Metallophosphoesterase MPPED2

Overview
NameMetallophosphoesterase MPPED2
Smed IDSMED30012192
Length (bp)1162
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Metallophosphoesterase MPPED2 (SMED30012192) t-SNE clustered cells

Violin plots show distribution of expression levels for Metallophosphoesterase MPPED2 (SMED30012192) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Metallophosphoesterase MPPED2 (SMED30012192) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Metallophosphoesterase MPPED2 (SMED30012192) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012192

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012192SMESG000074768.1 SmedASXL_060931SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30012192SMESG000074768.1 dd_Smed_v4_9610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012192SMESG000074768.1 dd_Smed_v4_9610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012192SMESG000074768.1 dd_Smed_v4_9610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30012192SMESG000074768.1 dd_Smed_v4_9610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30012192SMESG000074768.1 dd_Smed_v6_9610_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30012192SMESG000074768.1 Contig53801newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30012192SMESG000074768.1 Contig53801uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30012192SMESG000074768.1 Contig53801newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30012192SMESG000074768.1 Contig53801uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30012192SMESG000074768.1 dd_Smed_v4_9610_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Human
Match: MPPED1 (metallophosphoesterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:1306])

HSP 1 Score: 80.8777 bits (198), Expect = 2.380e-16
Identity = 73/257 (28.40%), Postives = 111/257 (43.19%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQSK-IIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNFR 817
            F P +V +V  V  D P+     R V +SDT    D +  Q+PYG +LIH+GDF +              S +   N +   LP+ +KI +AG+++                 +F ++SK      E +QSLL    YLQDS   +    IYG+PW            +   +L E W  IP   DILI++  P     W     + +           R++P LH++G     YGV+      + NAS  + VN++
Sbjct:   68 FQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPI--QMPYGDVLIHAGDFTE----------LGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRG-QALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCT-VNYQ 310          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Human
Match: MPPED1 (metallophosphoesterase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:1306])

HSP 1 Score: 80.8777 bits (198), Expect = 2.380e-16
Identity = 73/257 (28.40%), Postives = 111/257 (43.19%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQSK-IIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNFR 817
            F P +V +V  V  D P+     R V +SDT    D +  Q+PYG +LIH+GDF +              S +   N +   LP+ +KI +AG+++                 +F ++SK      E +QSLL    YLQDS   +    IYG+PW            +   +L E W  IP   DILI++  P     W     + +           R++P LH++G     YGV+      + NAS  + VN++
Sbjct:   68 FQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPI--QMPYGDVLIHAGDFTE----------LGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRG-QALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCT-VNYQ 310          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Human
Match: MPPED2 (metallophosphoesterase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:1180])

HSP 1 Score: 74.3294 bits (181), Expect = 2.505e-14
Identity = 68/249 (27.31%), Postives = 107/249 (42.97%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQ-SKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            F P +V++V  +  D P+ +   R V ISDT    D +  Q+PYG IL+H+GDF +              S +   N +  +LP+ +KI +AG+++                  F ++SK      + +QSLL    YLQDS   +    IYG PW            +   SL + W  IP   DIL+++  P     W     + +           R++P LH++G     YG++      + NAS
Sbjct:   36 FQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGI--QMPYGDILLHTGDFTE----------LGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRG-QSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINAS 271          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Human
Match: MPPED2 (metallophosphoesterase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:1180])

HSP 1 Score: 68.1662 bits (165), Expect = 2.803e-12
Identity = 63/229 (27.51%), Postives = 99/229 (43.23%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQ-SKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDS----------------HFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYG 733
            F P +V++V  +  D P+ +   R V ISDT    D +  Q+PYG IL+H+GDF +              S +   N +  +LP+ +KI +AG+++                  F ++SK      + +QSLL    YLQDS   +    IYG PW            +   SL + W  IP   DIL+++  P     W     + +           R++P LH++G
Sbjct:   36 FQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGI--QMPYGDILLHTGDFTE----------LGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRG-QSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFG 251          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Celegans
Match: C25E10.12 (UPF0046 protein C25E10.12 [Source:UniProtKB/Swiss-Prot;Acc:Q18161])

HSP 1 Score: 75.485 bits (184), Expect = 3.280e-15
Identity = 70/290 (24.14%), Postives = 105/290 (36.21%), Query Frame = 2
Query:  221 IRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHF---STMSKEQIQS-----------LLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP--------WE---------ATFYKHISTRIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNFRSKLKTESYGFWSQDSLESTLNSKTITCFQRQKISQPGFYIKSREHYEPIVFDVYVPPKAT 997
            +R V ISDT     ++   IP G +LIHSGDF               +  +   N     LPH HKI +AG+++  F     MS+ Q+             LL    YL D   + Y L IYG PW    +   + F +    +   W  IP+  D+L+++  P        W+         A     +  R+KP  H++G     +GV    +  F NA+   +                                            K R  Y+PI+FD+ +PP  T
Sbjct:   46 VRFVCISDTHEKLHEILPYIPDGDVLIHSGDFTNC----------GDIGEVIKFNAEIGSLPHKHKIVIAGNHELGFEDGEEMSERQLAGLNMLGINKAYELLSNCTYLCDKSYEAYGLKIYGAPW--HSMPGYSFFRQRGQKILHKWNQIPAKIDVLMTHTPPLGHGDFNAWDKMDGILCGCAELLNTVEQRVKPKYHVFGHVHQKHGVTTNGETTFINAALCDH--------------------------------------------KLRSAYDPIIFDIPLPPGKT 279          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Celegans
Match: K07C11.7 (UPF0046 protein K07C11.7 [Source:UniProtKB/Swiss-Prot;Acc:Q21268])

HSP 1 Score: 65.855 bits (159), Expect = 6.203e-12
Identity = 56/230 (24.35%), Postives = 100/230 (43.48%), Query Frame = 2
Query:  185 VVGAVDNPQSK---IIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFS-------------TMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----------WEATFYKHISTRIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
             +G +++P +     ++VV ISDT   E      +P G +LIH+GDF  +       +    +   + M RF    PH +K+ VAG+++  F               +  E   ++L  V YLQD    +  +  +G+ +    L+    +      L+E W+ +P++T++LI++  P           W          RI+P  H++G     +GVL   +  F NA+
Sbjct:   33 AIGEINSPPTDGTPYLKVVCISDTH--EQLHNVTVPDGDVLIHAGDFTNN------GKREELIKFNEEMTRF----PHKYKLVVAGNHELGFDHDENQGERQDADKGLGTEDGYNILTNVTYLQDKGVTIDGVTFFGSSY--HPLRGFPFYRNRAEQLAECWKAVPNDTNVLITHTPPLGYLDQFGDERWGCRDLLKTVERIQPAYHIFGHVHEQHGVLSNGNTTFINAA 248          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Celegans
Match: K07C11.7 (UPF0046 protein K07C11.7 [Source:UniProtKB/Swiss-Prot;Acc:Q21268])

HSP 1 Score: 65.855 bits (159), Expect = 6.203e-12
Identity = 56/230 (24.35%), Postives = 100/230 (43.48%), Query Frame = 2
Query:  185 VVGAVDNPQSK---IIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFS-------------TMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----------WEATFYKHISTRIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
             +G +++P +     ++VV ISDT   E      +P G +LIH+GDF  +       +    +   + M RF    PH +K+ VAG+++  F               +  E   ++L  V YLQD    +  +  +G+ +    L+    +      L+E W+ +P++T++LI++  P           W          RI+P  H++G     +GVL   +  F NA+
Sbjct:   33 AIGEINSPPTDGTPYLKVVCISDTH--EQLHNVTVPDGDVLIHAGDFTNN------GKREELIKFNEEMTRF----PHKYKLVVAGNHELGFDHDENQGERQDADKGLGTEDGYNILTNVTYLQDKGVTIDGVTFFGSSY--HPLRGFPFYRNRAEQLAECWKAVPNDTNVLITHTPPLGYLDQFGDERWGCRDLLKTVERIQPAYHIFGHVHEQHGVLSNGNTTFINAA 248          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Celegans
Match: K07C11.7 (UPF0046 protein K07C11.7 [Source:UniProtKB/Swiss-Prot;Acc:Q21268])

HSP 1 Score: 65.855 bits (159), Expect = 6.367e-12
Identity = 56/230 (24.35%), Postives = 100/230 (43.48%), Query Frame = 2
Query:  185 VVGAVDNPQSK---IIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFS-------------TMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----------WEATFYKHISTRIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
             +G +++P +     ++VV ISDT   E      +P G +LIH+GDF  +       +    +   + M RF    PH +K+ VAG+++  F               +  E   ++L  V YLQD    +  +  +G+ +    L+    +      L+E W+ +P++T++LI++  P           W          RI+P  H++G     +GVL   +  F NA+
Sbjct:   52 AIGEINSPPTDGTPYLKVVCISDTH--EQLHNVTVPDGDVLIHAGDFTNNG------KREELIKFNEEMTRF----PHKYKLVVAGNHELGFDHDENQGERQDADKGLGTEDGYNILTNVTYLQDKGVTIDGVTFFGSSY--HPLRGFPFYRNRAEQLAECWKAVPNDTNVLITHTPPLGYLDQFGDERWGCRDLLKTVERIQPAYHIFGHVHEQHGVLSNGNTTFINAA 267          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Celegans
Match: T07D4.2 (UPF0046 protein T07D4.2 [Source:UniProtKB/Swiss-Prot;Acc:Q22306])

HSP 1 Score: 54.6842 bits (130), Expect = 5.078e-8
Identity = 53/222 (23.87%), Postives = 90/222 (40.54%), Query Frame = 2
Query:  221 IRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHF---------STMSKEQI--QSLLPPVN-----------------YLQDSWCQLYSLFIYGTPWVKKRLKISN-AFT-KDFMSLSESWEGIPSNTDILISNQKPWE-------------ATFYKHISTRIKPILHLYGKNDGNYGV 757
            +R V I  T G E    S++P G +L+ +GDF      N           + N N+    L + +K+ + G+++  F          +  KE    Q+LL  ++                 YL+D+  +L+ + IYGTPW   + K+ N AF       L + W  IP+  D+L+++  P               A     +  R++P  H++G     YG 
Sbjct:   95 VRFVCIGCTHG-EQFDISKLPPGDVLLVAGDFTSCGLPN----------EVHNFNKLLGKLKYSYKVVIGGNHECTFDDTFLKLKQESEPKEMALKQALLSAIHSDSKGGISAKDLLSNAIYLEDNVIELFGITIYGTPW---QPKVDNWAFNLSRGQQLLDKWNLIPAGVDVLLTHTPPLGHGDMMNNGQRMGCAELLNTVFKRVRPKYHVFGHIHEGYGC 302          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Fly
Match: CG16717 (gene:FBgn0036028 transcript:FBtr0076392)

HSP 1 Score: 73.559 bits (179), Expect = 2.517e-14
Identity = 60/243 (24.69%), Postives = 96/243 (39.51%), Query Frame = 2
Query:  224 RVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHF----------------------------------------STMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP----------WEATFYKHIST---RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            RVV +SDT      +   IP G I IH+GDF K             L  ++  N +   LPH HKI +AG+++  F                                        S +  + ++ +L    YL+D   +++ + IYG+PW  +  + +    +    L + W  IP   DIL+++  P            A   + +ST   R++P  H++G     YG+     IIF NAS
Sbjct:   43 RVVCMSDTHSLTPYIKFDIPDGDIFIHAGDFTKC----------GQLEEVEEFNTWIGALPHRHKIVIAGNHELSFDRTFTHPFQKSKSHASSSKHTGMSILDDLPTLGNAKENLESAVQTQNVRDVLTNCRYLEDELLEIWGIQIYGSPWQPEFCRWAFNVPRGTACL-DKWNQIPEGIDILVTHTPPVGHGDLCCSGVRAGCVELLSTVQQRVRPKYHVFGHVHEGYGITSDGRIIFVNAS 274          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Zebrafish
Match: mpped1 (metallophosphoesterase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-111104-1])

HSP 1 Score: 79.337 bits (194), Expect = 3.371e-16
Identity = 73/257 (28.40%), Postives = 111/257 (43.19%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQSK-IIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNFR 817
            F P +V++V  +  D P+     R V ISDT    D +  Q+PYG +L+H+GDF +              S +   N +   LP+  KI +AG+++                 +F + SK      E +QSLL    YLQDS   +    IYG+PW            +   +L + W  IP +TDIL+++  P     W     + +           R++P LH++G     YGV+      F NAS    VNF+
Sbjct:   49 FQPPHVHMVDPIAHDTPKPPGYTRFVCISDTHSRTDAI--QMPYGDVLLHAGDFTE----------LGLPSEVKKFNDWLGTLPYEIKIVIAGNHELTFDQEFMADLIKQDFYYFPSASKLKPENYENVQSLLTNCIYLQDSDVTVRGFRIYGSPWQPWYYGWGFNLPRG-QALLDKWNQIPDSTDILLTHCPPLGFLDWVPRKMQRVGCMELLNTVQRRVQPKLHVFGHIHEGYGVMTDGTTTFVNAS-ACTVNFQ 291          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Zebrafish
Match: mpped2a (metallophosphoesterase domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-050417-241])

HSP 1 Score: 74.3294 bits (181), Expect = 1.464e-14
Identity = 67/249 (26.91%), Postives = 105/249 (42.17%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQ-SKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            F P +V++V  +  D P+     R V +SDT    D +  Q+PYG +L+H+GDF +              S +   N +   LP+  K+ +AG+++                  F ++SK      + +QSLL    YLQDS   +    IYGTPW            +   SL + W  IP   DIL+++  P     W     + +           R++P LH++G     YG++      F NAS
Sbjct:   36 FQPPHVHMVDPISYDTPKPGGHTRFVCVSDTHSRTDGI--QMPYGDVLLHTGDFTE----------LGLPSEVKKFNDWLGSLPYEFKVVIAGNHELTFDKDFMTELVKQDYYRFPSVSKLKPEDFDNVQSLLTNCVYLQDSDVTVKGFRIYGTPWTPWFNGWGFNLPRG-QSLLDKWNLIPEGVDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTFINAS 271          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Zebrafish
Match: mpped2a (metallophosphoesterase domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-050417-241])

HSP 1 Score: 74.3294 bits (181), Expect = 1.464e-14
Identity = 67/249 (26.91%), Postives = 105/249 (42.17%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQ-SKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            F P +V++V  +  D P+     R V +SDT    D +  Q+PYG +L+H+GDF +              S +   N +   LP+  K+ +AG+++                  F ++SK      + +QSLL    YLQDS   +    IYGTPW            +   SL + W  IP   DIL+++  P     W     + +           R++P LH++G     YG++      F NAS
Sbjct:   36 FQPPHVHMVDPISYDTPKPGGHTRFVCVSDTHSRTDGI--QMPYGDVLLHTGDFTE----------LGLPSEVKKFNDWLGSLPYEFKVVIAGNHELTFDKDFMTELVKQDYYRFPSVSKLKPEDFDNVQSLLTNCVYLQDSDVTVKGFRIYGTPWTPWFNGWGFNLPRG-QSLLDKWNLIPEGVDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTFINAS 271          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Zebrafish
Match: mpped2 (metallophosphoesterase domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8903])

HSP 1 Score: 73.559 bits (179), Expect = 2.726e-14
Identity = 66/249 (26.51%), Postives = 106/249 (42.57%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQS-KIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            F P +V++V  +  D P+S    R V +SDT    D +  Q+P+G +L+H+GDF +              S +   N +   LP+ +K+ +AG+++                  F ++SK      + +QSLL    YLQDS   +    IYG PW            +   SL + W  IP + DIL+++  P     W     + +           R++P LH YG     YG++      F N+S
Sbjct:   36 FQPPHVHMVEPLPYDAPKSVGHTRFVCVSDTHSRTDGI--QMPFGDVLLHTGDFTE----------LGLPSEVKKFNDWLGGLPYEYKVVIAGNHELTFDKDFMAELIKQDYYRFPSVSKLRSEDFDDVQSLLTNCVYLQDSEVTIKGFRIYGAPWTPWFNGWGFNLPRG-QSLLDKWNQIPEDVDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQKRVRPKLHAYGGIHEGYGIMTDGYTTFINSS 271          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Zebrafish
Match: mpped2 (metallophosphoesterase domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8903])

HSP 1 Score: 73.559 bits (179), Expect = 2.726e-14
Identity = 66/249 (26.51%), Postives = 106/249 (42.57%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQS-KIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            F P +V++V  +  D P+S    R V +SDT    D +  Q+P+G +L+H+GDF +              S +   N +   LP+ +K+ +AG+++                  F ++SK      + +QSLL    YLQDS   +    IYG PW            +   SL + W  IP + DIL+++  P     W     + +           R++P LH YG     YG++      F N+S
Sbjct:   36 FQPPHVHMVEPLPYDAPKSVGHTRFVCVSDTHSRTDGI--QMPFGDVLLHTGDFTE----------LGLPSEVKKFNDWLGGLPYEYKVVIAGNHELTFDKDFMAELIKQDYYRFPSVSKLRSEDFDDVQSLLTNCVYLQDSEVTIKGFRIYGAPWTPWFNGWGFNLPRG-QSLLDKWNQIPEDVDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQKRVRPKLHAYGGIHEGYGIMTDGYTTFINSS 271          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Xenopus
Match: bace1 (beta-site APP-cleaving enzyme 1 [Source:Xenbase;Acc:XB-GENE-5787150])

HSP 1 Score: 72.4034 bits (176), Expect = 1.199e-13
Identity = 65/249 (26.10%), Postives = 106/249 (42.57%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQ-SKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDS----------------HFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            F P +V++V  +  D P+ +   R V +SDT    D +  Q+PYG IL+H+GDF +              S +   N +   LP+ +KI +AG+++                  F ++SK      + +Q+LL    YLQDS   +    IYG PW            +   SL + W  +P   DIL+++  P     W     + +           R++P LH++G     YG++      + NAS
Sbjct:   36 FQPPHVHMVDPIPYDTPKPAGHTRFVCVSDTHSRTDGI--QMPYGDILLHTGDFTE----------LGLPSEVKKFNDWLGTLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQTLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRG-QSLLDKWNLVPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYVNAS 271          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Mouse
Match: Mpped1 (metallophosphoesterase domain containing 1 [Source:MGI Symbol;Acc:MGI:106316])

HSP 1 Score: 80.8777 bits (198), Expect = 1.634e-16
Identity = 73/257 (28.40%), Postives = 111/257 (43.19%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQSK-IIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDS----------------HFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNFR 817
            F P +V +V  V  D P+     R V +SDT    D +  Q+PYG +LIH+GDF +              S +   N +   LP+ +KI +AG+++                 +F ++SK      E +QSLL    YLQDS   +    IYG+PW            +   +L E W  IP   DILI++  P     W     + +           R++P LH++G     YGV+      + NAS  + VN++
Sbjct:   68 FQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPI--QMPYGDVLIHAGDFTE----------LGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRG-QALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCT-VNYQ 310          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Mouse
Match: Mpped1 (metallophosphoesterase domain containing 1 [Source:MGI Symbol;Acc:MGI:106316])

HSP 1 Score: 80.8777 bits (198), Expect = 1.634e-16
Identity = 73/257 (28.40%), Postives = 111/257 (43.19%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQSK-IIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDS----------------HFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNFR 817
            F P +V +V  V  D P+     R V +SDT    D +  Q+PYG +LIH+GDF +              S +   N +   LP+ +KI +AG+++                 +F ++SK      E +QSLL    YLQDS   +    IYG+PW            +   +L E W  IP   DILI++  P     W     + +           R++P LH++G     YGV+      + NAS  + VN++
Sbjct:   68 FQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPI--QMPYGDVLIHAGDFTE----------LGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRG-QALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCT-VNYQ 310          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Mouse
Match: Mpped2 (metallophosphoesterase domain containing 2 [Source:MGI Symbol;Acc:MGI:1924265])

HSP 1 Score: 75.0998 bits (183), Expect = 9.363e-15
Identity = 69/249 (27.71%), Postives = 107/249 (42.97%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQ-SKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            F P +V++V  +  D P+ +   R V ISDT    D +  Q+PYG IL+H+GDF +              S +   N +  +LP+ +KI +AG+++                  F ++SK      + +QSLL    YLQDS   +    IYG PW            +   SL + W  IP   DIL+++  P     W     + +           RI+P LH++G     YG++      + NAS
Sbjct:   36 FQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGI--QMPYGDILLHTGDFTE----------LGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRG-QSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRIRPKLHVFGGIHEGYGIMTDGYTTYINAS 271          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Mouse
Match: Mpped2 (metallophosphoesterase domain containing 2 [Source:MGI Symbol;Acc:MGI:1924265])

HSP 1 Score: 74.7146 bits (182), Expect = 1.179e-14
Identity = 69/249 (27.71%), Postives = 107/249 (42.97%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQ-SKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            F P +V++V  +  D P+ +   R V ISDT    D +  Q+PYG IL+H+GDF +              S +   N +  +LP+ +KI +AG+++                  F ++SK      + +QSLL    YLQDS   +    IYG PW            +   SL + W  IP   DIL+++  P     W     + +           RI+P LH++G     YG++      + NAS
Sbjct:   36 FQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGI--QMPYGDILLHTGDFTE----------LGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRG-QSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRIRPKLHVFGGIHEGYGIMTDGYTTYINAS 271          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Mouse
Match: Mpped2 (metallophosphoesterase domain containing 2 [Source:MGI Symbol;Acc:MGI:1924265])

HSP 1 Score: 74.7146 bits (182), Expect = 1.179e-14
Identity = 69/249 (27.71%), Postives = 107/249 (42.97%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQ-SKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            F P +V++V  +  D P+ +   R V ISDT    D +  Q+PYG IL+H+GDF +              S +   N +  +LP+ +KI +AG+++                  F ++SK      + +QSLL    YLQDS   +    IYG PW            +   SL + W  IP   DIL+++  P     W     + +           RI+P LH++G     YG++      + NAS
Sbjct:   36 FQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGI--QMPYGDILLHTGDFTE----------LGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRG-QSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRIRPKLHVFGGIHEGYGIMTDGYTTYINAS 271          
BLAST of Metallophosphoesterase MPPED2 vs. UniProt/SwissProt
Match: sp|Q91ZG2|MPPD1_MOUSE (Metallophosphoesterase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Mpped1 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.143e-15
Identity = 73/257 (28.40%), Postives = 111/257 (43.19%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQSK-IIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDS----------------HFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNFR 817
            F P +V +V  V  D P+     R V +SDT    D +  Q+PYG +LIH+GDF +              S +   N +   LP+ +KI +AG+++                 +F ++SK      E +QSLL    YLQDS   +    IYG+PW            +   +L E W  IP   DILI++  P     W     + +           R++P LH++G     YGV+      + NAS  + VN++
Sbjct:   68 FQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPI--QMPYGDVLIHAGDFTE----------LGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRG-QALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCT-VNYQ 310          
BLAST of Metallophosphoesterase MPPED2 vs. UniProt/SwissProt
Match: sp|O15442|MPPD1_HUMAN (Metallophosphoesterase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MPPED1 PE=1 SV=3)

HSP 1 Score: 80.8777 bits (198), Expect = 1.143e-15
Identity = 73/257 (28.40%), Postives = 111/257 (43.19%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQSK-IIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNFR 817
            F P +V +V  V  D P+     R V +SDT    D +  Q+PYG +LIH+GDF +              S +   N +   LP+ +KI +AG+++                 +F ++SK      E +QSLL    YLQDS   +    IYG+PW            +   +L E W  IP   DILI++  P     W     + +           R++P LH++G     YGV+      + NAS  + VN++
Sbjct:   68 FQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPI--QMPYGDVLIHAGDFTE----------LGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRG-QALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCT-VNYQ 310          
BLAST of Metallophosphoesterase MPPED2 vs. UniProt/SwissProt
Match: sp|Q18161|YBPT_CAEEL (UPF0046 protein C25E10.12 OS=Caenorhabditis elegans OX=6239 GN=C25E10.12 PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.172e-14
Identity = 70/290 (24.14%), Postives = 105/290 (36.21%), Query Frame = 2
Query:  221 IRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHF---STMSKEQIQS-----------LLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP--------WE---------ATFYKHISTRIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNFRSKLKTESYGFWSQDSLESTLNSKTITCFQRQKISQPGFYIKSREHYEPIVFDVYVPPKAT 997
            +R V ISDT     ++   IP G +LIHSGDF               +  +   N     LPH HKI +AG+++  F     MS+ Q+             LL    YL D   + Y L IYG PW    +   + F +    +   W  IP+  D+L+++  P        W+         A     +  R+KP  H++G     +GV    +  F NA+   +                                            K R  Y+PI+FD+ +PP  T
Sbjct:   46 VRFVCISDTHEKLHEILPYIPDGDVLIHSGDFTNC----------GDIGEVIKFNAEIGSLPHKHKIVIAGNHELGFEDGEEMSERQLAGLNMLGINKAYELLSNCTYLCDKSYEAYGLKIYGAPW--HSMPGYSFFRQRGQKILHKWNQIPAKIDVLMTHTPPLGHGDFNAWDKMDGILCGCAELLNTVEQRVKPKYHVFGHVHQKHGVTTNGETTFINAALCDH--------------------------------------------KLRSAYDPIIFDIPLPPGKT 279          
BLAST of Metallophosphoesterase MPPED2 vs. UniProt/SwissProt
Match: sp|B1WBP0|MPPD2_RAT (Metallophosphoesterase MPPED2 OS=Rattus norvegicus OX=10116 GN=Mpped2 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 5.146e-14
Identity = 69/249 (27.71%), Postives = 107/249 (42.97%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQ-SKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            F P +V++V  +  D P+ +   R V ISDT    D +  Q+PYG IL+H+GDF +              S +   N +  +LP+ +KI +AG+++                  F ++SK      + +QSLL    YLQDS   +    IYG PW            +   SL + W  IP  TDIL+++  P     W     + +           R++P LH++G     YG +      + NAS
Sbjct:   36 FQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGI--QMPYGDILLHTGDFTE----------LGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRG-QSLLDKWNLIPEGTDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGTMTDGYTTYINAS 271          
BLAST of Metallophosphoesterase MPPED2 vs. UniProt/SwissProt
Match: sp|Q9CZJ0|MPPD2_MOUSE (Metallophosphoesterase MPPED2 OS=Mus musculus OX=10090 GN=Mpped2 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.250e-14
Identity = 69/249 (27.71%), Postives = 107/249 (42.97%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQ-SKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            F P +V++V  +  D P+ +   R V ISDT    D +  Q+PYG IL+H+GDF +              S +   N +  +LP+ +KI +AG+++                  F ++SK      + +QSLL    YLQDS   +    IYG PW            +   SL + W  IP   DIL+++  P     W     + +           RI+P LH++G     YG++      + NAS
Sbjct:   36 FQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGI--QMPYGDILLHTGDFTE----------LGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRG-QSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRIRPKLHVFGGIHEGYGIMTDGYTTYINAS 271          
BLAST of Metallophosphoesterase MPPED2 vs. TrEMBL
Match: A0A1I8J9V2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028128g1 PE=4 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.464e-33
Identity = 76/214 (35.51%), Postives = 114/214 (53.27%), Query Frame = 2
Query:  179 VYVVGAVDNPQSKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFSTMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPW-VKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKPWEATFYKHISTRIKPILHLYG-------KNDG--NYGVLFKDDIIFSNA 790
            VYVVG+  NP+S  +R+ H+SDT    +   S +    +L+HSG+     F    ++   FL+ I  +N FF  +PH +KI+V G N+  F +  +E++Q+LLP   YLQDS C +  +  YG PW   +R  +   F K    L   W  +P N D+LIS+  P   + Y  +  R+KP + LYG       ++D      V FKD++IFSN 
Sbjct:  111 VYVVGS-PNPKSPFLRIAHVSDTCDLPNNGLSAVFEADVLVHSGNLCSYQFRKHFFKDTEFLNQIKAINNFFADMPHRYKIFVPGPNEIFFDSEDRERVQALLPNCIYLQDSECVIEGVRFYGVPWSANRRGTVGRGFGKSVTELKTVWSNVPDNVDVLISHSVPTN-SLYDDLVLRLKPKMFLYGSRMQRSSRSDQAEENCVKFKDNVIFSNG 322          
BLAST of Metallophosphoesterase MPPED2 vs. TrEMBL
Match: A0A267EAP4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010829g1 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.876e-32
Identity = 75/214 (35.05%), Postives = 114/214 (53.27%), Query Frame = 2
Query:  179 VYVVGAVDNPQSKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFSTMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPW-VKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKPWEATFYKHISTRIKPILHLYG-------KND--GNYGVLFKDDIIFSNA 790
            VYVVG+  NP+S  +R+ H+SDT    +   S +    +L+HSG+     F    ++   FL+ I  +N FF  +PH +KI+V G N+  F +  +E++Q+LLP   YLQDS C +  +  YG PW   +R  +   F K    L   W  +P + D+LIS+  P   + Y  +  R+KP + LYG       ++D      V FKD++IFSN 
Sbjct:  111 VYVVGS-PNPKSPFLRIAHVSDTCDLPNNGLSAVFEADVLVHSGNLCSYQFRKHFFKDTEFLNQIKAINNFFADMPHRYKIFVPGPNEIFFDSEDRERVQALLPNCIYLQDSECVIEGVRFYGVPWSANRRGTVGRGFGKSVTELKTVWSNVPDDVDVLISHSVPTN-SLYDDLVLRLKPKMFLYGSRMQRSSRSDQAEENCVKFKDNVIFSNG 322          
BLAST of Metallophosphoesterase MPPED2 vs. TrEMBL
Match: A0A1I8HPD3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003221g2 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 5.807e-31
Identity = 80/220 (36.36%), Postives = 115/220 (52.27%), Query Frame = 2
Query:  164 FNPSNVYVVGAVDNPQSKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFSTMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKI-SNAFTKDFMSLSESWEGIPSNTDILISNQKPWEATFYKHISTRIKPILHLYG-------KNDGNY---GVLFKDDIIFSNA 790
            F    VYVVG+  N +S  +R+ HISDT   +DK  S I    +L+H G+     F    ++   F S I  ++ FF  +PH +KI+VAG N+  F   S+E++Q+LLP   YLQDS C +  +  YGTPW   R  I    F K    L   W  IP + D+ ++   P   + Y+ +  RI+P L LYG       K+D +     V FKD++IF+N 
Sbjct:   61 FMQPQVYVVGS-PNIKSPFLRIAHISDTCEVDDKGASSIYEADVLVHCGNLNNYQFSKHFFKDSEFHSQIKAIDAFFAKMPHKYKIFVAGPNEI-FDGESREKLQALLPNCIYLQDSSCVIEGVRFYGTPWTVSRRGIDGRGFVKSHAELKTIWSNIPDDVDVFVAPSIPTN-SMYEELVARIRPKLFLYGARPDRPSKSDPHSEENCVKFKDNVIFANG 277          
BLAST of Metallophosphoesterase MPPED2 vs. TrEMBL
Match: A0A267E009 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003221g1 PE=4 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 6.705e-31
Identity = 79/216 (36.57%), Postives = 114/216 (52.78%), Query Frame = 2
Query:  176 NVYVVGAVDNPQSKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFSTMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKI-SNAFTKDFMSLSESWEGIPSNTDILISNQKPWEATFYKHISTRIKPILHLYG-------KNDGNY---GVLFKDDIIFSNA 790
             VYVVG+  N +S  +R+ HISDT   +DK  S I    +L+H G+     F    ++   F S I  ++ FF  +PH +KI+VAG N+  F   S+E++Q+LLP   YLQDS C +  +  YGTPW   R  I    F K    L   W  IP + D+ ++   P   + Y+ +  RI+P L LYG       K+D +     V FKD++IF+N 
Sbjct:   65 QVYVVGS-PNIKSPFLRIAHISDTCEVDDKGASSIYEADVLVHCGNLNNYQFSKHFFKDSEFHSQIKAIDAFFAKMPHKYKIFVAGPNEI-FDGESREKLQALLPNCIYLQDSSCVIEGVRFYGTPWTVSRRGIDGRGFVKSHAELKTIWSNIPDDVDVFVAPSIPTN-SMYEELVARIRPKLFLYGARPDRPSKSDPHSEENCVKFKDNVIFANG 277          
BLAST of Metallophosphoesterase MPPED2 vs. TrEMBL
Match: A0A1I8HVT0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 9.737e-31
Identity = 80/220 (36.36%), Postives = 115/220 (52.27%), Query Frame = 2
Query:  164 FNPSNVYVVGAVDNPQSKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFSTMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKIS-NAFTKDFMSLSESWEGIPSNTDILISNQKPWEATFYKHISTRIKPILHLYG-------KNDGNYG---VLFKDDIIFSNA 790
            F    VYVVG+  N +S  +R+ HISDT   +DK  S I    +L+H G+     F    ++   F S I  ++ FF  +PH +KI+VAG N+  F   S+E++Q+LLP   YLQDS C +  +  YGTPW   R  I    F K    L   W  IP + D+ ++   P   + Y+ +  RI+P L LYG       K+D +     V FKD++IF+N 
Sbjct: 1372 FMQPQVYVVGS-PNIKSPFLRIAHISDTCEVDDKGASSIYEADVLVHCGNLNNYQFSKHFFKDSEFHSQIKAIDAFFAKMPHKYKIFVAGPNEI-FDGESREKLQALLPNCIYLQDSSCVIEGVRFYGTPWTVSRRGIDGRGFVKSHAELKTIWSNIPDDVDVFVAPSIP-TNSMYEELVARIRPKLFLYGARPDRPSKSDPHSEENCVKFKDNVIFANG 1588          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Cavefish
Match: mpped1 (metallophosphoesterase domain-containing protein 1 [Source:NCBI gene;Acc:103025818])

HSP 1 Score: 77.0258 bits (188), Expect = 1.855e-15
Identity = 72/257 (28.02%), Postives = 111/257 (43.19%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQSK-IIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDS----------------HFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNFR 817
            F P +V++V  +  D P+     R V ISDT    D +  Q+PYG +L+H+GDF +              S +   N +   LP+  KI +AG+++                 +F + SK      E +QSLL    YLQDS   +    IYG+PW            +   +L + W  IP +TDIL+++  P     W     + +           R++P LH++G     YG++      F NAS    VNF+
Sbjct:   55 FQPPHVHMVDPLPHDTPKPPGYTRFVCISDTHSRTDSI--QMPYGDVLLHAGDFTE----------LGLPSEVKKFNDWLGTLPYEIKIVIAGNHELTFDQEFMADLIKQDFYYFPSASKLKPENYENVQSLLTNCIYLQDSDVTVRGFRIYGSPWQPWYYGWGFNLPRG-QALLDKWNQIPDSTDILLTHCPPLGFLDWVPRKMQRVGCMELLNTVQRRVQPKLHVFGHIHEGYGMMTDGTTTFINAS-TCTVNFQ 297          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Cavefish
Match: mpped2 (metallophosphoesterase domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8903])

HSP 1 Score: 71.633 bits (174), Expect = 1.054e-13
Identity = 61/226 (26.99%), Postives = 95/226 (42.04%), Query Frame = 2
Query:  224 RVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSKEQ------IQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            R V +SDT    D +   +PYG +L+H+GDF +              S +   N +   LP+ +K+ +AG+++                  F ++SK Q      +QSLL    YLQDS   +    IYGTPW            +   SL + W  IP + DIL+++  P     W     + +           R++P LH+YG     YG++      F N+S
Sbjct:   56 RFVCVSDTHSRTDGI--HMPYGDVLLHTGDFTE----------LGLPSEVKKFNDWLGSLPYEYKVVIAGNHELTFDKDFMSELVKQDYYRFPSVSKLQPEDFDNVQSLLTNCIYLQDSEVMVKGFRIYGTPWTPWFNGWGFNLPRG-QSLLDKWNQIPEDIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVYGGIHEGYGLMTDGYTTFINSS 268          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Cavefish
Match: mpped2 (metallophosphoesterase domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8903])

HSP 1 Score: 71.633 bits (174), Expect = 2.195e-13
Identity = 61/226 (26.99%), Postives = 95/226 (42.04%), Query Frame = 2
Query:  224 RVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDS----------------HFSTMSKEQ------IQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            R V +SDT    D +   +PYG +L+H+GDF +              S +   N +   LP+ +K+ +AG+++                  F ++SK Q      +QSLL    YLQDS   +    IYGTPW            +   SL + W  IP + DIL+++  P     W     + +           R++P LH+YG     YG++      F N+S
Sbjct:  158 RFVCVSDTHSRTDGI--HMPYGDVLLHTGDFTE----------LGLPSEVKKFNDWLGSLPYEYKVVIAGNHELTFDKDFMSELVKQDYYRFPSVSKLQPEDFDNVQSLLTNCIYLQDSEVMVKGFRIYGTPWTPWFNGWGFNLPRG-QSLLDKWNQIPEDIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVYGGIHEGYGLMTDGYTTFINSS 370          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Cavefish
Match: mpped2a (metallophosphoesterase domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-050417-241])

HSP 1 Score: 70.0922 bits (170), Expect = 3.028e-13
Identity = 64/235 (27.23%), Postives = 97/235 (41.28%), Query Frame = 2
Query:  200 DNPQ-SKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            D P+ S   R V +SDT    D +  Q+PYG +L+H+GDF +              S +   N +   LP+  K+ +AG+++                  F ++SK      + +QSLL    YLQDS   +    IYGTPW            +   SL + W  IP   DIL+++  P     W     + +           R++P LH +G     YG++      F NAS
Sbjct:   36 DTPKPSGHTRFVCVSDTHSRTDGV--QMPYGDVLLHTGDFTE----------LGLPSEVKKFNDWLGSLPYEFKVVIAGNHELTFDKDFMSELVKQDYYRFPSVSKLKPEDFDDVQSLLSNCLYLQDSDVTVKGFRIYGTPWTPWFNGWGFNLPRG-QSLLDKWNMIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHAFGGIHEGYGIMTDGYTTFINAS 257          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Nematostella
Match: EDO42031 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2M8])

HSP 1 Score: 82.0333 bits (201), Expect = 1.396e-17
Identity = 68/228 (29.82%), Postives = 96/228 (42.11%), Query Frame = 2
Query:  224 RVVHISDTMGCEDKL----FSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFST------------------MSKEQIQSL--LPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFM-SLSESWEGIPSNTDILISNQKPWE-------------ATFYKHISTRIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            R V ISDT     +     F  IP G +LIH+GDF        + ++R     +   N F   LPHPHK+ +AG++D  F                     + E ++ L  L  ++YL+DS   +  + IYGTPWV      S AF  D    L   W+ IP  TD+L+++  P                     + TR+KP  H+YG     YGV       + NAS
Sbjct:   61 RFVCISDTHCLHSRTGAASFPCIPDGDVLIHAGDFTM------VGKAR----EVTQFNEFITSLPHPHKVVIAGNHDLPFDVGGYDCHYRYWRMSLNEPKTTPEGVRQLLDLSKIHYLEDSEITINGIMIYGTPWVPTFG--SWAFMLDRGPDLQAKWDQIPDGTDVLVTHTPPLGYGDLCTSKLRAGCINLLHTVQTRVKPKYHIYGHIHEAYGVRTDGVTTYINAS 276          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Medaka
Match: mpped1 (metallophosphoesterase domain-containing protein 1 [Source:NCBI gene;Acc:101164611])

HSP 1 Score: 78.5666 bits (192), Expect = 5.599e-16
Identity = 72/256 (28.12%), Postives = 109/256 (42.58%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQSK-IIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSND----------------SHFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNF 814
            F P +V++V  +  D P+     R V +SDT    D +  Q+PYG + IH+GDF +              S +   N +   LP+  KI +AG+++                 +F + SK      E +QSLL    YLQDS   +    IYG+PW            +   +L + W  IP NTDIL+++  P     W     + +           R++P LH++G     YG++      F NAS    VNF
Sbjct:   53 FQPPHVHMVDPMPHDTPKPPGYTRFVCVSDTHSRTDAI--QMPYGDVFIHAGDFTE----------LGLPSEVKKFNDWLGTLPYDIKIVIAGNHELTFDQEFMADLIKQDFYYFPSASKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWYYGWGFNLPRG-QALLDKWNQIPDNTDILVTHCPPLGFLDWVPKKMQRVGCMELLNTVQRRVQPKLHVFGHIHEGYGMMSDGTTTFVNAS-TCTVNF 294          
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Medaka
Match: mpped2a (metallophosphoesterase MPPED2 [Source:NCBI gene;Acc:101173128])

HSP 1 Score: 73.9442 bits (180), Expect = 1.685e-14
Identity = 67/249 (26.91%), Postives = 104/249 (41.77%), Query Frame = 2
Query:  164 FNPSNVYVVGAV--DNPQ-SKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDS----------------HFSTMSK------EQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKP-----WEATFYKHIST---------RIKPILHLYGKNDGNYGVLFKDDIIFSNAS 793
            F P +V++V  +  D P+ +   R V +SDT    D +  Q+PYG +L+H GDF +              S +   N +   LP+  K+ +AG+++                  F ++SK      + +QSLL    YLQDS   +    IYGTPW            +   SL E W  +P   DIL+++  P     W     + +           R++P LH +G     YG++      F NAS
Sbjct:   31 FQPPHVHMVDPIPYDTPKPAGHTRFVCVSDTHSRTDGI--QMPYGDVLLHMGDFTE----------LGLPSEVKKFNDWLGGLPYEFKVVIAGNHELTFDKDFMAELIKQDYYRFPSVSKLKPEDFDDVQSLLTNCVYLQDSDVTIKGFRIYGTPWTPWFNGWGFNLPRG-QSLLEKWNLVPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQKRVRPKLHCFGGIHEGYGIMTDGYTTFINAS 266          
BLAST of Metallophosphoesterase MPPED2 vs. Planmine SMEST
Match: SMESG000074768.1 (SMESG000074768.1)

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 289/290 (99.66%), Postives = 290/290 (100.00%), Query Frame = 2
Query:  158 MNFNPSNVYVVGAVDNPQSKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFSTMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKPWEATFYKHISTRIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNFRSKLKTESYGFWSQDSLESTLNSKTITCFQRQKISQPGFYIKSREHYEPIVFDVYVPPKATVNCDDLIDIN 1027
            MNFNPSNVYVVGAVDNPQSKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFS+MSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKPWEATFYKHISTRIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNFRSKLKTESYGFWSQDSLESTLNSKTITCFQRQKISQPGFYIKSREHYEPIVFDVYVPPKATVNCDDLIDIN
Sbjct:    1 MNFNPSNVYVVGAVDNPQSKIIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFSSMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKPWEATFYKHISTRIKPILHLYGKNDGNYGVLFKDDIIFSNASFQSYVNFRSKLKTESYGFWSQDSLESTLNSKTITCFQRQKISQPGFYIKSREHYEPIVFDVYVPPKATVNCDDLIDIN 290          
BLAST of Metallophosphoesterase MPPED2 vs. Planmine SMEST
Match: SMESG000036432.1 (SMESG000036432.1)

HSP 1 Score: 76.6406 bits (187), Expect = 5.996e-16
Identity = 63/185 (34.05%), Postives = 86/185 (46.49%), Query Frame = 2
Query:  218 IIRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFSTMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKPW---EATFYKH----------ISTRIKPILHLYG 733
            +IR V ISDT   +  L   IP G +L+H GDF   TFF      R  L  IDN   F   LP   K+ +AG++D       K     +     YLQDS   +Y   IYGTPWV           +    L   W+ IP +TDIL+++  P    + +F K+          I  RIKP++H++G
Sbjct:   37 VIRFVAISDTH--DKHLKMNIPSGDVLLHCGDF---TFFG---DKRKHLISIDN---FLGTLPFRRKVLIAGNHDWGIFNSYKTD-PYIFKNCEYLQDSGTTIYGYNIYGTPWV-PWFHYGAFMLERGEELQGKWQKIPDDTDILLTHGPPLGYGDKSFSKNRAGDVDLLLEIQNRIKPLMHIFG 208          
BLAST of Metallophosphoesterase MPPED2 vs. Planmine SMEST
Match: SMESG000036416.1 (SMESG000036416.1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.266e-15
Identity = 58/205 (28.29%), Postives = 93/205 (45.37%), Query Frame = 2
Query:  221 IRVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFSTMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILIS-------------NQKPWEATFYKHISTRIKPILHLYGKNDGNYGVLFKDDIIFSNASF 796
            IR V ISDT G  +++  +IP   +L+H GDF     +N   RS      I + + +   LP+  KI +AG+++     ++ +          YLQDS   ++   IYGTPWV    + +    +    L E W  IP++TDIL++             N +  +      +  RIKPI+H++G      G        F+NA+ 
Sbjct:   38 IRFVAISDTHGRHNRI--KIPNCDVLLHCGDF----TYNGYKRSE-----IIDFDEYLGTLPNYKKIVIAGNHELDMHKVNNKNPYKFQN-CEYLQDSSTTIFGYKIYGTPWVPHYHRGAFMLNRG-EQLKEKWGEIPNDTDILLTHGPPLGYGDKTRGNNRAGDVDLLLEVQNRIKPIMHVFGHIHDGKGAWTDGTTTFANAAI 229          
BLAST of Metallophosphoesterase MPPED2 vs. Planmine SMEST
Match: SMESG000036432.1 (SMESG000036432.1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.304e-14
Identity = 61/183 (33.33%), Postives = 84/183 (45.90%), Query Frame = 2
Query:  224 RVVHISDTMGCEDKLFSQIPYGHILIHSGDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFSTMSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMSLSESWEGIPSNTDILISNQKPW---EATFYKH----------ISTRIKPILHLYG 733
            + V ISDT   +  L   IP G +L+H GDF   TFF      R  L  IDN   F   LP   K+ +AG++D       K     +     YLQDS   +Y   IYGTPWV           +    L   W+ IP +TDIL+++  P    + +F K+          I  RIKP++H++G
Sbjct:   11 KFVAISDTH--DKHLKMNIPSGDVLLHCGDF---TFFG---DKRKHLISIDN---FLGTLPFRRKVLIAGNHDWGIFNSYKTD-PYIFKNCEYLQDSGTTIYGYNIYGTPWV-PWFHYGAFMLERGEELQGKWQKIPDDTDILLTHGPPLGYGDKSFSKNRAGDVDLLLEIQNRIKPLMHIFG 180          
The following BLAST results are available for this feature:
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
MPPED12.380e-1628.40metallophosphoesterase domain containing 1 [Source... [more]
MPPED12.380e-1628.40metallophosphoesterase domain containing 1 [Source... [more]
MPPED22.505e-1427.31metallophosphoesterase domain containing 2 [Source... [more]
MPPED22.803e-1227.51metallophosphoesterase domain containing 2 [Source... [more]
back to top
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C25E10.123.280e-1524.14UPF0046 protein C25E10.12 [Source:UniProtKB/Swiss... [more]
K07C11.76.203e-1224.35UPF0046 protein K07C11.7 [Source:UniProtKB/Swiss-... [more]
K07C11.76.203e-1224.35UPF0046 protein K07C11.7 [Source:UniProtKB/Swiss-... [more]
K07C11.76.367e-1224.35UPF0046 protein K07C11.7 [Source:UniProtKB/Swiss-... [more]
T07D4.25.078e-823.87UPF0046 protein T07D4.2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG167172.517e-1424.69gene:FBgn0036028 transcript:FBtr0076392[more]
back to top
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpped13.371e-1628.40metallophosphoesterase domain containing 1 [Source... [more]
mpped2a1.464e-1426.91metallophosphoesterase domain containing 2a [Sourc... [more]
mpped2a1.464e-1426.91metallophosphoesterase domain containing 2a [Sourc... [more]
mpped22.726e-1426.51metallophosphoesterase domain containing 2b [Sourc... [more]
mpped22.726e-1426.51metallophosphoesterase domain containing 2b [Sourc... [more]
back to top
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bace11.199e-1326.10beta-site APP-cleaving enzyme 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mpped11.634e-1628.40metallophosphoesterase domain containing 1 [Source... [more]
Mpped11.634e-1628.40metallophosphoesterase domain containing 1 [Source... [more]
Mpped29.363e-1527.71metallophosphoesterase domain containing 2 [Source... [more]
Mpped21.179e-1427.71metallophosphoesterase domain containing 2 [Source... [more]
Mpped21.179e-1427.71metallophosphoesterase domain containing 2 [Source... [more]
back to top
BLAST of Metallophosphoesterase MPPED2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91ZG2|MPPD1_MOUSE1.143e-1528.40Metallophosphoesterase domain-containing protein 1... [more]
sp|O15442|MPPD1_HUMAN1.143e-1528.40Metallophosphoesterase domain-containing protein 1... [more]
sp|Q18161|YBPT_CAEEL4.172e-1424.14UPF0046 protein C25E10.12 OS=Caenorhabditis elegan... [more]
sp|B1WBP0|MPPD2_RAT5.146e-1427.71Metallophosphoesterase MPPED2 OS=Rattus norvegicus... [more]
sp|Q9CZJ0|MPPD2_MOUSE8.250e-1427.71Metallophosphoesterase MPPED2 OS=Mus musculus OX=1... [more]
back to top
BLAST of Metallophosphoesterase MPPED2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J9V24.464e-3335.51Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EAP41.876e-3235.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HPD35.807e-3136.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E0096.705e-3136.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HVT09.737e-3136.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mpped11.855e-1528.02metallophosphoesterase domain-containing protein 1... [more]
mpped21.054e-1326.99metallophosphoesterase domain containing 2b [Sourc... [more]
mpped22.195e-1326.99metallophosphoesterase domain containing 2b [Sourc... [more]
mpped2a3.028e-1327.23metallophosphoesterase domain containing 2a [Sourc... [more]
back to top
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO420311.396e-1729.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Metallophosphoesterase MPPED2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mpped15.599e-1628.13metallophosphoesterase domain-containing protein 1... [more]
mpped2a1.685e-1426.91metallophosphoesterase MPPED2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Metallophosphoesterase MPPED2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000074768.10.000e+099.66SMESG000074768.1[more]
SMESG000036432.15.996e-1634.05SMESG000036432.1[more]
SMESG000036416.13.266e-1528.29SMESG000036416.1[more]
SMESG000036432.11.304e-1433.33SMESG000036432.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012192 ID=SMED30012192|Name=Metallophosphoesterase MPPED2|organism=Schmidtea mediterranea sexual|type=transcript|length=1162bp
CATATTTAACTTAGCAACAGCTGTTATCATTGGTTTAAGGATATGTTAAG
GAACCAATAGAAATCAAGCCAAATATTTAATCAAATATTTCACATCTGAG
AAGTTAGATCAATCTCATTTCTGGACAGTGTCGTAATATTCAATATTATG
TTACTTTATGAATTTTAATCCCTCAAATGTCTACGTAGTGGGAGCAGTAG
ACAATCCTCAGTCAAAGATCATCCGAGTAGTTCATATCTCTGATACAATG
GGATGTGAAGACAAACTCTTCTCTCAGATTCCATACGGACATATCCTCAT
ACATTCCGGTGACTTTGGAAAATCTACTTTCTTTAATCCATTATGGCGAT
CGAGAGCTTTTCTCAGCCACATAGATAATATGAATAGATTTTTTAACCAT
TTACCTCATCCTCATAAAATTTACGTGGCTGGAAGTAATGATTCTCACTT
TTCAACTATGTCTAAAGAGCAGATTCAATCCTTATTACCACCTGTTAATT
ATCTACAAGACTCGTGGTGTCAGTTATATTCATTATTTATTTATGGGACC
CCTTGGGTTAAGAAAAGGCTCAAAATTTCAAACGCATTTACTAAAGATTT
TATGAGTCTTTCTGAGTCTTGGGAGGGTATTCCCAGTAATACAGATATAC
TCATTTCAAATCAGAAACCATGGGAAGCAACGTTTTACAAACATATTTCA
ACTAGAATTAAGCCAATTTTGCATTTATATGGGAAAAATGACGGAAATTA
TGGTGTATTATTCAAGGACGATATTATATTTAGCAATGCCTCATTTCAAT
CATATGTGAATTTCAGAAGCAAATTAAAAACCGAATCATATGGTTTTTGG
TCTCAAGATTCTCTAGAAAGTACACTGAACAGTAAAACAATTACTTGCTT
TCAGAGACAAAAAATAAGTCAACCTGGGTTTTATATAAAGTCAAGAGAAC
ACTATGAGCCAATTGTGTTTGATGTCTACGTTCCTCCCAAAGCTACCGTA
AATTGTGATGACTTAATTGATATTAATTAGCCTTTTATTTGGCTGGTTAT
AATTGTTAACCATATCAGGTTTTAATTACTAATTTTTCAACAGAATGAGC
GCAATTTTATTTGTATATATCTAAAAGTCTCATTTTGATGCAACCGCGCT
GTTTTTGAGGAT
back to top

protein sequence of SMED30012192-orf-1

>SMED30012192-orf-1 ID=SMED30012192-orf-1|Name=SMED30012192-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=291bp
MNFNPSNVYVVGAVDNPQSKIIRVVHISDTMGCEDKLFSQIPYGHILIHS
GDFGKSTFFNPLWRSRAFLSHIDNMNRFFNHLPHPHKIYVAGSNDSHFST
MSKEQIQSLLPPVNYLQDSWCQLYSLFIYGTPWVKKRLKISNAFTKDFMS
LSESWEGIPSNTDILISNQKPWEATFYKHISTRIKPILHLYGKNDGNYGV
LFKDDIIFSNASFQSYVNFRSKLKTESYGFWSQDSLESTLNSKTITCFQR
QKISQPGFYIKSREHYEPIVFDVYVPPKATVNCDDLIDIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0008081phosphoric diester hydrolase activity
GO:0016208AMP binding
GO:0019002GMP binding
GO:0030145manganese ion binding
GO:0046872metal ion binding
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000136whole organism
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029052Metallo-depent_PP-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 2..228
e-value: 8.7E-28
score: 99.2
NoneNo IPR availablePANTHERPTHR12905SPERM PROTEIN HOMOLOGcoord: 18..167
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 22..212