVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQDFFGLAFP-GSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQ 2224          

HSP 2 Score: 165.622 bits (418), Expect = 3.407e-41
Identity = 104/344 (30.23%), Postives = 178/344 (51.74%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQT--LSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIE----------------------------------NESD-------KIKAIMKTQFPQGVSLKD---ENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAK 1758
            K+AV+ +     EG+    LG NGAGKTTT  +LTG    T G A+I    I +EM    +N+G CPQ + L  +LT EE ++FY R++G+   H+K  +E    ++ L P +K  ++T  LSGG +RKLS A+A +G  K+V LDEPT+G+D  +RR +W ++  +       +IL++H+M+E +VL  R++I+ +G++ C+G+   LK++ G  Y++ +    +E                                  +ESD        I  +++    +   ++D   E    L Y          +FH  ++  ++  I+ Y +S+T+L+E+F+  A+
Sbjct:  913 KVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSTIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGL-PSSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELL--LKYRQGRTIILSTHHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAE 1253          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. UniProt/SwissProt
Match: sp|P41233|ABCA1_MOUSE (Phospholipid-transporting ATPase ABCA1 OS=Mus musculus OX=10090 GN=Abca1 PE=1 SV=4)

HSP 1 Score: 482.256 bits (1240), Expect = 2.379e-149
Identity = 256/585 (43.76%), Postives = 364/585 (62.22%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER+S AK  QF+SGV P +YW+SNF+WD+  Y++P  +V++IF+ F  +SY+ + N     +LLL YG +I P MYP SFV   PSTA+V+L + NL +G   ++ATF L+L    +  L   ND+LK +FLIFP + LGRG++D+  N    +     G      P  W+  G+ L ++ +       V+F + + +I      R +  K K   L ++ED DV  ER+R+       D+L++  LTKIY                      KRK AV+ IC G+  GECFGLLGVNGAGK+TTFKMLTG+  +T GDAF+N +SI++ + + H+NMG+CPQFDA+  LLT  E + F+  +RG+P   +    E +++ L L+ + +K     SGGNKRKLSTA+A+IG P +VFLDEPT+GMD  ARRFLWN   ++  E ++ V+LTSH+MEECE LC R++IMVNG  +CLG+VQHLK++FGD Y + +R+     +   ++      FP G  LK+++   LQY+   SL  L+ IF      K    I DYSVSQT+LD+VF+NFAK++
Sbjct: 1670 ASFVVFLIQERVSKAKHLQFISGVKPVIYWLSNFVWDMCNYVVPATLVIIIFICFQQKSYVSSTNLPVLALLLLLYGWSITPLMYPASFVFKIPSTAYVVLTSVNLFIGINGSVATFVLELFT--NNKLNDINDILKSVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPLSWDLVGRNLFAMAVEG-----VVFFLITVLIQYRFFIRPRPVKAKLPPL-NDEDEDVRRERQRILDGGGQNDILEIKELTKIYR--------------------RKRKPAVDRICIGIPPGECFGLLGVNGAGKSTTFKMLTGDTPVTRGDAFLNKNSILSNIHEVHQNMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAIRKLGLVKYGEKYASNYSGGNKRKLSTAMALIGGPPVVFLDEPTTGMDPKARRFLWNCALSIVKEGRS-VVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQEFFGLAFP-GSVLKEKHRNMLQYQLPSSLSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQ 2224          

HSP 2 Score: 168.703 bits (426), Expect = 3.976e-42
Identity = 103/343 (30.03%), Postives = 175/343 (51.02%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHT-KKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIE----------------------------------NESD-------KIKAIMKTQFPQGVSLKD---ENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAK 1758
            K+AV+ +     EG+    LG NGAGKTTT  +LTG    T G A+I    I +EM    +N+G CPQ + L  +LT EE ++FY R++G+   H+K  +E    ++ L P   K  T  LSGG +RKLS A+A +G  K+V LDEPT+G+D  +RR +W ++  +       +IL++H+M+E ++L  R++I+ +G++ C+G+   LK++ G  Y++ +    +E                                  +ESD        I  +++    +   ++D   E    L Y          +FH  ++  ++  I+ Y +S+T+L+E+F+  A+
Sbjct:  913 KVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSEMSSIRQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSKLKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELL--LKYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAE 1253          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. UniProt/SwissProt
Match: sp|P41234|ABCA2_MOUSE (ATP-binding cassette sub-family A member 2 OS=Mus musculus OX=10090 GN=Abca2 PE=1 SV=4)

HSP 1 Score: 473.396 bits (1217), Expect = 4.689e-146
Identity = 245/586 (41.81%), Postives = 356/586 (60.75%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFN-YL-QYNISGGKV--TYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCS-LKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FL+ E+ + AK  QFVSG NP +YW++N++WD++ Y++P    ++I  +F+  +Y    N  A + L L YG +I P MYP SF    PS+A+V L   NL +G   T+ATF L L +  D  LK  N  LK  FLIFP Y+LG G+M++++N Y+ +Y    G+      PF W+   + L ++ +     +F+    +   + +         +L       E+D DV  ER+R+ +   + D++K+ NLTK+Y            R +        R LAV+ +C GV+ GECFGLLGVNGAGKT+TFKMLTG+E  T G+AF+N HS++ +++   +++G+CPQFDAL   LT  E L  Y R+RGIP       V+ +L+ L L  +  K   T SGGNKRKLSTAIA+IG+P  +FLDEPT+GMD  ARRFLWN+I  +    ++ V+LTSH+MEECE LC RL+IMVNG ++CLG++QHLK++FGD Y + +R    +N  D ++      FP+ + LK+ +   +QY+     + L+ +F   E +     I DYSVSQT+LD VF+NFAK +
Sbjct: 1808 ASFVVFLVAEKSTKAKHLQFVSGCNPVIYWLANYVWDMLNYLVPATCCVIILFVFDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITATVATFLLQLFE-HDKDLKVVNSYLKSCFLIFPNYNLGHGLMEMAYNEYINEYYAKIGQFDKMKSPFEWDIVTRGLVAMTVEGFVGFFLTIMCQYNFLRQP-------QRLPVSTKPVEDDVDVASERQRVLRGDADNDMVKIENLTKVYK----------SRKIG-------RILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKMLTGDESTTGGEAFVNGHSVLKDLLQVQQSLGYCPQFDALFDELTAREHLQLYTRLRGIPWKDEAQVVKWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGRS-VVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVRTKSSQNVKDVVR-FFNRNFPEAM-LKERHHTKVQYQLKSEHISLAQVFSKMEQVVGVLGIEDYSVSQTTLDNVFVNFAKKQ 2365          

HSP 2 Score: 175.252 bits (443), Expect = 2.619e-44
Identity = 89/230 (38.70%), Postives = 139/230 (60.43%), Query Frame = 1
Query:  862 RKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESD 1551
            +KLA+N +   + E +    LG NGAGKTTT  +LTG    T G A I  H I  EM +  KN+G CPQ + L   LT EE L+FY R++ +  + I+   +  +++L L      L QTLSGG KRKLS AIA +G  + + LDEPT+G+D  ARR +W++I  +  +    ++L++H+M+E ++L  R++I+ +G++KC G+   LK  +GD Y    R+  ++  ++
Sbjct: 1003 KKLALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDRLTVEEHLWFYSRLKSMAQEEIRKETDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLI--LKYKPGRTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGAYGDGY----RLTLVKQPAE 1226          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. UniProt/SwissProt
Match: sp|Q9ESR9|ABCA2_RAT (ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus OX=10116 GN=Abca2 PE=1 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 2.415e-144
Identity = 243/586 (41.47%), Postives = 355/586 (60.58%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFN-YL-QYNISGGKV--TYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCS-LKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FL+ E+ + AK  QFVSG NP +YW++N++WD++ Y++P    ++I  +F+  +Y    N  A + L L YG +I P MYP SF    PS+A+V L   NL +G   T+ATF L L +  D  LK  N  LK  FLIFP Y+LG G+M++++N Y+ +Y    G+      PF W+   + L ++ +     +F+    +   + +         +L       E+D DV  ER+R+ +   + D++K+ NLTK+Y            R +        R LAV+ +C GV+ GECFGLLGVNGAGKT+TFKMLTG+E  T G+AF+N HS++ +++   +++G+CPQFDAL   LT  E L  Y R+RGIP       V  +L+ L L     K   + SGGNKRKLSTAIA+IG+P  +FLDEPT+GMD  ARRFLWN+I  +    ++ V+LTSH+MEECE +C RL+IMVNG ++CLG++QHLK++FGD Y + +R    +N  D ++      FP+ + LK+ +   +QY+     + L+ +F   E++     I DYSVSQT+LD VF+NFAK +
Sbjct: 1808 ASFVVFLVAEKSTKAKHLQFVSGCNPVIYWLANYVWDMLNYLVPATCCIIILFVFDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITATVATFLLQLFE-HDKDLKVVNSYLKSCFLIFPNYNLGHGLMEIAYNEYINEYYAKIGQFDKMKSPFEWDIVTRGLVAMTVEGFVGFFLTIMCQYNFLRQP-------QRLPVSTKPVEDDVDVASERQRVLRGDADNDMVKIENLTKVYK----------SRKIG-------RILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKMLTGDESTTGGEAFVNGHSVLKDLLQVQQSLGYCPQFDALFDELTAREHLQLYTRLRGIPWKDEAQVVRWALEKLELTKCADKPAGSYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGRS-VVLTSHSMEECEAVCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVRTKSSQNVKDVVR-FFNRNFPEAM-LKERHHTKVQYQLKSEHISLAQVFSKMEHVVGVLGIEDYSVSQTTLDNVFVNFAKKQ 2365          

HSP 2 Score: 175.637 bits (444), Expect = 2.264e-44
Identity = 88/216 (40.74%), Postives = 134/216 (62.04%), Query Frame = 1
Query:  862 RKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDY 1509
            +KLA+N +   + E +    LG NGAGKTTT  +LTG    T G A I  H I  EM +  KN+G CPQ + L   LT EE L+FY R++ +  + I+  ++  +++L L      L QTLSGG KRKLS AIA +G  + + LDEPT+G+D  ARR +W++I  +  +    ++L++H+M+E ++L  R++I+ +G++KC G+   LK  +GD Y
Sbjct: 1003 KKLALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDQLTVEEHLWFYSRLKSMAQEEIRKEMDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLI--LKYKPGRTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGAYGDGY 1216          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. UniProt/SwissProt
Match: sp|Q9BZC7|ABCA2_HUMAN (ATP-binding cassette sub-family A member 2 OS=Homo sapiens OX=9606 GN=ABCA2 PE=1 SV=4)

HSP 1 Score: 466.848 bits (1200), Expect = 8.029e-144
Identity = 242/586 (41.30%), Postives = 354/586 (60.41%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFN-YL-QYNISGGKV--TYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCS-LKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FL+ E+ + AK  QFVSG NP +YW++N++WD++ Y++P    ++I  +F+  +Y    N  A + L L YG +I P MYP SF    PS+A+V L   NL +G   T+ATF L L +  D  LK  N  LK  FLIFP Y+LG G+M++++N Y+ +Y    G+      PF W+   + L ++ +  +  + +    +   + R     +    +       E+D DV  ER+R+ +   + D++K+ NLTK+Y            R +        R LAV+ +C GV+ GECFGLLGVNGAGKT+TFKMLTG+E  T G+AF+N HS++ E++   +++G+CPQ DAL   LT  E L  Y R+RGI        V+ +L+ L L  +  K   T SGGNKRKLSTAIA+IG+P  +FLDEPT+GMD  ARRFLWN+I  +    ++ V+LTSH+MEECE LC RL+IMVNG ++CLG++QHLK++FGD Y + +R    ++  D ++      FP+ + LK+ +   +QY+     + L+ +F   E +     I DYSVSQT+LD VF+NFAK +
Sbjct: 1807 ASFVVFLVAEKSTKAKHLQFVSGCNPIIYWLANYVWDMLNYLVPATCCVIILFVFDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSSAYVFLIVINLFIGITATVATFLLQLFE-HDKDLKVVNSYLKSCFLIFPNYNLGHGLMEMAYNEYINEYYAKIGQFDKMKSPFEWDIVTRGLVAMAVEGVVGFLLTIMCQYNFLRRPQRMPVSTKPV-------EDDVDVASERQRVLRGDADNDMVKIENLTKVYK----------SRKIG-------RILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKMLTGDESTTGGEAFVNGHSVLKELLQVQQSLGYCPQCDALFDELTAREHLQLYTRLRGISWKDEARVVKWALEKLELTKYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGRS-VVLTSHSMEECEALCTRLAIMVNGRLRCLGSIQHLKNRFGDGYMITVRTKSSQSVKDVVR-FFNRNFPEAM-LKERHHTKVQYQLKSEHISLAQVFSKMEQVSGVLGIEDYSVSQTTLDNVFVNFAKKQ 2364          

HSP 2 Score: 175.637 bits (444), Expect = 2.086e-44
Identity = 88/218 (40.37%), Postives = 135/218 (61.93%), Query Frame = 1
Query:  856 EKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDY 1509
            + +KLA+N +   + E +    LG NGAGKTTT  +LTG    T G A I  H I  EM +  KN+G CPQ + L   LT EE L+FY R++ +  + I+  ++  +++L L      L QTLSGG KRKLS AIA +G  + + LDEPT+G+D  ARR +W++I  +  +    ++L++H+M+E ++L  R++I+ +G++KC G+   LK  +GD Y
Sbjct: 1001 DDKKLALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLFPPTSGSATIYGHDIRTEMDEIRKNLGMCPQHNVLFDRLTVEEHLWFYSRLKSMAQEEIRREMDKMIEDLELSNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWDLI--LKYKPGRTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGTYGDGY 1216          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. TrEMBL
Match: A0A0S7H654 (ABCA1 (Fragment) OS=Poeciliopsis prolifica OX=188132 GN=ABCA1 PE=4 SV=1)

HSP 1 Score: 507.294 bits (1305), Expect = 9.239e-168
Identity = 269/586 (45.90%), Postives = 371/586 (63.31%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQ-HEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLK-LSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER+S AK  QFVSGVNP +YWI+NF+WD+  YI+P  IV+VIF+ F  ++Y+   N  A I+LL+FYG AI P MYP SFV S PSTA+V+L   NL +G   ++ATF ++L  +DD ++   ND++K++ LIFP + LGRG++D++ N     +    G     DP  WE  G+ L ++ I       V+F I   I  +  C   K   +  ++L   EED DV  ER R+ + +   D+L++ +LTK+Y                      K   AV+ +C GV   ECFGLLG+NGAGKTTTFKMLTG+  ++ G+AF+N +SI  EM   H+NMG+CPQFDA+  LLT  E L FY R+RG+P + +    E  ++ L LI +  K   T SGGNKRKLSTA+A+IG P +VFLDEPT+GMD  ARRFLW+ I ++  E +  VILTSH+MEECE LC R++IMVNG  KCLG++QHLKS+FGD Y V +R+         ++  +K  FP  V LK+++  TLQY+   + + L+ IF  F   +    I DYSVSQT+LD+VF+NFA ++
Sbjct:  149 ASFVLFLIQERVSKAKHLQFVSGVNPTIYWITNFVWDMCNYIVPCFIVIVIFLCFQQKAYVSPPNLPALILLLIFYGWAITPMMYPASFVFSVPSTAYVVLTCVNLFIGINGSVATFIMEL--IDDDNISRTNDIVKQVLLIFPHFCLGRGLIDMAKNQAMATLFSNFGEDRFKDPLSWEMVGKNLLAMSI----QGAVMFIITILIQYKFFC---KPRLISAKQLATEEEDVDVARERRRVYEGRAQNDLLRISDLTKVY--------------------PGKSTPAVDQLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTEMRHVHQNMGYCPQFDAIDDLLTGREHLEFYARLRGVPEEEVAMVAEWGIQKLGLIKYANKSAGTYSGGNKRKLSTAMALIGCPPVVFLDEPTTGMDPKARRFLWDCILSVIKEGRL-VILTSHSMEECEALCTRMAIMVNGRFKCLGSIQHLKSRFGDGYTVIVRVGGSPPALKPVEDFVKLTFPDSV-LKEKHHNTLQYQLPYAQRALANIFSQFTRNQRRLGIEDYSVSQTTLDQVFVNFAHHQ 703          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. TrEMBL
Match: L7MEM9 (Putative lipid exporter abca1 (Fragment) OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 492.656 bits (1267), Expect = 4.095e-161
Identity = 255/585 (43.59%), Postives = 370/585 (63.25%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQF-PQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLIE+R SG++  QFVSG+ P+LYWI N+ WDL  YI+P  + + IF+ F  ++Y+   N G  ++LLL YG + IP MYP SF+ S PS+AFV L   NL VG ++T++T+ L+L   DD  L+    +L+K+FL+ PQY LGRG+MD+  N+L        G K    P  W+  G  L SL +  + ++     ++     R    R +      +EL    D DV  ERER+   + +  +L+V+NLTK+Y            RA         +  AVN++C GV+ GECFGLLGVNGAGKTTTFKMLTG  E+T G+AFI+ +SI  ++  A +N+G+CPQFDAL  LLT  E L FY R+RGIP  +++   +  ++ L L  +  +   T SGGNKRKL+TAIA++G P +VFLDEPT+GMD  ARRFLW+ I  +  + ++ VILTSH+MEECE LC RL+IMVNG+ +CLG++QHLK+K+G  Y V +++    +E   + ++M+  F P    L++++   ++Y+ + S+ L+ +F   E  + +  + DYSV+QT+LD+VFINFAK +
Sbjct:  127 ASFVMFLIEDRTSGSQHLQFVSGLKPFLYWIGNYTWDLCNYIVPAVLCIFIFMAFKEEAYVSHDNIGGLVLLLLLYGWSSIPLMYPSSFIFSVPSSAFVTLACCNLFVGIVSTVSTYVLELF--DDKELQSIARILRKVFLVLPQYCLGRGLMDMFSNHLTAEALARFGLKTFKHPLEWDFLGLNLISLAVQGLVYFIFTLLLQYRFFVRK---RQQTVPFDPKEL---ADQDVTQERERVLAGQADDSILQVVNLTKVY------------RA--------GQHPAVNHLCVGVRAGECFGLLGVNGAGKTTTFKMLTGNTEVTEGNAFISGYSIRTQIDLARQNIGYCPQFDALDPLLTGWEHLEFYARLRGIPEKYVQKVADWGIRKLGLHRYAHRCAGTYSGGNKRKLNTAIALVGDPPLVFLDEPTTGMDPKARRFLWDCILDVVRDGRS-VILTSHSMEECEALCSRLAIMVNGQFRCLGSIQHLKNKYGSGYTVTLKVGGTSSELSHVASLMENSFGPADAQLREQHLNQMEYQISPSVPLAVLFQRLEAARESSALDDYSVTQTTLDQVFINFAKQQ 682          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. TrEMBL
Match: C3YTK5 (ABC transporter domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_118238 PE=4 SV=1)

HSP 1 Score: 489.189 bits (1258), Expect = 1.021e-160
Identity = 258/585 (44.10%), Postives = 359/585 (61.37%), Query Frame = 1
Query:   25 SFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFN--YLQYNISGGK--VTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRF-NCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
            SFV+FL+ ER   AK  QFVSGVNP +YW+SN+ WD++ Y++P    ++I  +F+  +Y  + N  A + L L YG +I P MYP SF  + PS A+V L   NL +G   T+ATF   L Q D   L   N+ ++K FL+FP Y LGRG+MDL++N  + +Y +  G+      PF WE   + L ++    + ++F+    E     +        Y     E   +ED DV  ER+R+ +   + D++K+ NLTK+Y        K  KR          +  AV+ +C  V  GECFGLLGVNGAGKTTTFKMLTGE  +T G+AF+N HSI+ ++I  H+++G+CPQFDAL   LT    L  Y R+RGIP       V  +L+ L+L+P+  K   TLSGGNKRKLSTAIA+IGFP ++FLDEPT+GMD  ARRFLW++I+++    ++ VILTSH+MEECE LC RL+IMVNG  KCLG++QHLK++FGD Y + +R+     E  ++       FP+ V +K+ +   +QY   +  L LS IF   E ++    I DYSVSQT+LD VF+NFAK +
Sbjct:   98 SFVVFLVFERSIKAKHLQFVSGVNPVIYWVSNYAWDMLNYLLPATCCVIILTIFDLPAYTSSTNFPAVVALFLMYGWSITPMMYPVSFWFNVPSHAYVFLIVINLFIGITATVATFMFQLFQYDK-DLHAINEYMRKAFLLFPNYCLGRGLMDLAYNEYFNEYYLKIGQEDKVKSPFDWELVTRSLVAMAAEGLVFFFITILCEYKFFFK------PKYIAVSDEPIEDEDIDVANERQRILRGDADKDLMKLANLTKVY--------KTSKR--------NGQTPAVDRLCVAVPCGECFGLLGVNGAGKTTTFKMLTGEIAVTGGEAFLNGHSILKDIIKVHQSIGYCPQFDALLDELTARGHLTMYARLRGIPWSETDQVVNWALRKLALMPYADKPAGTLSGGNKRKLSTAIALIGFPPLIFLDEPTTGMDPAARRFLWDLIKSIIQTGRS-VILTSHSMEECEALCTRLAIMVNGRFKCLGSIQHLKNRFGDGYMITVRVK-PGAEVKQVVRFFNRTFPEAV-MKERHHNMVQYELKSADLSLSFIFSKMEEVQETLRIEDYSVSQTTLDNVFVNFAKKQ 656          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. TrEMBL
Match: A0A1A8AXH2 (ATP-binding cassette, sub-family A (ABC1), member 7 OS=Nothobranchius furzeri OX=105023 GN=ABCA7 PE=4 SV=1)

HSP 1 Score: 487.649 bits (1254), Expect = 2.003e-160
Identity = 262/588 (44.56%), Postives = 369/588 (62.76%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYL---QYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNY-KLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESD--KIKAIMKTQFPQGVSLKDENFITLQYRFNC-SLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLIEER+S AK  QFVSGV P LYW++NF WD++ Y +P  +V++IF+ F  Q+Y+   N  A I+LLL YG +I P MYP SFV S PSTA+V+L + NL +G   ++ATF L+L    D  L   N +LKK+FLIFP + LGRG++D++ N      +   G K   DPF W+  G+ L ++     A   VIF + + ++        + +  + +      ED DV  ERER+   K   D+L +I+L+K+Y                       RK AVN +C G+   ECFGLLGVNGAGKT+TF+MLTG+  IT+G AF++ HS++ EM   H+ MG+CPQFDA+  LLT  E L  Y R+RG+P + +    +  +K L L  ++++     SGGNKRKLSTAI+ IG P ++FLDEPTSGMD  A+RFLWN I  +T E + AV+LTSH+MEECE LC R++IMVNG  +CLG+VQHLK++FGD Y + +R++  + + D   + A M+T FP  + LK+++   LQY+ +  +  L+ IF    N      I D+SVSQT+LD+VF++FAK +
Sbjct:   22 ASFVLFLIEERVSKAKHLQFVSGVKPVLYWLANFAWDMLNYSVPAMMVVLIFISFQQQAYVSETNLPALILLLLLYGWSITPLMYPASFVFSVPSTAYVVLTSINLFIGINGSMATFVLELFV--DEHLNEINRILKKVFLIFPHFCLGRGLIDMAKNQALADAFQRLGAKPNLDPFQWDFVGKNLFAM-----AAQGVIFFVFTVLLQYKFFIYFRPWWSVPQLPPLGTEDEDVARERERVKSGKAQSDILTMIDLSKVYK--------------------SGRKPAVNRLCLGIPHSECFGLLGVNGAGKTSTFRMLTGDTPITYGKAFLSHHSVLTEMEQVHQLMGYCPQFDAISDLLTGREHLELYARLRGVPEEAVTKVAQWGVKKLGLTQYSEQEAGGYSGGNKRKLSTAISFIGAPSVIFLDEPTSGMDPKAKRFLWNCIVNVTKEGR-AVVLTSHSMEECEALCTRMAIMVNGRFQCLGSVQHLKNRFGDGYTIILRLSETKADPDDCPVDAYMRTSFP-SIELKEKHQSILQYQLSSHACCLAHIFDALANNYEELGIVDFSVSQTTLDQVFVSFAKEQ 580          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. TrEMBL
Match: A0A3B4Z3Q7 (Uncharacterized protein OS=Stegastes partitus OX=144197 PE=4 SV=1)

HSP 1 Score: 512.301 bits (1318), Expect = 6.162e-160
Identity = 263/585 (44.96%), Postives = 374/585 (63.93%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGG---KVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFN-CSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER++ AK  QFVSGVNP +YW++NF WD+  YI+P  IV+VIF+ F  ++Y+   N  A I+LL+FYG AI P MYP SFV S PSTA+V+L   NL +G   +IATF +++   DD ++   N+++K++ LIFP + LGRG++DL+ N    ++  G       +P  W+  G+ LC++ I  +  + V   I+     +    R+ + K        EED DV  ER+R+   K   D+L++ +LTK+Y                    S K   AV+ +C GV   ECFGLLG+NGAGKTTTFKMLTG+  ++ G+AF+N +SI  EM D H+N+G+CPQFDA+  LLT  E L FY R+RG+P   +    E  ++ L L+ ++ K   T SGGNKRKLSTA+A+IG P ++FLDEPT+GMD  ARRFLW+ I ++  E ++ VILTSH+MEECE LC R++IMVNG  KCLG++QHLKS+FGD Y + +R+     +   ++  +K  FP G  LK+++  TLQY+       LS++F+ F   +    I DYSVSQT+LD+VF+NFAK++
Sbjct: 1135 ASFVLFLIQERVNKAKHLQFVSGVNPTVYWVANFAWDMCNYIVPCLIVIVIFLSFQQEAYVSPPNLPALILLLVFYGWAITPMMYPASFVFSVPSTAYVVLTCINLFIGINGSIATFVMEMF--DDDNITKINNIVKQVLLIFPHFCLGRGLIDLASNQAMADLYSGFGEDRFQEPLSWDMVGKNLCAMSIQGVVMFAVTILIQYKFFCKP---RLISAKSPP---AGEEDVDVARERQRIYDGKAQNDLLRICDLTKVY--------------------SRKSTPAVDRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTEMRDVHQNLGYCPQFDAIDDLLTGREHLEFYARLRGVPEKEVAMVAEWGIQKLGLVKYSSKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIREGRS-VILTSHSMEECEALCTRMAIMVNGRFKCLGSIQHLKSRFGDGYTLIVRVGGSTPKLKPVEDFVKLNFP-GSILKEKHHNTLQYQLPFAEGALSSVFNLFTRYQRRLRIEDYSVSQTTLDQVFVNFAKHQ 1689          

HSP 2 Score: 184.111 bits (466), Expect = 9.639e-45
Identity = 104/289 (35.99%), Postives = 163/289 (56.40%), Query Frame = 1
Query:  730 RMTKRKENVDVLK--VINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQG 1590
            R T   EN+D+LK    N   +  P  N+      R +     + K KLAV+ +     E +    LG NGAGKTTT  +LTG    T G AFIN + I  +M    + +G CPQ + L + LT EE +YFY R++G   D +K  ++  ++++ L    K+L + LSGG +RKLS AIA +G  KIV LDEPT+G+D  ARR +W ++  +  +    +IL++H+M+E ++L  R++I+ NG+M+C G+   LK  FG  Y++ +  +  E  + +   I++ +   G
Sbjct:  391 RATVSDENIDLLKDAAGNSEYLEKPPPNVTAGVSVRNLVKIYKTGK-KLAVDGLSVDFYESQITSFLGHNGAGKTTTMSILTGLFPPTSGTAFINGYDICTDMDSIRRYLGMCPQHNVLFNELTVEEHIYFYARLKGRSRDEVKMEMDQIIEDVGLPHKRKELAKNLSGGMQRKLSVAIAFVGGSKIVILDEPTAGVDPYARRGIWELL--LKYKQDRTIILSTHHMDEADILGDRIAIISNGKMRCCGSPLFLKKCFGSGYYLTLVRDGTEKMAAQRSGIIQNKETDG 676          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Cavefish
Match: zgc:172302 (zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5])

HSP 1 Score: 482.641 bits (1241), Expect = 2.054e-150
Identity = 260/587 (44.29%), Postives = 369/587 (62.86%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRS--ICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNC-SLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLIEER+S AK  QFVSGV P LYW +NF+WD++ Y +P  +V++IF+ F  Q+Y+  +N  A ++LLL YG AI P MYP SFV S PSTA+V L + NL +G   +IATF L+L    +  L+  N +LKK+FLIFP + LGRG++D++ N    +     G K T +P  W+  G+ L ++ +  +   F IFTI   ++     I  R+  ++     L   ED DV  ER+R+   +   D+L +I+L+K+Y                       +K AVN +C G+  GECFGLLGVNGAGKT+TF MLTG+  +T G+AF+ +HS++ EM   H+ MG+CPQFDA++ LLT  E L FY R+RG+P  ++    +  +K L L  +  +     SGGNKRKLSTAI++IG P ++FLDEPT+GMD  A+RFLWN I ++  E + AVILTSH+MEECE LC R++IMVNG  +CLG+VQHLK++FGD Y + +R++    +   + A +K  F  G+ LK+ +   LQY+    S  L+ +F    N      + DYS+SQT+LD+VF+NFAK +
Sbjct: 1590 ASFVLFLIEERVSKAKHLQFVSGVKPILYWTANFVWDMLNYTVPATLVVLIFIGFQQQAYVSEKNLPALVLLLLLYGWAITPLMYPASFVFSVPSTAYVTLTSINLFIGINGSIATFVLELFT--NEHLREVNRILKKVFLIFPHFCLGRGLIDMAKNQAMADALQRLGTKQTLEPLEWDFVGKNLFAMAVEGVV--FFIFTI---LLQYKFFIRCRLPWFEPVLPPL-CAEDEDVGRERDRVKNGRTQDDILTLIDLSKVYK--------------------SGKKPAVNRLCLGIPRGECFGLLGVNGAGKTSTFLMLTGDTSVTCGEAFLCNHSVLTEMDRVHQLMGYCPQFDAINELLTGREHLEFYARLRGVPEAYVAKVAQWGVKKLGLTHYADREAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCIHSVIKEGR-AVILTSHSMEECEALCTRMAIMVNGRFQCLGSVQHLKNRFGDGYTIILRLSAPPKDPCPVDAYIKNSF-TGIVLKERHHNVLQYQLPSNSCSLARVFDVLSNNYEELGVTDYSISQTTLDQVFVNFAKEQ 2146          

HSP 2 Score: 158.688 bits (400), Expect = 8.745e-40
Identity = 82/217 (37.79%), Postives = 129/217 (59.45%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFV 1515
            KLAVN++     EG+    LG NGAGKTTT  +LTG    T G  +I    I  +M +  + +G CPQ + L  +LT EE ++FY  ++G+    +K  +   L+++ L     + T+ LSGG +RKLS AIA IG  K+V LDEPT+G+D  +RR +W+++  +       +IL++H M+E ++L  R++I+  G++ C G+   LKS  G  Y++
Sbjct:  871 KLAVNHLSVKFFEGQITSFLGHNGAGKTTTLSILTGLFPPTAGSVYIKGMDIRTDMNEIRRTLGVCPQHNVLFDMLTVEEHVWFYGHMKGMSSSEVKEEMASLLEDVGLTHKRHEQTKNLSGGMQRKLSVAIAFIGGSKVVILDEPTAGVDPYSRRGIWDLL--LKYRKDRTIILSTHYMDEADLLGDRIAIISQGKLCCCGSSLFLKSHLGTGYYL 1085          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Cavefish
Match: abca1a (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:103028164])

HSP 1 Score: 474.552 bits (1220), Expect = 1.296e-147
Identity = 244/585 (41.71%), Postives = 368/585 (62.91%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER++ AK  QF+SGV P+LYW++NF+WD+  YI+P  +V++IFV F  ++Y+ + N     +LLL YG +I P MYP SF    PSTA+V+L + N+L+G   +++TF L+L   ++  +   ND+LK +FLIFP + LGRG++D+  N    +     G      P  W+  G+ L ++ +  + ++F+       +I    C + + +    + +  EED DV  ER+R+     + D+L++  LTK+Y                      K+K AV+ +C G+  GECFGLLGVNGAGKT+TFKMLTG+  IT G+A++   S++ E+ + H+NMG+CPQFDA++ LLT  E L FY  +RG+P   +    +  ++ L L+ +  K   + SGGN RKLSTAIA+IG P +VFLDEPT+GMD  ARR LWN I ++  E ++ V+LTSH+MEECE LC R++IMVNG  +C+G+VQHLK++FGD Y + +R+   + + + +   ++ + P G +LK+++   LQY+   SL  L+ IF      K    I DYSVSQT+LD+VF+NFAK++
Sbjct: 1679 ASFVVFLIQERVNKAKHLQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFFITV-----LIQYRFCIKARGFSANLKPI-GEEDEDVARERQRILGGGGHSDILELRQLTKVYK--------------------RKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVITGGEAYLAGKSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVADWGIRKLGLVKYVDKAAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGRS-VVLTSHSMEECEALCTRMAIMVNGTFRCMGSVQHLKNRFGDGYTIVLRVAGADPQLEPVMKFIEHELP-GSTLKEKHRNMLQYQLPSSLSSLARIFSILAKNKDELHIEDYSVSQTTLDQVFVNFAKDQ 2233          

HSP 2 Score: 174.866 bits (442), Expect = 4.032e-45
Identity = 92/265 (34.72%), Postives = 156/265 (58.87%), Query Frame = 1
Query:  730 RMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKL-TQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI 1521
            + T ++EN +   + ++     P + I N          +     KLAV+ +  G  EG+    LG NGAGKTTT  +LTG    T G A+I    I +++    +N+G CPQ + L S+LT EE ++FY R++G+  + +K  ++  + +L L PH +K  T  LSGG +RKLS A+A +G  K+V LDEPT+G+D  ARR +W+++  +       +IL++H+M+E ++L  R++I+ +G++ C+G+   LK++ G  Y++ +
Sbjct:  879 QTTNKRENAEAFCIEDVPSDLEPGVYIENLV-------KVYRHGNKLAVDGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSDLSAIRQNLGMCPQHNVLFSMLTVEEHIWFYARLKGLSEEKVKAEMDQIVSDLGL-PHKRKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLL--LKYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTL 1133          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Cavefish
Match: abca1a (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:103028164])

HSP 1 Score: 474.552 bits (1220), Expect = 1.296e-147
Identity = 244/585 (41.71%), Postives = 368/585 (62.91%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER++ AK  QF+SGV P+LYW++NF+WD+  YI+P  +V++IFV F  ++Y+ + N     +LLL YG +I P MYP SF    PSTA+V+L + N+L+G   +++TF L+L   ++  +   ND+LK +FLIFP + LGRG++D+  N    +     G      P  W+  G+ L ++ +  + ++F+       +I    C + + +    + +  EED DV  ER+R+     + D+L++  LTK+Y                      K+K AV+ +C G+  GECFGLLGVNGAGKT+TFKMLTG+  IT G+A++   S++ E+ + H+NMG+CPQFDA++ LLT  E L FY  +RG+P   +    +  ++ L L+ +  K   + SGGN RKLSTAIA+IG P +VFLDEPT+GMD  ARR LWN I ++  E ++ V+LTSH+MEECE LC R++IMVNG  +C+G+VQHLK++FGD Y + +R+   + + + +   ++ + P G +LK+++   LQY+   SL  L+ IF      K    I DYSVSQT+LD+VF+NFAK++
Sbjct: 1679 ASFVVFLIQERVNKAKHLQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFFITV-----LIQYRFCIKARGFSANLKPI-GEEDEDVARERQRILGGGGHSDILELRQLTKVYK--------------------RKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVITGGEAYLAGKSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVADWGIRKLGLVKYVDKAAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGRS-VVLTSHSMEECEALCTRMAIMVNGTFRCMGSVQHLKNRFGDGYTIVLRVAGADPQLEPVMKFIEHELP-GSTLKEKHRNMLQYQLPSSLSSLARIFSILAKNKDELHIEDYSVSQTTLDQVFVNFAKDQ 2233          

HSP 2 Score: 174.866 bits (442), Expect = 4.032e-45
Identity = 92/265 (34.72%), Postives = 156/265 (58.87%), Query Frame = 1
Query:  730 RMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKL-TQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI 1521
            + T ++EN +   + ++     P + I N          +     KLAV+ +  G  EG+    LG NGAGKTTT  +LTG    T G A+I    I +++    +N+G CPQ + L S+LT EE ++FY R++G+  + +K  ++  + +L L PH +K  T  LSGG +RKLS A+A +G  K+V LDEPT+G+D  ARR +W+++  +       +IL++H+M+E ++L  R++I+ +G++ C+G+   LK++ G  Y++ +
Sbjct:  879 QTTNKRENAEAFCIEDVPSDLEPGVYIENLV-------KVYRHGNKLAVDGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSDLSAIRQNLGMCPQHNVLFSMLTVEEHIWFYARLKGLSEEKVKAEMDQIVSDLGL-PHKRKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLL--LKYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTL 1133          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Cavefish
Match: abca1a (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:103028164])

HSP 1 Score: 474.167 bits (1219), Expect = 1.425e-147
Identity = 244/585 (41.71%), Postives = 368/585 (62.91%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER++ AK  QF+SGV P+LYW++NF+WD+  YI+P  +V++IFV F  ++Y+ + N     +LLL YG +I P MYP SF    PSTA+V+L + N+L+G   +++TF L+L   ++  +   ND+LK +FLIFP + LGRG++D+  N    +     G      P  W+  G+ L ++ +  + ++F+       +I    C + + +    + +  EED DV  ER+R+     + D+L++  LTK+Y                      K+K AV+ +C G+  GECFGLLGVNGAGKT+TFKMLTG+  IT G+A++   S++ E+ + H+NMG+CPQFDA++ LLT  E L FY  +RG+P   +    +  ++ L L+ +  K   + SGGN RKLSTAIA+IG P +VFLDEPT+GMD  ARR LWN I ++  E ++ V+LTSH+MEECE LC R++IMVNG  +C+G+VQHLK++FGD Y + +R+   + + + +   ++ + P G +LK+++   LQY+   SL  L+ IF      K    I DYSVSQT+LD+VF+NFAK++
Sbjct: 1632 ASFVVFLIQERVNKAKHLQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQEAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFFITV-----LIQYRFCIKARGFSANLKPI-GEEDEDVARERQRILGGGGHSDILELRQLTKVYK--------------------RKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSVITGGEAYLAGKSVLTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVADWGIRKLGLVKYVDKAAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNCILSIIKEGRS-VVLTSHSMEECEALCTRMAIMVNGTFRCMGSVQHLKNRFGDGYTIVLRVAGADPQLEPVMKFIEHELP-GSTLKEKHRNMLQYQLPSSLSSLARIFSILAKNKDELHIEDYSVSQTTLDQVFVNFAKDQ 2186          

HSP 2 Score: 174.866 bits (442), Expect = 4.269e-45
Identity = 92/265 (34.72%), Postives = 156/265 (58.87%), Query Frame = 1
Query:  730 RMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKL-TQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI 1521
            + T ++EN +   + ++     P + I N          +     KLAV+ +  G  EG+    LG NGAGKTTT  +LTG    T G A+I    I +++    +N+G CPQ + L S+LT EE ++FY R++G+  + +K  ++  + +L L PH +K  T  LSGG +RKLS A+A +G  K+V LDEPT+G+D  ARR +W+++  +       +IL++H+M+E ++L  R++I+ +G++ C+G+   LK++ G  Y++ +
Sbjct:  878 QTTNKRENAEAFCIEDVPSDLEPGVYIENLV-------KVYRHGNKLAVDGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYIMGKDIRSDLSAIRQNLGMCPQHNVLFSMLTVEEHIWFYARLKGLSEEKVKAEMDQIVSDLGL-PHKRKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLL--LKYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTL 1132          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Cavefish
Match: abca4b (ATP-binding cassette, sub-family A (ABC1), member 4b [Source:ZFIN;Acc:ZDB-GENE-050517-4])

HSP 1 Score: 472.626 bits (1215), Expect = 5.398e-147
Identity = 252/591 (42.64%), Postives = 361/591 (61.08%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQ---HEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNF----IENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV++LI+ER++ AK  QFVSGV+P +YW++NF WD++ Y I  A+V+ IFV F+ + Y    N  A + LL  YG +I P MYP S++ S PSTA+V L   NL +G  ++  TF L+L + ++ SL   N+ LKK+ L+FP + LGRG++DL+ N    ++    G + + DPF W+  G+ L  + I    ++ +   I+              Y+      Q   ++ED DV  ER+R+       D+L + +L+K Y                      +++ AV+ IC GV  GECFGLLGVNGAGKTTTFKMLTG+ ++T G+A +  +SI++ ++D H+NMG+CPQFDA+  LLT  E LY Y R+RG+P   I   VE  ++ L L+ +  +   T SGGNKRKLSTAIA+IG P +V LDEPT+GMD  +RRFLWN I ++   ++ AV+LTSH+MEECE LC RL+IMVNG  KCLG ++HLK KFGD Y V +++      +  +    +A M + FP G   +++++ TLQY    S  L+ +F      K    I DYSVSQT+LD+VF+NFAK +
Sbjct: 1665 ASFVLYLIQERVTKAKHLQFVSGVSPLVYWVANFFWDMLNYGISTAMVVGIFVGFDKKCYTSPSNLPALVALLSLYGWSITPMMYPMSYIFSIPSTAYVSLSCVNLFIGINSSAITFILELFE-NNRSLLMFNEGLKKVLLVFPHFCLGRGLIDLAMNQAVTDVYARFGEEHSLDPFRWDFVGKYLVFMAIEGPVYFLLNLLIQ--------------YRFFLDHCQISVNDEDDDVAQERQRVYSGGSKNDILHIRDLSKTY--------------------VGRKRPAVDRICVGVPAGECFGLLGVNGAGKTTTFKMLTGDTDVTSGEASVAGYSILSNILDVHQNMGYCPQFDAIDELLTGREHLYLYARLRGVPEREISRVVEWGIQKLGLVEYAGRCAGTYSGGNKRKLSTAIAMIGCPPLVLLDEPTTGMDPHSRRFLWNAIMSV-IRDRRAVVLTSHSMEECEALCTRLAIMVNGTFKCLGTIEHLKYKFGDGYVVTMKIRAPKPGLSPDLGPAEAFMDSSFP-GCVQREKHYNTLQYEIAAS-SLARVFQLVAANKEKLSIEDYSVSQTTLDQVFVNFAKQQ 2217          

HSP 2 Score: 154.451 bits (389), Expect = 2.012e-38
Identity = 84/223 (37.67%), Postives = 130/223 (58.30%), Query Frame = 1
Query:  853 SEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI 1521
            S   + AVN +     EG+    LG NGAGKTTT  +LTG    T G A++N   I  +M    +++G CPQ++ L + LT EE + FY  ++G      +  VE  L++L L        Q LSGG +RKLS A+A +G  K+V LDEPTSG+D  +RR +W+++    T     VIL++H+M+E ++L  R++I+  G++ C G+   LK+ FG  +++ +
Sbjct:  950 SGSSRPAVNCLNITFYEGQITSFLGHNGAGKTTTLSILTGLFPPTSGTAYVNGMDIRTDMDAIRQSLGMCPQYNILFNHLTVEEHILFYSLLKGREQKEAEQEVEDMLEDLGLPNKRDDEAQNLSGGMQRKLSVAMAFVGGSKVVILDEPTSGVDPYSRRSIWDLLLKYRTGR--TVILSTHHMDEADLLSDRVAIISKGQLHCCGSPLFLKNCFGVGFYLTL 1170          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Sea Lamprey
Match: abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:ZFIN;Acc:ZDB-GENE-030131-9790])

HSP 1 Score: 397.897 bits (1021), Expect = 4.062e-122
Identity = 237/601 (39.43%), Postives = 349/601 (58.07%), Query Frame = 1
Query:   25 SFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQV--DDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSIC-----GRIKNYKLKEREL-QHEEDADVFLERERMTKRKENVDV------LKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFI---NDHSIVNEMIDAHKN---MGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
            SF   ++ ERI+G+KR Q +SGV+P  YW  NF +D+V Y +   + + +   F+  +Y    N GA  +LL+ +G A +P MY  S V S    AFV   + N+++G  T I+TF ++ L +  D  SL  A ++++ +FL+FPQ+ LG G++ LS   L  +I    +  DP       Q+  S  +    W FV   + +GI+  ++        I+ ++ K  E  Q E D DV  ER R+ ++   VD       L+++ L K Y            R +  S +      AV+ +  GV   +CFGLLGVNGAGKTTTFKMLTG+ + + GDA I   N HS + +M  A +    +G+CPQFDAL  LLT  E LY Y RIRGIP  HI+   +  +  L L  H  KL +T SGG KRKLSTA+A+IG P+++ LDEP+SGMD  ++R+LW  I T       +VILTSH+MEECE LC +L+IMVNG+ KCLG +QHLK++FG+ + +K+R++   ++  ++   + + FP G  LK+++   L+++   +  KLS IF   E  K +  I  YS+SQT+LD+VFINFA+ +
Sbjct: 1193 SFATAVVRERITGSKRLQQISGVSPTFYWAVNFTYDMVSYTVTTGLCIAVIAAFHLPAYTDNSNLGAVSLLLILFGFASLPWMYLISGVFSEEEMAFVTYISINIILGVSTIISTFLVNFLYLSSDSQSLYNAYNIMRWLFLVFPQFCLGWGLVSLSKQRLMEDIMK-LLGSDP-------QESSSFAMDITGWPFVALAV-NGIVCFTLRLVLTDSFIRWWRRKAVEPGQPELDTDVQAERSRVEEQSRVVDAATPDDTLQLVGLRKRY------------RLLNRSFT------AVDGLHLGVSPNQCFGLLGVNGAGKTTTFKMLTGDIQPSGGDAIIRTQNGHSALLKMEKARRTGTLIGYCPQFDALDDLLTGWEHLYCYARIRGIPSHHIEQVSQELVTRLHLSLHADKLVKTYSGGTKRKLSTALALIGKPQLLLLDEPSSGMDPKSKRYLWKTI-TREVRGGCSVILTSHSMEECEALCDKLAIMVNGQFKCLGTLQHLKNRFGNGHMIKLRLSSGNSKVTEVTEFITSHFP-GAYLKEQHISQLEFQVPSNAGKLSEIFIALEKEKESLSIQHYSISQTTLDQVFINFARQQ 1764          

HSP 2 Score: 152.14 bits (383), Expect = 1.744e-38
Identity = 100/323 (30.96%), Postives = 168/323 (52.01%), Query Frame = 1
Query:  853 SEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDH--IKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFV----KIRMNFIEN----------ESDKIKAIMKTQFPQGVSLK-----------DENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEV 1740
            S+ +K A+ ++     + +   LLG NGAGKTTT  +L G  E + G   +  H    +M +  + +G C Q D L   L   E L  Y R++ +      ++  V+  L +L L  H  KL  TLSGG KRKLS AIA IG    V LDEPTSG+D  +RR +WN+I  +       +IL++H+++E EVL  R++++ +G+++C G+ Q+LK  +G    +    K+R+  +            + +++ +++++    G +LK           D  F+   +  N  L  S +    EN++  G ++ Y++S T+L+EV
Sbjct:  391 SKGKKAALQDLSLDFYQDQITTLLGHNGAGKTTTMSLLMGLYEPSSGSVHVGGHDARTDMAEVRRQLGVCLQRDVLFPALNVHEHLLLYGRLKALDWSRQRLQQEVDTFLNDLGLYNHKDKLVGTLSGGMKRKLSIAIAFIGGSTTVILDEPTSGVDPCSRRSIWNLI--LKHRAGRTIILSTHHLDEAEVLSDRIAVLEHGKLRCCGSPQYLKEIYGQGLTLTLTKKVRVLCLSQSVTLGSRPPFDPERVVSLVRSGV-AGAALKSGEDSSGNRNADMVFLLPAHSQNV-LGQSFLVTLEENMEELG-LSGYAISDTTLEEV 708          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006855.1 (pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene:ENSPMAG00000006189.1 transcript:ENSPMAT00000006855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 304.294 bits (778), Expect = 1.015e-98
Identity = 153/308 (49.68%), Postives = 208/308 (67.53%), Query Frame = 1
Query:  862 RKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPL---DHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNC-SLKLSTIFHFFENLKANGVIADYSVSQTSLD---EVFINFAKNK 1764
            R LAV+ +C GV+ GECFGLLGVNGAGKTTTFKMLTG+  +T G+AF+N HS++ +     + +G+CPQFDAL   LT  E L  Y R+RGIP      ++  V  +L+ L L  +  K   T SGGNKRKLSTAIA+IG+P ++FLDEPT+GMD  ARRFLWN+I  +    + +V+LTSH+MEECE LC RL+IMVNG  KCLG++QHLK++FGD Y + IR     +  + ++   ++ FP  V LK+ +   +QY+    +L L+ +F   E +     + DYSVSQT+LD   +VF+NFAK +
Sbjct:    1 RILAVDRLCVGVRPGECFGLLGVNGAGKTTTFKMLTGDASVTGGEAFLNGHSVLRDQHKVQQTIGYCPQFDALFDELTAREHLELYTRLRGIPWRDEKRVRQVVNWALQKLGLTSYADKPAGTYSGGNKRKLSTAIALIGYPPLIFLDEPTTGMDPKARRFLWNLILDIIKTGR-SVVLTSHSMEECEALCTRLAIMVNGHFKCLGSIQHLKNRFGDGYMITIRTRSTLHVKEVLRFFSRS-FPDAV-LKERHHTKVQYQLKSETLSLAAVFTKMEQVLDVLGVEDYSVSQTTLDNDPQVFVNFAKKQ 305          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010397.1 (pep scaffold:Pmarinus_7.0:GL480213:155963:163950:1 gene:ENSPMAG00000009413.1 transcript:ENSPMAT00000010397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 271.166 bits (692), Expect = 3.438e-86
Identity = 131/298 (43.96%), Postives = 195/298 (65.44%), Query Frame = 1
Query:  868 LAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRF-NCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAK 1758
            +AV+ I  G+  GECFGLLG NGAGKTTTFKMLTGEE  T GDA I  +SI+ ++    + +G+CPQFD L   +T  E L+ Y R+RG+P + + P    + +   + P  ++     SGG KRKLSTA+A++G P +VFLDEP++GMD  ARR LW+ +  +  E + A+++TSH+MEECE LC R++IMVNG+ +CLG+ QHLKS++G  Y +  R+   + ++   K  ++T FP G  LKD++   + Y   + ++  + +F   E  K +  + DYS+SQ SL++VF+ FA+
Sbjct:    4 VAVDGISVGIPAGECFGLLGFNGAGKTTTFKMLTGEETATSGDAVIGGYSILTDIRKVQQRIGYCPQFDGLLEHMTGRETLWMYARLRGVP-ERLIPWATRTGRVPRVAPPHRR-----SGGTKRKLSTAVALMGSPPVVFLDEPSTGMDPVARRLLWDALSRVREEGR-ALVITSHSMEECEALCTRIAIMVNGQFRCLGSQQHLKSRYGSGYTLLARIRAEQADTQPFKHFVETTFP-GSILKDQHQGLVHYHLTDMNMSWAQVFGMLEKAKRDYCLDDYSISQISLEQVFLGFAR 293          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002495.1 (pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene:ENSPMAG00000002218.1 transcript:ENSPMAT00000002495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 1.366e-44
Identity = 83/220 (37.73%), Postives = 136/220 (61.82%), Query Frame = 1
Query:  862 RKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI 1521
            +KLAV+ +     +G+    LG NGAGKTTT  +LTG    T G A+I    I  ++    KN+G CPQ++ L   LT EE ++FY R++G      K  +E  ++++ L      ++++LSGG +RKLS  IA +G  K+VFLDEPT+G+D  ARR +WN++  +   +   +IL++H+M+E ++L  R++I+ +G ++C G+   LK+ FG  Y++ +
Sbjct:  376 KKLAVDGLSLNFYQGQITSFLGHNGAGKTTTMSILTGLFPPTAGTAYILGRDIRTDIDKIRKNLGVCPQYNVLFDRLTVEEHIWFYARLKGRSEQEAKQEIEQMIQDVDLAHKRSDISKSLSGGMQRKLSIGIAFVGGSKVVFLDEPTAGVDPYARRGIWNLL--LKYRHGRTIILSTHHMDEADLLGDRIAIISHGRLRCCGSSLFLKNAFGAGYYLTM 593          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006988.1 (pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-1 gene:ENSPMAG00000006318.1 transcript:ENSPMAT00000006988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 1.182e-26
Identity = 68/215 (31.63%), Postives = 107/215 (49.77%), Query Frame = 1
Query:  868 LAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVN-EMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDY 1509
            +A+  +   + EG+   LLG NGAGKTT   +LTG    + G      H+    +  +    +  C     L+   T   +      +   P   +   V   L    L     K  Q LSGG KRKLS A A++G P+++ LDEPTSGMD  +RR +W+++  +  + +   +L++H+MEE + L    +++  G +KC G+   LK+KFG  Y
Sbjct:  465 MALRGLSLNIYEGQITALLGHNGAGKTTLINILTGLITPSAGATHTRAHTQHQLDKFEIRNTVKCCTSLTNLYPSRTTGRERKKDVSLSSFPSPDLPSEVSRVLSATGLEKAADKQVQDLSGGQKRKLSLAAALLGKPRLLILDEPTSGMDPVSRRRVWSLL--LGGKRECVTLLSTHSMEEADALADWKAVLSQGRLKCAGSSLFLKTKFGVGY 677          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Yeast
Match: ADP1 (Putative ATP-dependent permease of the ABC transporter family [Source:SGD;Acc:S000000604])

HSP 1 Score: 72.0182 bits (175), Expect = 1.615e-13
Identity = 59/214 (27.57%), Postives = 99/214 (46.26%), Query Frame = 1
Query:  871 AVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIR---GIPLDHIKPTV-----ELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAG-ARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHL 1485
             +N I   VK G+   ++G +GAGKTT   +L  + +  H    I  + I  +     K +GF  Q D L   LT  E +     +R    +  +  K  V     EL + ++       +  + +SGG KR++S A  ++  P ++FLDEPTSG+DA  A   +  +++  +  N+T V+           L  +L ++  GEM   GN + +
Sbjct:  405 VLNEISGIVKPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKIIGFVDQDDFLLPTLTVFETVLNSALLRLPKALSFEAKKARVYKVLEELRIIDIKDRIIGNEFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASNANNVIECLVRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEMVYSGNAKKV 618          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Yeast
Match: YOL075C_mRNA (Putative ABC transporter [Source:SGD;Acc:S000005435])

HSP 1 Score: 71.633 bits (174), Expect = 2.238e-13
Identity = 57/210 (27.14%), Postives = 91/210 (43.33%), Query Frame = 1
Query:  847 LSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEE--ITHGDA----FINDHSIVNEM-------------IDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTV------ELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHN 1401
            ++S+     VN     +  G    ++G +G+GKTT   +L  +    +TH  +      +  S  NE              I  H  M + PQ D L   LTC E L F   ++    +  K  +      EL LK+ +         + LSGG KR+LS    +I  P I+FLDEPT+G+DA +   +   ++ +  E+    I++ H 
Sbjct:   36 VASKTNTTLVNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTGSEPNETEPKRAHLDGQDHPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSSERTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQ 245          

HSP 2 Score: 54.6842 bits (130), Expect = 4.757e-8
Identity = 44/186 (23.66%), Postives = 87/186 (46.77%), Query Frame = 1
Query:  898 KEGECFGLLGVNGAGKTTTFKMLTGEEEI-------THGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELS-----LKNLSLIPHTK------KLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHN 1401
            K G    ++G +G+GK++   +++G  +        T G    ND   V+E++  +         D L + LT +E L +   +R   L H+     +      +++L L  H +      +  + +SGG KR+++  + ++  P I+ LDEPTSG+D+     +  +++ +  E    +I+T H 
Sbjct:  718 KPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSIMFNDIQ-VSELMFKNVCSYVSQDDDHLLAALTVKETLKYAAALR---LHHLTEAERMERTDNLIRSLGL-KHCENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQ 898          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Yeast
Match: PDR11 (ATP-binding cassette (ABC) transporter; multidrug transporter involved in multiple drug resistance; mediates sterol uptake when sterol biosynthesis is compromised; regulated by Pdr1p; required for anaerobic growth; PDR11 has a paralog, AUS1, that arose from the whole genome duplication [Source:SGD;Acc:S000001275])

HSP 1 Score: 69.707 bits (169), Expect = 9.637e-13
Identity = 63/221 (28.51%), Postives = 111/221 (50.23%), Query Frame = 1
Query:  787 IYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECF------------GLLGVNGAGKTTTFKMLTGEEE--ITHGDAFINDHSIVNEMIDA-HKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIV-FLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHN 1401
            I +P   +NN   K +VA  + ++K  ++  NI + + + +               L+G +GAGKTT   +L+   E  +  G+  I+   + N  IDA  +++GF  Q D    LLT  E L   C +RG   D  +  + + + NL  +P ++KL   LS   ++ LS  + ++  P ++ FLDEPTSG+DA A   +   ++ ++ + + A++ T H 
Sbjct:  727 IKHPDETVNNHT-KESVA--METQKHVISWKNINYTIGDKKLINDASGYISSGLTALMGESGAGKTTLLNVLSQRTESGVVTGELLIDGQPLTN--IDAFRRSIGFVQQQDVHLELLTVRESLEISCVLRG---DGDRDYLGV-VSNLLRLP-SEKLVADLSPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSMQGQ-AILCTIHQ 936          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Yeast
Match: PDR5 (Plasma membrane ATP-binding cassette (ABC) transporter; multidrug transporter actively regulated by Pdr1p; also involved in steroid transport, cation resistance, and cellular detoxification during exponential growth; PDR5 has a paralog, PDR15, that arose from the whole genome duplication [Source:SGD;Acc:S000005679])

HSP 1 Score: 64.3142 bits (155), Expect = 4.494e-11
Identity = 72/276 (26.09%), Postives = 124/276 (44.93%), Query Frame = 1
Query:  631 IINRSICGRIKNYK-LKERELQHEED----ADVFLERERMTKR-KENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAH---KNMGFCPQFDALHSLLTCEEQLYFYCRIRG---IPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGG----NKRKLSTAIAIIGFPK-IVFLDEPTSGMDAGARRFLWNVIQTMT--TENKTAVILTSHN 1401
            +  RSI  R+K    L E+     E+    +D+  +R+ + +  +E  D    I L+K      +  N C +  +     +E R++ +NN+   VK G    L+G +GAGKTT    L   E +T G   I    +VN +       +++G+C Q D      T  E L F   +R    + ++     VE  +K L +  +   +      G     +++L+  + +   PK +VFLDEPTSG+D+   +  W++ Q M     +  A++ T H 
Sbjct:  807 VFPRSIVKRMKKRGVLTEKNANDPENVGERSDLSSDRKMLQESSEEESDTYGEIGLSKS-EAIFHWRNLCYEVQI----KAETRRI-LNNVDGWVKPGTLTALMGASGAGKTTLLDCLA--ERVTMG--VITGDILVNGIPRDKSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPAEVSIEEKNRYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDS---QTAWSICQLMKKLANHGQAILCTIHQ 1069          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Yeast
Match: AUS1 (Plasma membrane sterol transporter of the ATP-binding cassette family; required, along with Pdr11p, for uptake of exogenous sterols and their incorporation into the plasma membrane; activity is stimulated by phosphatidylserine; sterol uptake is required for anaerobic growth because sterol biosynthesis requires oxygen; AUS1 has a paralog, PDR11, that arose from the whole genome duplication [Source:SGD;Acc:S000005537])

HSP 1 Score: 64.3142 bits (155), Expect = 5.286e-11
Identity = 53/175 (30.29%), Postives = 93/175 (53.14%), Query Frame = 1
Query:  916 GLLGVNGAGKTTTFKMLTGEEE--ITHGDAFINDHSIVNEMIDAHK-NMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIV-FLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCH 1428
             L+G +GAGKTT   +L+   E  +  G+  I+ H + +E  DA K ++GF  Q D    LL+ +E L   C +RG   D  +  ++ ++ NL  +P +  L   L+   ++ LS  + ++  P ++ FLDEPTSG+DA A   +   ++ ++ + + A+  T H   +  V+ H
Sbjct:  779 ALMGESGAGKTTLLNVLSQRVETGVVSGEILIDGHPLTDE--DAFKRSIGFVQQQDLHLDLLSVKESLEISCLLRG---DGDRAYLD-TVSNLLKLP-SDILVADLNPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVKFLKQLSLQGQ-AIFCTIHQPSK-SVISH 944          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Nematostella
Match: EDO46878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNL9])

HSP 1 Score: 494.197 bits (1271), Expect = 1.245e-157
Identity = 264/585 (45.13%), Postives = 377/585 (64.44%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQ--YNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERM-TKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNC-SLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FL+ ER+S AK    VSGV PY+YW++N++WD+  Y IP  + + IF+ F  +SY    N      LLL YG +I P MYP S   S  STA+++L + NL VG   T+ATF L+L + DD  L   N VLK +FL+FP Y LGRG++DL+ N     ++  G  +T DPF W+ TG+ + ++II      FV FT+ + +I      +++  K+  + ++ EED DV  ER+R+ +      D L+++NLTK+Y                   S  KR +AV+ +C GV +GECFGLLGVNGAGKTTTFKMLTG+  +T G+ F++ HSI++++  AH++MG+CPQFDAL  LLT ++ L  Y R+RG+P  +I   V   ++ ++L+ +        SGGNKRKLSTAIA++G P IVF+DEPT+GMD  ARRFLWN+I  +  E +T VILTSH+MEECE LC+R++IMVNG+MKCLG+ QHLK+KFGD Y V +R+     +++++   +   FP  V LKD++   ++Y+  C  L +S +F   E  +    I DYSV+QT+LD+VFINFAK++
Sbjct: 1080 ASFVVFLVSERVSKAKHLHLVSGVKPYIYWLANYVWDMCNYFIPAMLCVFIFLAFGDESYTTAMNFPPTFCLLLLYGWSITPLMYPASHFFSVSSTAYIVLISINLFVGINCTLATFILELFE-DDKELTDINTVLKSVFLVFPNYCLGRGLIDLAKNQFLGIFSRFGVNLTRDPFSWDITGRNIFAMIIE----GFVFFTL-TVLIEYRFFIKLRPVKVVLKPVE-EEDDDVQRERQRVNSGLGHATDALRLMNLTKVYR------------------SRRKRIVAVDRLCVGVPKGECFGLLGVNGAGKTTTFKMLTGDIPVTSGEGFVDGHSILSDINGAHQSMGYCPQFDALDDLLTAKDHLRLYARLRGVPERYIPKVVNSLIQRMNLVQYQDVCAGKYSGGNKRKLSTAIALVGNPAIVFMDEPTTGMDPKARRFLWNIITGIMKEGRT-VILTSHSMEECEALCNRVAIMVNGQMKCLGSPQHLKNKFGDGYTVILRVAGSNPDTEQVCQFIIQCFPNAV-LKDKHHNMVEYQIPCQGLSVSRLFGHLEANRKMFDIEDYSVTQTTLDQVFINFAKDQ 1637          

HSP 2 Score: 174.096 bits (440), Expect = 2.297e-45
Identity = 86/222 (38.74%), Postives = 137/222 (61.71%), Query Frame = 1
Query:  856 EKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI 1521
            E +KLAV+ +   + EG+    LG NGAGKTTT  +LTG    THG A I+ + I  ++    +N+G CPQ + L   LT EE L+FY  ++G+    I   +E  LK++ L     +L+  LSGG KRKLS A+A +   ++V LDEPT+G+D  ARR +W+++  +  +    V+L++H+M+E +VL  R++I+  G+++C G    LKS +G+ Y++ +
Sbjct:  382 EGKKLAVDGLNLNLYEGQILSFLGHNGAGKTTTMSVLTGLFPPTHGTALISGYDIRTDIDMVRRNLGMCPQHNVLFDCLTVEEHLWFYASLKGMEKSRIPGEIEKFLKDVGLTNKRHELSANLSGGMKRKLSVAMAFVAESRVVILDEPTAGVDPYARRSIWDLL--LKYKKDRTVLLSTHHMDEADVLGDRIAIISQGKLQCCGTSLFLKSHYGNGYYLTL 601          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Nematostella
Match: EDO48951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI12])

HSP 1 Score: 357.836 bits (917), Expect = 9.229e-108
Identity = 212/600 (35.33%), Postives = 331/600 (55.17%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNI------------SGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTK------RKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCS-LKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SF+ FL++ER S AK  QFVSGV+ + YW + + WD + Y++P  ++L++F  F  + +    + G+  +LL+ +GL ++P +Y  SF   +   A+  +  + L + +   +   FL   ++   +L    +++  +F++ P Y +   ++D+S NY    I            +G + T     W+  G    +L +   A   V+F +   I  R      + Y+L        +D DV  ER R+        +KE+V    V +LTK+Y+ S                     + AV+++C G+  GECFGLLGVNGAGKTTTF MLTG++ I+ G A+++ + I   + +  + +G+CPQFDA    +T  E L  + R+RG+  D I   V  ++++L+L     KL    SGGNKRKLSTAIA++G P I+FLDEPT+GMD  ARRFLW+ + T   +   +++LTSH+MEECE LC RL+IMVNG+ KC+G+ QHLKS+FG  Y + +++          +  + + FP    L+  N + L Y+ N + L  S IF   E  +A+  I DYSVSQTSL++VF+N AK +
Sbjct: 1162 ASFITFLVQERTSKAKHLQFVSGVDAFSYWSATYTWDFLNYLVPCLLILILFAAFQIEEF--ENDMGSVFLLLILFGLVVLPFIYVMSFAFKSQLIAYA-MTVFVLSIMSFGMLLAVFL--CRIPSLNLLDEAEIMHYVFMLLPTYTVSYALIDMSTNYGYRKICSTLQTVESCRDNGIQFTDSSLNWDRPGVGQHALYMAVEA--VVLFILTLLIQVR------RPYRLIPICPWTSQDCDVAGERARVHSLNPEQIKKESV---IVKDLTKVYHGS--------------------DRTAVDHLCIGIPRGECFGLLGVNGAGKTTTFSMLTGDQSISEGTAYLDGYDIQTHLKEVQQRIGYCPQFDAFIERMTGREMLTMFARLRGVQPDKIPNVVSTTIEHLNLGKWADKLCGDYSGGNKRKLSTAIALVGNPPIIFLDEPTTGMDPVARRFLWDSL-THVMKGGRSIVLTSHSMEECEALCTRLAIMVNGQFKCVGSAQHLKSRFGMGYTLMLKVEARLVPVSNTEQFVSSTFPGAQLLESHNGM-LTYQINSTELSWSRIFGELERNRASLNIVDYSVSQTSLEQVFLNLAKEQ 1723          

HSP 2 Score: 178.718 bits (452), Expect = 6.874e-47
Identity = 150/528 (28.41%), Postives = 251/528 (47.54%), Query Frame = 1
Query:  229 IVLLLF---YGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMM----------DLSFNYLQYNISGGKVTYDPF--GWETTGQKLCSLIILFIAWWF-VIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFN--CSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAK 1758
            IV+ LF   Y +++I + +  S   SNP+ +        +L G++   A      L   + +    +   K    + P   LG G              SF+    N++      D F   W      + SL+ L + W+   +F  + GI        +K+Y        H++  +  LER +     E+          +  + ++ +  K  ++    S  S   K+AV+N+   + +G+   LLG NGAGKTTT  +LTG    T G A I++ SI+ ++    +++G CPQ + L   LT EE L F+  ++G      K  V   + +L L+   K  +  LSGG KRKL+ AIA++G  + VFLDEPTSGMD  ARR  W+++  +  +    VILT+H M+E + L  R++IM +G+++C G+   LKS++G  Y + +      +++  I A+ +T  P    L +     +++  N   S    ++F   EN K +  IA Y VS T+++EVF+   +
Sbjct:  315 IVVFLFFLCYIISMISYCFFISVFFSNPTLS--------MLFGSVLWYAALLPYQLLAQNENYDTLSQSAKASMCLLPNTCLGIGATLIARLEGFKTGASFS----NLASSPSADDHFSLAWVLGMMIISSLVYLILTWYISTVFPGQYGIPKPFYFPFMKSYWCG---FSHDDVVEAGLERVKNNPAIED----------EPTDLAIGVQIKDLRKVFKGSTGS---KVAVDNLSLNMYKGQITALLGHNGAGKTTTMSILTGLFTPTSGSAMIDNKSILTDIDGIRESLGLCPQHNVLFDRLTVEEHLEFFINLKGKYGQAAKDEVLQMITDLQLLDKRKAKSSELSGGMKRKLNCAIALVGGSETVFLDEPTSGMDPYARRATWDLL--LKHKAGKTVILTTHFMDEADFLGDRIAIMADGQLRCCGSSLFLKSRYGVGYHLTLVKKEDCDDNAIINAVRET-VPSAQVLSNVG-AEIEFVLNGEASKDFESLFVKLENNKEDYGIASYGVSCTTMEEVFMKVGE 810          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Nematostella
Match: EDO38879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBQ0])

HSP 1 Score: 322.013 bits (824), Expect = 3.257e-95
Identity = 177/429 (41.26%), Postives = 249/429 (58.04%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFN-YLQ---YNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHE-EDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFL 1293
             SFV+FL+ ER + AK  QFVSGV+P +YW+SN++WD+  Y+IP    + +  LF   +Y    N  A + L + YG +I P MYP +F  S  S+A+V +   NL VG   T+ TF L L   DD  L   NDV+K I L FP Y LGRG+MDL++N YL      I        PF W    + L  +++   A++ +   IE           +K  ++   +L  E ED DV  ER+R+ +   + D++K+ NLTKIY           KR          + LAV+ +C GV +GECFGLLGVNGAGKT+TFKMLTG+  +T GDA +N + I  ++   H+ +G+CPQFDAL   +T EE +  Y R+RG+P   IK  ++ +++ ++L  + K   +T SGGNKRKLSTAIA+IG P I+FL
Sbjct: 1384 ASFVVFLVTERSTKAKHLQFVSGVDPVVYWLSNYLWDMCNYLIPALACITLLYLFGVPAYASETNFPAVVGLFMLYGWSITPMMYPSAFCFSEASSAYVAMIVLNLFVGVTATVTTFILQLFP-DDEVLTDVNDVIKLISLGFPNYCLGRGLMDLAYNQYLSEYYRQIGEEDSIKSPFEWMIVSRNLVCMLMEGFAFFILTILIEFKFF-------LKRRRIPVSQLPIETEDEDVAAERDRVLRGDADDDLVKIENLTKIYYSR--------KRG---------KHLAVDRLCVGVPQGECFGLLGVNGAGKTSTFKMLTGDTAMTAGDAVLNSYRIATDIHRVHRCIGYCPQFDALIDEMTSEEHILLYARLRGVPEKEIKQVMKWAIRKMNLTQYAKTPCKTYSGGNKRKLSTAIALIGDPPIIFL 1787          

HSP 2 Score: 160.999 bits (406), Expect = 5.090e-41
Identity = 100/317 (31.55%), Postives = 169/317 (53.31%), Query Frame = 1
Query:  871 AVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKT-----QFPQGVSLKDENFIT-------LQYRFNC---------SLKLSTIFHFFENLKAN----GVIADYSVSQTSLDEVFI 1746
            AV+ +   + EG+    LG NGAGKTTT  +LTG    T G  +I  H I  +M     N+G CPQ + L   LT +E L+FY R++G+    +K  +   ++++ L        +TLSGG KRKLS A+A +   + V LDEPT+G+D  ARR +W+++  +  +    ++L++H MEE ++L  R++I+ +G+++C+G+  +LK +FG+ Y + +    I +    I +  ++     +  +    K  +FIT       L+++ N          S+K       F +L+ N    G I  Y ++ T L+EVF+
Sbjct:  619 AVDGLNLNLYEGQIMSFLGHNGAGKTTTMSILTGLFPPTAGTGYIYGHDIRFDMDKIRHNLGMCPQHNVLFDGLTVDEHLWFYARMKGMAAHAVKTEMNQLVEDIGLPNKRNCAVETLSGGMKRKLSVAMAFVAGSRTVILDEPTAGVDPYARRAIWDLL--IKYKKGRTILLSTHFMEEADILGDRIAIISSGKLRCVGSPLYLKRRFGEGYNLTLVKKSISSPHGSIGSFRRSTSSNLEASRRSEEKLTSFITSHISSAQLKHKTNQEFTFILPDNSIKRGAFKKLFADLEQNIDVLG-IDSYGITHTLLEEVFL 932          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Nematostella
Match: EDO32071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW57])

HSP 1 Score: 204.527 bits (519), Expect = 3.456e-60
Identity = 125/310 (40.32%), Postives = 179/310 (57.74%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQ---FPQGV---SLKDENF----ITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
            K+ V ++ FGV  GE FGLLG NGAGKTTT  M+T     + G   +  + +  E     ++MGFCPQ DAL   +T EE L  Y  +RG+P   I   V   +  + +  H  K  + LSGG KRKLS  +A++G P ++ LDEP++GMD  ARRFL   +           ILT+H+MEE + LC R+ IMV G++KCLG+ QHLKSKFG  Y ++I+++     SD     M+TQ   F +G+   + + E+F    I    + N S KLS+ F   E  K +  I +YS SQ++L++VF+ FA+ +
Sbjct:    1 KVVVKDVYFGVTPGEVFGLLGPNGAGKTTTLNMMTAGIPASRGSVSVAGYDLQTETHKVFQHMGFCPQQDALFDDITLEEHLTLYASVRGVPWASIDNVVNHYMSAMKITEHANKRAKELSGGTKRKLSFGMAMLGDPDLLLLDEPSTGMDPSARRFLCKNVT-----GARGAILTTHSMEEADALCSRVGIMVKGQLKCLGSTQHLKSKFGSGYTLEIKLSPSFQSSDP-DVDMQTQLVAFVEGLFPNAKRTESFGDRVIYKVPKSNVS-KLSSTFATLEEGKRSIGIEEYSFSQSTLEQVFLEFAREQ 303          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Nematostella
Match: EDO28092 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7F9])

HSP 1 Score: 165.236 bits (417), Expect = 1.510e-47
Identity = 88/178 (49.44%), Postives = 122/178 (68.54%), Query Frame = 1
Query: 1222 LSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYF----VKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCS-LKLSTIFHFFENLKANGVIADYSVSQTSLDEV 1740
            +SGGNKRKLSTAIA++G P I+FLDEPT+GMD  ARRFLW+ + T   +   +++LTSH+MEECE LC RL+IMVNG+ KC+G+ QHLKS+FG  Y     V+ R+  + N +++ +  + + FP    L+  N + L Y+ N + L  S IF   E  +A+  I DYSVSQTSL++V
Sbjct:    8 ISGGNKRKLSTAIALVGNPPIIFLDEPTTGMDPVARRFLWDSL-THVMKGGRSIVLTSHSMEECEALCTRLAIMVNGQFKCVGSAQHLKSRFGMGYTLMLKVEARLVPVSN-TEQAQQFVSSTFPGAQLLESHNGM-LTYQINSTELSWSRIFGELERNRASLNIVDYSVSQTSLEQV 182          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Medaka
Match: zgc:172302 (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101162276])

HSP 1 Score: 499.59 bits (1285), Expect = 2.575e-156
Identity = 273/591 (46.19%), Postives = 380/591 (64.30%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYL---QYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQH--EEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFI--ENESDKIKAIMKTQFPQGVSLKDENFITLQYRF---NCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLIEER S AK  QFVSGV P LYW++NF+WD++ Y +P A+V++IF+ F  +SY+  QN  A I+LLLFYG +I P MYP SFV + PSTA+V+L + NL +G   ++ATF L+L  VDD +L   N+VLKK+FLIFP + LGRG++D++ N      ++  G +   DPF W+  G+ L  +    +  ++ IFTI   ++       +K +   E +L     ED DV  ER R+   K + D+L +INL+K+Y                       +K AVN +C G+  GECFGLLGVNGAGKT+TF+MLTG+  ITHG+AF++ HS++ EM   H+ MG+CPQFDA+  LLT  E L  Y R+RG+P + +    +  ++ L L  + ++     SGGNKRKLSTAI++IG P ++FLDEPT+GMD  A+RFLWN I ++T E K AV+LTSH+MEECE LC R++IMVNG+ +CLG+VQHLK++FGD Y V +R+     + ES  +   M   FP  + LK+++   LQY      CSL L  IF    N      +AD+SVSQT+LD+VFI+FAK++
Sbjct: 1689 ASFVLFLIEERASKAKHLQFVSGVQPLLYWVANFIWDMLNYAVPAAMVVLIFIGFQQKSYVSEQNLPALILLLLFYGWSITPLMYPASFVFTVPSTAYVVLTSINLFIGINCSMATFVLELF-VDD-NLNQINNVLKKVFLIFPHFCLGRGLIDMAKNQAMADAFHRLGARPVLDPFQWDFVGKNLFCMAASGV--FYFIFTI---LLQYKFFIHLKPW-WTEPQLPPIGPEDEDVARERARVMSGKFHSDILTMINLSKVYKAG--------------------KKPAVNRLCLGIPPGECFGLLGVNGAGKTSTFRMLTGDTPITHGEAFLDRHSVLTEMDRVHQLMGYCPQFDAISDLLTGREHLELYARLRGVPEESVSKVAQWGVRKLGLTQYAEQKAGGYSGGNKRKLSTAISLIGAPPVIFLDEPTTGMDPKAKRFLWNCIHSVTKEGK-AVVLTSHSMEECEALCTRMAIMVNGQFQCLGSVQHLKNRFGDGYTVILRLADTKSDTESCPVDEYMTKSFPN-IELKEQHQNVLQYHLPSHGCSLAL--IFDALANNCEELGVADFSVSQTTLDQVFISFAKDQ 2247          

HSP 2 Score: 155.606 bits (392), Expect = 9.136e-39
Identity = 82/219 (37.44%), Postives = 132/219 (60.27%), Query Frame = 1
Query:  865 KLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI 1521
            KLAVN++     EG+    LG NGAGKTTT  +LTG    T G  +I    I  +M      +G CPQ + L  +LT EE ++FY  ++G+  + +K  ++  L+++ L+    + T+ LSGG +RKLS AIA +G  K+V LDEPT+G+D  +RR +W+++  +       +IL++H M+E E+L  R++I+  G++ C G+   LKS+ G  Y++ +
Sbjct:  943 KLAVNHLNLKFFEGQITSFLGHNGAGKTTTISVLTGLFPPTSGTVYIKGLDIRYDMDIIRNTLGVCPQHNVLFDILTVEEHVWFYGCLKGLSEEKVKAELDNLLEDVGLLHKRHEQTKNLSGGMQRKLSVAIAFVGGSKVVVLDEPTAGVDPYSRRGIWDLL--LKYRKGRTIILSTHYMDEAELLGDRIAIISKGKLCCCGSPLFLKSQLGSGYYLTV 1159          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Medaka
Match: ENSORLT00000046301.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 491.115 bits (1263), Expect = 1.563e-154
Identity = 251/585 (42.91%), Postives = 369/585 (63.08%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYR-FNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER+S AK  QFVSGVNP +YW+++F+WD+  Y+IP  +V+ IF+ F  ++Y+  QN  A I+LL+ YG AI P MYP SF+ + PSTA+V+L   NL +G   ++ATF ++L +  D S+   N+++K++ LIFP + LGRG+MD++ N    N+    G     DP  W   G+ L ++ I     +     I+     +    R+   K++  E   +ED DV  ER+R+ + + N DVL++ +LTK+Y                      K   AV  +C GV   ECFGLLG+NGAGKTTTFKMLTG+  ++ G+AF+N +SI  +M D H+NMG+CPQFDA++ LL   E L  Y R+RG+P + +    E  ++ L L+ +  K   T SGGNKRKLSTA+A+IG P ++FLDEPT+GMD  ARRFLW+ I ++  E ++ V+LTSH+MEECE LC R++IMVNG  +CLG++QHLK++FGD Y + +R+     +   ++  ++  FP G  LK+++  TLQY+  +    L+ IF    + +    + DYSVSQT+LD+VF+NFAK +
Sbjct: 1315 ASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLIQYKFFYKP---RLSLPKVQSEE---KEDVDVARERQRVHEGRANNDVLRICDLTKVY--------------------PRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRS-VVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVRVGGCPPDLKPVEDFVEETFP-GTVLKEKHHNTLQYQLLSQEGALAKIFTELTDHQQELGLEDYSVSQTTLDQVFVNFAKEQ 1869          

HSP 2 Score: 175.637 bits (444), Expect = 1.959e-45
Identity = 125/434 (28.80%), Postives = 202/434 (46.54%), Query Frame = 1
Query:  601 WFVIFTIESGIINRSICGRIK-NYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIE------------------NESD-------------------------KIKAIMKTQFPQGV---SLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
            W+ +FT        S+   I  N+KL +R     E    FLE+     +      + + NL KIY                       +K+AV+ +     E +    LG NGAGKTTT  +LTG    T G A IN + I  +M +  K +G CPQ + L   LT EE +YFY R++G+    ++  ++  +K++ L+   K L + LSGG +RKLS AIA +G  KIVFLDEPT+G+D  ARR +W+++  +  +    +IL++H+M+E ++L  R++I+ +G+M+C G+   LK  FG  Y++ +  +  E                   ESD                          +   ++   P+ V   S+  E    L Y        +T+F   + +     +  Y VS T+L+E+F+  A++
Sbjct:  508 WYFLFTYSYWFGKTSVPEDIPDNFKLLKRSSVPNE----FLEKPDPNMKAG----VSIRNLVKIYKTG--------------------KKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDNIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVFLDEPTAGVDPFARRGIWDLL--LKYKKGRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAED 911          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Medaka
Match: ENSORLT00000045391.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 490.73 bits (1262), Expect = 2.319e-154
Identity = 251/585 (42.91%), Postives = 369/585 (63.08%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYR-FNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER+S AK  QFVSGVNP +YW+++F+WD+  Y+IP  +V+ IF+ F  ++Y+  QN  A I+LL+ YG AI P MYP SF+ + PSTA+V+L   NL +G   ++ATF ++L +  D S+   N+++K++ LIFP + LGRG+MD++ N    N+    G     DP  W   G+ L ++ I     +     I+     +    R+   K++  E   +ED DV  ER+R+ + + N DVL++ +LTK+Y                      K   AV  +C GV   ECFGLLG+NGAGKTTTFKMLTG+  ++ G+AF+N +SI  +M D H+NMG+CPQFDA++ LL   E L  Y R+RG+P + +    E  ++ L L+ +  K   T SGGNKRKLSTA+A+IG P ++FLDEPT+GMD  ARRFLW+ I ++  E ++ V+LTSH+MEECE LC R++IMVNG  +CLG++QHLK++FGD Y + +R+     +   ++  ++  FP G  LK+++  TLQY+  +    L+ IF    + +    + DYSVSQT+LD+VF+NFAK +
Sbjct: 1315 ASFVLFLIQERVSKAKHLQFVSGVNPTVYWVASFVWDICNYVIPCFLVVGIFICFQQKAYVSPQNLPALILLLVMYGWAITPMMYPASFIFTVPSTAYVVLTCLNLFIGINGSVATFVMELFE--DESITKINNIVKQVLLIFPHFCLGRGLMDMARNQAMANVFSNFGEDRFEDPLSWNMVGKNLIAMSIQGAVMFAFTLLIQYKFFYKP---RLSLPKVQSEE---KEDVDVARERQRVHEGRANNDVLRICDLTKVY--------------------PRKSTPAVYRLCVGVPAAECFGLLGINGAGKTTTFKMLTGDIPVSSGEAFLNGYSIRTQMGDVHQNMGYCPQFDAINDLLNGREHLELYARLRGVPEEEVAMVAEWGIQKLGLVKYANKSAGTYSGGNKRKLSTAMALIGCPPVIFLDEPTTGMDPKARRFLWDCILSVIKEGRS-VVLTSHSMEECEALCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVRVGGCPPDLKPVEDFVEETFP-GTVLKEKHHNTLQYQLLSQEGALAKIFTELTDHQQELGLEDYSVSQTTLDQVFVNFAKEQ 1869          

HSP 2 Score: 176.022 bits (445), Expect = 1.648e-45
Identity = 125/434 (28.80%), Postives = 202/434 (46.54%), Query Frame = 1
Query:  601 WFVIFTIESGIINRSICGRIK-NYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIE------------------NESD-------------------------KIKAIMKTQFPQGV---SLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
            W+ +FT        S+   I  N+KL +R     E    FLE+     +      + + NL KIY                       +K+AV+ +     E +    LG NGAGKTTT  +LTG    T G A IN + I  +M +  K +G CPQ + L   LT EE +YFY R++G+    ++  ++  +K++ L+   K L + LSGG +RKLS AIA +G  KIVFLDEPT+G+D  ARR +W+++  +  +    +IL++H+M+E ++L  R++I+ +G+M+C G+   LK  FG  Y++ +  +  E                   ESD                          +   ++   P+ V   S+  E    L Y        +T+F   + +     +  Y VS T+L+E+F+  A++
Sbjct:  508 WYFLFTYSYWFGKTSVPEDIPDNFKLLKRSSVPNE----FLEKPDPNMKAG----VSIRNLVKIYKTG--------------------KKVAVDGLSVDFYENQITSFLGHNGAGKTTTMSILTGLFPPTSGTALINGYDIRTDMDNIRKYLGMCPQHNVLFDELTVEEHIYFYGRLKGLNPSELQTEMDQMIKDVGLLHKRKDLVKNLSGGMQRKLSVAIAFVGGSKIVFLDEPTAGVDPFARRGIWDLL--LKYKKGRTIILSTHHMDEADILGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKHVTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAED 911          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Medaka
Match: abca1a (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163147])

HSP 1 Score: 473.011 bits (1216), Expect = 4.087e-147
Identity = 248/587 (42.25%), Postives = 362/587 (61.67%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESG--IINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER++ AK  QF+SGV P+LYW++NF+WD+  YI+P  +V++IFV F   +Y+ + N     +LLL YG +I P MYP SF    PSTA+V+L + N+L+G   +++TF L+L   ++  +   ND+LK +FLIFP + LGRG++D+  N    +     G      P  W+  G+ L ++ +  + ++ +   I+    I  RS    +K           EED DV  ER+R+       D+L++  LTKIY                      K+K AV+ +C G+  GECFGLLGVNGAGKT+TFKMLTG+  +T G+A++   S+  E+ + H+NMG+CPQFDA++ LLT  E L FY  +RG+P   +    E  ++ L L+ +  K   + SGGN RKLSTAIA+IG P +VFLDEPT+GMD  ARR LWN I ++  E ++ V+LTSH+MEECE LC R++IMVNG  +CLG+VQHLK++FGD Y + +R+   + +   +   ++ + P G +LK+++   LQY+   SL  L+ IF      K    I DYSVSQT+LD+VF+NFAK++
Sbjct: 1675 ASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQDAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFCITVLIQYRFCITTRSSISHLKPIG--------EEDEDVARERQRVLSGSGQSDILELRELTKIYK--------------------RKQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSLVTSGEAYLAGKSVTTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVAEWGIRKLGLVKYVDKSAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNAILSIIKEGRS-VVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVAGPDPDLRPVMGFIERELP-GSTLKEKHRNMLQYQLPSSLTSLARIFSLLSKNKETLCIEDYSVSQTTLDQVFVNFAKDQ 2229          

HSP 2 Score: 171.785 bits (434), Expect = 4.714e-44
Identity = 88/224 (39.29%), Postives = 141/224 (62.95%), Query Frame = 1
Query:  853 SEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKK-LTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI 1521
            S   KLAV+ +     EG+    LG NGAGKTTT  +LTG    T G A+I    I +E+    +N+G CPQ + L S+LT EE ++FY R++G+  + +K  +E  + ++ L PH +K  T TLSGG +RKLS A+A +G  K+V LDEPT+G+D  ARR +W+++  +       +IL++H+M+E ++L  R++I+ +G++ C+G+   LK+  G  Y++ +
Sbjct:  914 SHGNKLAVDGLSLKFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSELSTIRQNLGMCPQHNVLFSMLTVEEHIWFYARLKGLSEEKVKAEMEQIVNDVGL-PHKRKSRTNTLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLL--LKYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTM 1134          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Medaka
Match: abca1a (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163147])

HSP 1 Score: 472.626 bits (1215), Expect = 5.312e-147
Identity = 250/587 (42.59%), Postives = 364/587 (62.01%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNIS---GGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESG--IINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSL-KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNK 1764
             SFV+FLI+ER++ AK  QF+SGV P+LYW++NF+WD+  YI+P  +V++IFV F   +Y+ + N     +LLL YG +I P MYP SF    PSTA+V+L + N+L+G   +++TF L+L   ++  +   ND+LK +FLIFP + LGRG++D+  N    +     G      P  W+  G+ L ++ +  + ++ +   I+    I  RS    +K           EED DV  ER+R+       D+L++  LTKIY           KR         K+K AV+ +C G+  GECFGLLGVNGAGKT+TFKMLTG+  +T G+A++   S+  E+ + H+NMG+CPQFDA++ LLT  E L FY  +RG+P   +    E  ++ L L+ +  K   + SGGN RKLSTAIA+IG P +VFLDEPT+GMD  ARR LWN I ++  E ++ V+LTSH+MEECE LC R++IMVNG  +CLG+VQHLK++FGD Y + +R+   + +   +   ++ + P G +LK+++   LQY+   SL  L+ IF      K    I DYSVSQT+LD+VF+NFAK++
Sbjct: 1645 ASFVVFLIQERVNKAKHMQFISGVQPFLYWLANFVWDMCNYIVPATLVIIIFVCFQQDAYVSSTNLPVLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSVSTFVLELFGSNE--IGGINDILKNVFLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLAWDMVGKNLFAMAVEGVVFFCITVLIQYRFCITTRSSISHLKPIG--------EEDEDVARERQRVLSGSGQSDILELRELTKIY-----------KR---------KQKPAVDRLCVGIPPGECFGLLGVNGAGKTSTFKMLTGDSLVTSGEAYLAGKSVTTEIDEVHQNMGYCPQFDAINDLLTGREHLEFYAILRGVPEKEVCEVAEWGIRKLGLVKYVDKSAGSYSGGNMRKLSTAIALIGGPPVVFLDEPTTGMDPKARRALWNAILSIIKEGRS-VVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVAGPDPDLRPVMGFIERELP-GSTLKEKHRNMLQYQLPSSLTSLARIFSLLSKNKETLCIEDYSVSQTTLDQVFVNFAKDQ 2199          

HSP 2 Score: 171.4 bits (433), Expect = 5.048e-44
Identity = 88/224 (39.29%), Postives = 141/224 (62.95%), Query Frame = 1
Query:  853 SEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKK-LTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKI 1521
            S   KLAV+ +     EG+    LG NGAGKTTT  +LTG    T G A+I    I +E+    +N+G CPQ + L S+LT EE ++FY R++G+  + +K  +E  + ++ L PH +K  T TLSGG +RKLS A+A +G  K+V LDEPT+G+D  ARR +W+++  +       +IL++H+M+E ++L  R++I+ +G++ C+G+   LK+  G  Y++ +
Sbjct:  901 SHGNKLAVDGLSLKFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGKDIRSELSTIRQNLGMCPQHNVLFSMLTVEEHIWFYARLKGLSEEKVKAEMEQIVNDVGL-PHKRKSRTNTLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLL--LKYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTM 1121          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Planmine SMEST
Match: SMESG000068605.1 (SMESG000068605.1)

HSP 1 Score: 1238.02 bits (3202), Expect = 0.000e+0
Identity = 607/611 (99.35%), Postives = 608/611 (99.51%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNKXXXXXXXXXIRNSVPLFDGQVNECYENEIQ 1854
             SFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWW VIFTIESGIINRSICGRIKNYKLKERELQHEED DVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNKSSNNENEESIRNSVPLFDGQVNECYE+EIQ
Sbjct: 1435 ASFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWSVIFTIESGIINRSICGRIKNYKLKERELQHEEDTDVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNKSSNNENEESIRNSVPLFDGQVNECYESEIQ 2045          

HSP 2 Score: 175.252 bits (443), Expect = 1.915e-45
Identity = 107/318 (33.65%), Postives = 168/318 (52.83%), Query Frame = 1
Query:  871 AVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFV---------------------KIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
            AVNN+     + +    LG NGAGKTTT  +LTG    + G AFI +  I   M    + MG CPQ + L   LT E+ +YFY  ++ +  + IK  +   ++ + L      LT+ LSGG KRKLS A+A +G  ++VFLDEPT+G+D  ARR +W+++     E++ A+ILT+H+M+E + L  R++I+  G+++C G+   LK +FG+ Y++                      I + FI+N     K + +T+    ++L        Q   NCS K   +F   +    +  I  Y +S TSL+EVF+  A +
Sbjct:  726 AVNNLNLNFYQSQITAFLGHNGAGKTTTISILTGLFAPSSGTAFILNDDIRTNMDRIRQKMGLCPQHNILFEDLTVEDHIYFYGLLKRMDKNMIKNIIPKIIEEVGLTKKISSLTKNLSGGMKRKLSVALAFVGDSRVVFLDEPTAGVDPFARRGIWDLLVKYRCEDR-AIILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIALP-------QSENNCS-KFPDLFDNLDRAMEDLGIVTYGLSDTSLEEVFLKVADD 1034          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Planmine SMEST
Match: SMESG000032861.1 (SMESG000032861.1)

HSP 1 Score: 921.768 bits (2381), Expect = 0.000e+0
Identity = 431/584 (73.80%), Postives = 505/584 (86.47%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHE-EDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNF---IENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
             SFVIFLIEERI+G+KRQQ VSGVNPY+YW+SNF+WD++KYI+P+ I+++IFV F+YQSYIG++N GAFI LL+FYGLAIIPHMYPFSF+LS PSTAFV+LDAYNLL+G+ITTI+TFFLDLLQ DD +LKP NDVLKK+FL+FPQY LGRGMMDLSFNYL +NIS GK  YDPFGW TTG+KLCSL +LF+ WW V+F IESGIINR +CG+IKN  LK +E++ E ED DV +ERER+   K + DVLKVI LTK+YN SLN+ N CCK+ V D+L +EKRKLAVNN+CFGV+EGECFGLLGVNGAGKTTTFKMLTGEEEITHG+AFIN  SI+++MI AH+NMGFCPQFDALH+LLTCEEQL FYCRIRGI  + IK  V+ SL+NLSL PH  KLTQ LSGGNKRKLSTAIA+IG PK++FLDEPTSGMDAGARRFLWNVIQ MT ENK AVILTSHNMEECE LCHRLSIMVNGEMKCLG+VQHLKSKFGDDY+V IRM F    EN+++K+KAI++ +FP  VS  D +F+TLQYRF  S KL+ IF FFENLK + +I DYSVSQT+LD+VFINFA++
Sbjct: 1408 ASFVIFLIEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVVLDAYNLLLGSITTISTFFLDLLQQDDETLKPVNDVLKKVFLLFPQYGLGRGMMDLSFNYLTFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVFIIESGIINRMLCGKIKNRNLKAKEMKDEFEDVDVAVERERIISEKISDDVLKVIKLTKVYNQSLNVKNTCCKKVVKDTLENEKRKLAVNNLCFGVQEGECFGLLGVNGAGKTTTFKMLTGEEEITHGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIKSNQIKSVVDRSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVTIRMPFGKDHENDNEKVKAIIEDKFPSEVSFVDGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILDYSVSQTTLDDVFINFARD 1991          

HSP 2 Score: 176.022 bits (445), Expect = 1.220e-45
Identity = 110/320 (34.38%), Postives = 170/320 (53.12%), Query Frame = 1
Query:  871 AVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDE---NFITL--------------------QYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
            AV+++     + +    LG NGAGKTTT  +LTG    T G A+I +  I ++M    + MG CPQ + L S LT E+ +YFY  ++G+  + I+  +   ++++ L    K  ++ LSGG KRKLS A+A IG  K+VFLDEPT+G+D  ARR +W+++     + +T +ILT+H+M+E + L  R++I+  G+++C G+   LK +FGD Y++ +  N    E D         F  G+S   E   NFI                      Q   N S K S +F   +   +   I  Y +S TSL+EVF+  A +
Sbjct:  700 AVDDLNLNFYQSQITAFLGHNGAGKTTTISILTGIFSATSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDERT-IILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEED---------FRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEIN-SGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADD 1008          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Planmine SMEST
Match: SMESG000032891.1 (SMESG000032891.1)

HSP 1 Score: 916.376 bits (2367), Expect = 0.000e+0
Identity = 429/584 (73.46%), Postives = 503/584 (86.13%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHE-EDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIE---NESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
             SFVIFLIEERI+G+KRQQ VSGVNPY+YW+SNF+WD++KYI+P+ I+++IFV F+YQSYIG++N GAFI LL+FYGLAIIPHMYPFSF+LS PSTAFV+LDAYNLLVG+ITTI+TFFLDLLQ DD +LKP NDVLKK+FL+FPQY LGRGMMDLSFNYL +NIS GK  YDPFGW TTG+KLCSL +LF+ WW V+  IESGIINR++CG+IKN  LK +E++ E ED DV +ERER+   K + DVLKVI LTK+YN SLN+ N CCK+ V D+L +EKRKLAVNN+CFGV+EGECFGLLGVNGAGKTTTFKMLTGEEEIT G+AFIN  SI+++MI AH+NMGFCPQFDALH+LLTCEEQL FYCRIRGI  + IK  V+ SL+NLSL PH  KLTQ LSGGNKRKLSTAIA+IG PK++FLDEPTSGMDAGARRFLWNVIQ MT ENK AVILTSHNMEECE LCHRLSIMVNGEMKCLG+VQHLKSKFGDDY+V IRM F +   N++ K+KAI++ +FP  VS  D +F+TLQYRF  S KL+ IF FFENLK + +I DYSVSQT+LD+VFINFA++
Sbjct: 1398 ASFVIFLIEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVVLDAYNLLVGSITTISTFFLDLLQKDDETLKPVNDVLKKVFLLFPQYGLGRGMMDLSFNYLTFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVLIIESGIINRTLCGKIKNRNLKAKEIKDEFEDVDVAVERERIISEKISDDVLKVIKLTKVYNQSLNVKNTCCKKVVKDALENEKRKLAVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITRGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAVILTSHNMEECEALCHRLSIMVNGEMKCLGSVQHLKSKFGDDYYVTIRMPFGKDHANDNGKVKAIIEDKFPSEVSFVDGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILDYSVSQTTLDDVFINFARD 1981          

HSP 2 Score: 174.096 bits (440), Expect = 5.088e-45
Identity = 107/319 (33.54%), Postives = 171/319 (53.61%), Query Frame = 1
Query:  871 AVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDE---NFITL---------QYRFNCSL----------KLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
            AV+++     + +    LG NGAGKTTT  +LTG    + G A+I +  + ++M    + MG CPQ + L S LT E+ +YFY  ++G+  + I+  +   ++++ L    K  ++ LSGG KRKLS A+A IG  K+VFLDEPT+G+D  ARR +WN++     + +T +ILT+H+M+E + L  R++I+  G+++C G+   LK +FGD Y++ +  N    E D         F  G+S   E   NFI           + R   ++          K S +F   +   +   I  Y +S TSL+EVF+  A +
Sbjct:  690 AVDDLNLNFYQSQITAFLGHNGAGKTTTISILTGIFSPSSGTAYILNEDLRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSIAMAFIGDSKVVFLDEPTAGVDPFARRGIWNLLIKYRNDERT-IILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEED---------FRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLSQNEINNGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADD 998          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Planmine SMEST
Match: SMESG000032896.1 (SMESG000032896.1)

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 396/586 (67.58%), Postives = 476/586 (81.23%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHE-EDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMK--CLGNVQHLKSKFGDDYFVKIRMNF---IENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
             SFVIFL EERI+G+KRQQ VSGVNPY+YW+SNF+WD++KYI+P+ I+++IFV F+YQSYIG++N GAFI LL+FYGLAIIPHMYPFSF+LS PSTAFV L+AYNL +G+ITTI+TF LDLLQ DD +LKP ND LKK+FL+FPQY LGRGMMDLSFNYL++NIS GK  YDPFGW TTG+KLCSL +LF+ WW V+F IESGIINR++CG+IKN  LK +E++ E ED DV +ERER+   K + DVLKVI LTK+YN SLN+ N CCK  V D+L +EKR+LAVNN+CFGV+EGECFGLLGVNGAGKTTTFKMLTGEEEIT G+AFIN  SI+++MI AH+NMGFCPQFDALH+LLTCEEQL FYCRIRGI  + IK  V+ SL+NLSL PH  KLTQ LSGGNKRKLSTAIA+IG PK++FLDEPTSGMDAGARRFLWNVIQ MT ENK A +                    NGE +   LG+VQHLKSKFGDDY+V IRM F    EN+++K+KAI++ +F   VS  + +F+TLQYRF  S KL+ IF FFENLK + +I  YSVSQT+L++VFINFA++
Sbjct: 1382 ASFVIFLSEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVNLNAYNLFLGSITTISTFLLDLLQKDDETLKPVNDFLKKVFLLFPQYGLGRGMMDLSFNYLKFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVFIIESGIINRTLCGKIKNRNLKAKEMKDEFEDVDVAVERERIISEKISDDVLKVIKLTKVYNQSLNVKNTCCKNVVKDALENEKRELAVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITRGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAAV-------------------NNGEWRNEVLGSVQHLKSKFGDDYYVTIRMPFGKDHENDNEKVKAIIEDKFRSEVSFVNGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILYYSVSQTTLNDVFINFARD 1948          

HSP 2 Score: 173.326 bits (438), Expect = 1.038e-44
Identity = 108/320 (33.75%), Postives = 167/320 (52.19%), Query Frame = 1
Query:  871 AVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDE---NFITL--------------------QYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
            AV+N+     + +    LG NG GKTTT  +LTG    T G A+I +  I ++M    + MG CPQ + L S LT E+ +YFY  ++G+  + I+  +   ++++ L    K  ++ LSGG KRKLS A+A IG  K+VFLDEPT+G+D  ARR +W+++     + +T +ILT+H+M+E + L  R++I+  G+++C G+   LK +FGD Y++ +  N    E D         F  G+S   E   NFI                      Q   N   K S +F   +   +      Y +S TSL+EVF+  A +
Sbjct:  690 AVDNLNLNFYQSQITAFLGHNGDGKTTTISILTGIFSATSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDERT-IILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEED---------FRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINIG-KFSDLFADIDRSLSGLNFVSYGLSDTSLEEVFLKVADD 998          
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Planmine SMEST
Match: SMESG000032896.1 (SMESG000032896.1)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 396/586 (67.58%), Postives = 476/586 (81.23%), Query Frame = 1
Query:   22 TSFVIFLIEERISGAKRQQFVSGVNPYLYWISNFMWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHMYPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPANDVLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLCSLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHE-EDADVFLERERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLAVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMK--CLGNVQHLKSKFGDDYFVKIRMNF---IENESDKIKAIMKTQFPQGVSLKDENFITLQYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
             SFVIFL EERI+G+KRQQ VSGVNPY+YW+SNF+WD++KYI+P+ I+++IFV F+YQSYIG++N GAFI LL+FYGLAIIPHMYPFSF+LS PSTAFV L+AYNL +G+ITTI+TF LDLLQ DD +LKP ND LKK+FL+FPQY LGRGMMDLSFNYL++NIS GK  YDPFGW TTG+KLCSL +LF+ WW V+F IESGIINR++CG+IKN  LK +E++ E ED DV +ERER+   K + DVLKVI LTK+YN SLN+ N CCK  V D+L +EKR+LAVNN+CFGV+EGECFGLLGVNGAGKTTTFKMLTGEEEIT G+AFIN  SI+++MI AH+NMGFCPQFDALH+LLTCEEQL FYCRIRGI  + IK  V+ SL+NLSL PH  KLTQ LSGGNKRKLSTAIA+IG PK++FLDEPTSGMDAGARRFLWNVIQ MT ENK A +                    NGE +   LG+VQHLKSKFGDDY+V IRM F    EN+++K+KAI++ +F   VS  + +F+TLQYRF  S KL+ IF FFENLK + +I  YSVSQT+L++VFINFA++
Sbjct: 1379 ASFVIFLSEERITGSKRQQIVSGVNPYVYWMSNFLWDILKYIVPIFIIVLIFVAFDYQSYIGSKNLGAFITLLIFYGLAIIPHMYPFSFLLSTPSTAFVNLNAYNLFLGSITTISTFLLDLLQKDDETLKPVNDFLKKVFLLFPQYGLGRGMMDLSFNYLKFNISNGKQDYDPFGWSTTGEKLCSLSVLFVGWWIVVFIIESGIINRTLCGKIKNRNLKAKEMKDEFEDVDVAVERERIISEKISDDVLKVIKLTKVYNQSLNVKNTCCKNVVKDALENEKRELAVNNLCFGVREGECFGLLGVNGAGKTTTFKMLTGEEEITRGNAFINGQSIISDMIGAHRNMGFCPQFDALHALLTCEEQLTFYCRIRGIESNQIKSVVDTSLRNLSLTPHATKLTQNLSGGNKRKLSTAIALIGNPKVIFLDEPTSGMDAGARRFLWNVIQKMTNENKIAAV-------------------NNGEWRNEVLGSVQHLKSKFGDDYYVTIRMPFGKDHENDNEKVKAIIEDKFRSEVSFVNGSFVTLQYRFASSTKLAVIFDFFENLKKDSIILYYSVSQTTLNDVFINFARD 1945          

HSP 2 Score: 172.94 bits (437), Expect = 1.126e-44
Identity = 108/320 (33.75%), Postives = 167/320 (52.19%), Query Frame = 1
Query:  871 AVNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIVNEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELSLKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAGARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGNVQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDE---NFITL--------------------QYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKN 1761
            AV+N+     + +    LG NG GKTTT  +LTG    T G A+I +  I ++M    + MG CPQ + L S LT E+ +YFY  ++G+  + I+  +   ++++ L    K  ++ LSGG KRKLS A+A IG  K+VFLDEPT+G+D  ARR +W+++     + +T +ILT+H+M+E + L  R++I+  G+++C G+   LK +FGD Y++ +  N    E D         F  G+S   E   NFI                      Q   N   K S +F   +   +      Y +S TSL+EVF+  A +
Sbjct:  687 AVDNLNLNFYQSQITAFLGHNGDGKTTTISILTGIFSATSGTAYILNEDIRSDMDKIREKMGLCPQHNILFSNLTVEDHIYFYGLLKGMKTEEIREILPKIIEDVGLTKKMKSFSKNLSGGMKRKLSVAMAFIGDSKVVFLDEPTAGVDPFARRGIWDLLIKYRNDERT-IILTTHHMDEADYLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEED---------FRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINIG-KFSDLFADIDRSLSGLNFVSYGLSDTSLEEVFLKVADD 995          
The following BLAST results are available for this feature:
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA11.697e-15043.59ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA41.386e-14741.43ATP binding cassette subfamily A member 4 [Source:... [more]
ABCA21.672e-14441.30ATP binding cassette subfamily A member 2 [Source:... [more]
ABCA21.757e-14441.30ATP binding cassette subfamily A member 2 [Source:... [more]
ABCA21.917e-14441.30ATP binding cassette subfamily A member 2 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abt-29.124e-9433.77ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-21.300e-9333.77ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
abt-41.866e-9032.69ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
ced-74.048e-7029.88ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
ced-74.054e-7029.88ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA7.358e-9633.76gene:FBgn0031170 transcript:FBtr0332488[more]
ABCA1.028e-9533.76gene:FBgn0031170 transcript:FBtr0306679[more]
ABCA1.130e-9533.76gene:FBgn0031170 transcript:FBtr0332489[more]
CG60521.028e-8230.85gene:FBgn0036747 transcript:FBtr0075195[more]
CG341201.379e-6030.30gene:FBgn0083956 transcript:FBtr0299591[more]
back to top
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca1a5.119e-14842.56ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1a5.119e-14842.56ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1b2.718e-14642.39ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1b3.251e-14642.39ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca24.208e-14542.15ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klf96.475e-15844.05Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
klf91.954e-15044.05Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
klf92.058e-15044.05Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
klf92.899e-15044.05Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
klf93.118e-15044.05Kruppel-like factor 9 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abca13.401e-15043.76ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca46.061e-15041.05ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca27.814e-14741.81ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca45.187e-14341.05ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca79.678e-12940.48ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95477|ABCA1_HUMAN8.150e-15043.59Phospholipid-transporting ATPase ABCA1 OS=Homo sap... [more]
sp|P41233|ABCA1_MOUSE2.379e-14943.76Phospholipid-transporting ATPase ABCA1 OS=Mus musc... [more]
sp|P41234|ABCA2_MOUSE4.689e-14641.81ATP-binding cassette sub-family A member 2 OS=Mus ... [more]
sp|Q9ESR9|ABCA2_RAT2.415e-14441.47ATP-binding cassette sub-family A member 2 OS=Ratt... [more]
sp|Q9BZC7|ABCA2_HUMAN8.029e-14441.30ATP-binding cassette sub-family A member 2 OS=Homo... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0S7H6549.239e-16845.90ABCA1 (Fragment) OS=Poeciliopsis prolifica OX=1881... [more]
L7MEM94.095e-16143.59Putative lipid exporter abca1 (Fragment) OS=Rhipic... [more]
C3YTK51.021e-16044.10ABC transporter domain-containing protein OS=Branc... [more]
A0A1A8AXH22.003e-16044.56ATP-binding cassette, sub-family A (ABC1), member ... [more]
A0A3B4Z3Q76.162e-16044.96Uncharacterized protein OS=Stegastes partitus OX=1... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1723022.054e-15044.29zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5][more]
abca1a1.296e-14741.71ATP-binding cassette sub-family A member 1-like [S... [more]
abca1a1.296e-14741.71ATP-binding cassette sub-family A member 1-like [S... [more]
abca1a1.425e-14741.71ATP-binding cassette sub-family A member 1-like [S... [more]
abca4b5.398e-14742.64ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca124.062e-12239.43ATP-binding cassette, sub-family A (ABC1), member ... [more]
ENSPMAT00000006855.11.015e-9849.68pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene... [more]
ENSPMAT00000010397.13.438e-8643.96pep scaffold:Pmarinus_7.0:GL480213:155963:163950:1... [more]
ENSPMAT00000002495.11.366e-4437.73pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene... [more]
ENSPMAT00000006988.11.182e-2631.63pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ADP11.615e-1327.57Putative ATP-dependent permease of the ABC transpo... [more]
YOL075C_mRNA2.238e-1327.14Putative ABC transporter [Source:SGD;Acc:S00000543... [more]
PDR119.637e-1328.51ATP-binding cassette (ABC) transporter; multidrug ... [more]
PDR54.494e-1126.09Plasma membrane ATP-binding cassette (ABC) transpo... [more]
AUS15.286e-1130.29Plasma membrane sterol transporter of the ATP-bind... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468781.245e-15745.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489519.229e-10835.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388793.257e-9541.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320713.456e-6040.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO280921.510e-4749.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1723022.575e-15646.19ATP-binding cassette sub-family A member 1 [Source... [more]
ENSORLT00000046301.11.563e-15442.91ATP-binding cassette sub-family A member 1-like [S... [more]
ENSORLT00000045391.12.319e-15442.91ATP-binding cassette sub-family A member 1-like [S... [more]
abca1a4.087e-14742.25ATP-binding cassette sub-family A member 1 [Source... [more]
abca1a5.312e-14742.59ATP-binding cassette sub-family A member 1 [Source... [more]
back to top
BLAST of ATP-binding cassette sub-family A member 7-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068605.11.915e-4599.35SMESG000068605.1[more]
SMESG000032861.11.220e-4573.80SMESG000032861.1[more]
SMESG000032891.15.088e-4573.46SMESG000032891.1[more]
SMESG000032896.11.038e-4467.58SMESG000032896.1[more]
SMESG000032896.11.126e-4467.58SMESG000032896.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012205 ID=SMED30012205|Name=ATP-binding cassette sub-family A member 7-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2001bp
AAATACTCAAATGTTTCTTGAACAAGTTTTGTGATATTTTTGATCGAAGA
ACGAATCTCTGGAGCAAAGAGACAACAGTTTGTATCGGGAGTAAACCCTT
ATCTGTATTGGATTTCCAATTTCATGTGGGATTTGGTTAAATACATTATT
CCGGTTGCAATAGTTCTGGTAATATTTGTATTGTTCAATTACCAGTCTTA
TATTGGTACTCAAAACGCAGGGGCATTTATCGTTCTTCTACTTTTCTACG
GATTGGCCATTATTCCTCACATGTATCCATTTAGCTTTGTCTTATCCAAT
CCTAGCACCGCTTTTGTAATTCTTGACGCCTACAATCTTTTAGTTGGAGC
TATAACTACGATTGCAACTTTTTTCCTCGATCTTTTACAAGTAGATGATC
CATCATTGAAGCCAGCGAACGATGTGTTAAAAAAAATATTTTTGATTTTT
CCTCAATATGATCTTGGAAGAGGCATGATGGATTTGTCCTTCAACTACTT
ACAGTATAATATTAGTGGGGGGAAAGTAACATATGATCCGTTTGGTTGGG
AAACCACCGGACAGAAATTATGTTCTCTAATAATTTTATTCATTGCTTGG
TGGTTTGTTATTTTCACGATTGAAAGTGGAATAATTAATCGAAGTATTTG
TGGTAGGATAAAGAATTATAAATTAAAAGAGAGAGAACTTCAACACGAAG
AAGATGCAGATGTGTTTTTGGAAAGAGAAAGAATGACCAAAAGAAAGGAA
AATGTTGATGTATTGAAAGTAATTAATTTGACTAAAATATATAATCCCTC
TTTGAATATAAATAACAAGTGTTGCAAAAGAGCAGTTGCGGATTCATTGT
CAAGTGAGAAACGTAAACTTGCTGTAAATAACATATGTTTCGGAGTTAAG
GAAGGTGAATGTTTCGGACTGCTAGGAGTCAATGGAGCGGGTAAAACGAC
GACTTTTAAAATGCTAACTGGAGAAGAAGAAATAACTCATGGTGATGCAT
TTATAAATGACCATTCAATTGTTAATGAGATGATTGATGCCCATAAAAAC
ATGGGGTTTTGTCCGCAATTCGATGCATTGCATTCTTTATTAACATGCGA
AGAACAATTGTACTTTTATTGTCGAATTCGAGGAATACCGTTGGATCACA
TCAAACCAACTGTTGAATTAAGCTTGAAGAATTTGAGTCTCATTCCTCAC
ACGAAAAAGTTAACTCAAACTCTTTCGGGAGGAAATAAACGAAAATTGTC
TACAGCGATAGCTATAATTGGGTTTCCGAAAATTGTTTTTCTAGATGAAC
CCACTAGTGGAATGGATGCTGGGGCTCGTCGATTTCTTTGGAATGTCATA
CAAACTATGACAACAGAGAATAAAACCGCCGTCATATTGACATCACATAA
CATGGAGGAGTGCGAAGTCCTCTGTCATAGGTTGTCTATTATGGTGAATG
GAGAAATGAAATGCTTGGGAAATGTCCAACATTTAAAGTCTAAATTCGGT
GACGATTATTTTGTAAAAATTAGAATGAATTTTATTGAAAATGAAAGCGA
TAAAATAAAGGCTATTATGAAAACTCAATTTCCTCAAGGGGTTTCTCTGA
AAGACGAAAACTTCATTACTCTTCAATATCGGTTCAATTGTTCTTTGAAG
TTGTCCACCATTTTTCACTTTTTTGAAAATCTCAAAGCCAACGGCGTAAT
TGCGGATTATTCGGTTTCACAAACCTCACTGGACGAAGTTTTCATCAACT
TTGCTAAAAATAAATCTTCTAACAATGAAAATGAAGAAAGTATCAGAAAT
TCTGTACCCCTATTCGACGGCCAAGTGAATGAATGCTATGAAAACGAAAT
TCAATGACTTTATTTTATTCTTTGTTTTATTGAACTTGATTTTATTAATT
TTTATTTTAATTAGAATTTCACTTATTTATTTCTGGTCAGATTCTATTTT
TATTTATTTGATCTTTTTGACAAGTTTCATACATTATTCGTTTAAATTCA
C
back to top

protein sequence of SMED30012205-orf-1

>SMED30012205-orf-1 ID=SMED30012205-orf-1|Name=SMED30012205-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=578bp
MWDLVKYIIPVAIVLVIFVLFNYQSYIGTQNAGAFIVLLLFYGLAIIPHM
YPFSFVLSNPSTAFVILDAYNLLVGAITTIATFFLDLLQVDDPSLKPAND
VLKKIFLIFPQYDLGRGMMDLSFNYLQYNISGGKVTYDPFGWETTGQKLC
SLIILFIAWWFVIFTIESGIINRSICGRIKNYKLKERELQHEEDADVFLE
RERMTKRKENVDVLKVINLTKIYNPSLNINNKCCKRAVADSLSSEKRKLA
VNNICFGVKEGECFGLLGVNGAGKTTTFKMLTGEEEITHGDAFINDHSIV
NEMIDAHKNMGFCPQFDALHSLLTCEEQLYFYCRIRGIPLDHIKPTVELS
LKNLSLIPHTKKLTQTLSGGNKRKLSTAIAIIGFPKIVFLDEPTSGMDAG
ARRFLWNVIQTMTTENKTAVILTSHNMEECEVLCHRLSIMVNGEMKCLGN
VQHLKSKFGDDYFVKIRMNFIENESDKIKAIMKTQFPQGVSLKDENFITL
QYRFNCSLKLSTIFHFFENLKANGVIADYSVSQTSLDEVFINFAKNKSSN
NENEESIRNSVPLFDGQVNECYENEIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR026082ABCA
IPR003593AAA+_ATPase
IPR003439ABC_transporter-like
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0016887ATPase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0005102signaling receptor binding
GO:0005215transporter activity
GO:0005515protein binding
GO:0005548phospholipid transporter activity
GO:0008509anion transmembrane transporter activity
GO:0017127cholesterol transporter activity
GO:0019905syntaxin binding
GO:0031267small GTPase binding
GO:0090554phosphatidylcholine-translocating ATPase activity
GO:0090556phosphatidylserine-translocating ATPase activity
GO:0034185apolipoprotein binding
GO:0034186apolipoprotein A-I binding
GO:0034188apolipoprotein A-I receptor activity
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0051117ATPase binding
Vocabulary: biological process
TermDefinition
GO:0002790peptide secretion
GO:0006497protein lipidation
GO:0006810transport
GO:0006911phagocytosis, engulfment
GO:0007040lysosome organization
GO:0007186G-protein coupled receptor signaling pathway
GO:0007584response to nutrient
GO:0008203cholesterol metabolic process
GO:0010875positive regulation of cholesterol efflux
GO:0015914phospholipid transport
GO:0015917aminophospholipid transport
GO:0016197endosomal transport
GO:0030301cholesterol transport
GO:0030819positive regulation of cAMP biosynthetic process
GO:0032367intracellular cholesterol transport
GO:0032489regulation of Cdc42 protein signal transduction
GO:0033344cholesterol efflux
GO:0060155platelet dense granule organization
GO:0071222cellular response to lipopolysaccharide
GO:0071300cellular response to retinoic acid
GO:0071397cellular response to cholesterol
GO:0098656anion transmembrane transport
GO:0033700phospholipid efflux
GO:0034380high-density lipoprotein particle assembly
GO:0034616response to laminar fluid shear stress
GO:0038027apolipoprotein A-I-mediated signaling pathway
GO:0042157lipoprotein metabolic process
GO:0042158lipoprotein biosynthetic process
GO:0042493response to drug
GO:0042632cholesterol homeostasis
GO:0043691reverse cholesterol transport
GO:0045332phospholipid translocation
GO:0050702interleukin-1 beta secretion
GO:0055085transmembrane transport
GO:0055091phospholipid homeostasis
GO:0055098response to low-density lipoprotein particle
Vocabulary: cellular component
TermDefinition
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0009897external side of plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030139endocytic vesicle
GO:0034364high-density lipoprotein particle
GO:0043231intracellular membrane-bounded organelle
GO:0045121membrane raft
GO:0045335phagocytic vesicle
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 260..444
e-value: 2.4E-4
score: 30.5
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 252..395
e-value: 3.4E-23
score: 82.7
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 214..467
score: 16.613
NoneNo IPR availablePFAMPF12698ABC2_membrane_3coord: 2..162
e-value: 1.2E-13
score: 50.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 228..476
e-value: 7.5E-53
score: 181.5
NoneNo IPR availablePANTHERPTHR19229:SF185coord: 2..550
NoneNo IPR availableCDDcd03263ABC_subfamily_Acoord: 214..455
e-value: 1.65134E-109
score: 324.843
NoneNo IPR availableTMHMMTMhelixcoord: 63..85
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 34..56
NoneNo IPR availableTMHMMTMhelixcoord: 149..171
IPR026082ABC transporter APANTHERPTHR19229ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY A ABCAcoord: 2..550
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 246..463