Nucleosome assembly protein 1-like 1

Overview
NameNucleosome assembly protein 1-like 1
Smed IDSMED30012187
Length (bp)1244
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleosome assembly protein 1-like 1 (SMED30012187) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleosome assembly protein 1-like 1 (SMED30012187) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleosome assembly protein 1-like 1 (SMED30012187) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleosome assembly protein 1-like 1 (SMED30012187) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012187

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30012187h1SMcG0012480 dd_Smed_v4_997_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30012187h1SMcG0012480 dd_Smed_v6_997_0_1dd_Smed_v6PMID:29674432
Plass et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Human
Match: NAP1L1 (nucleosome assembly protein 1 like 1 [Source:HGNC Symbol;Acc:HGNC:7637])

HSP 1 Score: 264.233 bits (674), Expect = 2.081e-84
Identity = 149/306 (48.69%), Postives = 201/306 (65.69%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA I    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    FVLEFHF  NEYF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP     G  ++  + E +L ADFE+G ++RERIIPR+VLY+TG
Sbjct:   42 MMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESG--DLDDDAEAILAADFEIGHFLRERIIPRSVLYFTG 344          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Human
Match: NAP1L1 (nucleosome assembly protein 1 like 1 [Source:HGNC Symbol;Acc:HGNC:7637])

HSP 1 Score: 260.766 bits (665), Expect = 8.428e-84
Identity = 148/305 (48.52%), Postives = 200/305 (65.57%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA I    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    FVLEFHF  NEYF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP     G  ++  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:    1 MMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESG--DLDDDAEAILAADFEIGHFLRERIIPRSVLYFT 302          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Human
Match: NAP1L1 (nucleosome assembly protein 1 like 1 [Source:HGNC Symbol;Acc:HGNC:7637])

HSP 1 Score: 261.536 bits (667), Expect = 1.362e-83
Identity = 148/305 (48.52%), Postives = 200/305 (65.57%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA I    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    FVLEFHF  NEYF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP     G  ++  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   42 MMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESG--DLDDDAEAILAADFEIGHFLRERIIPRSVLYFT 343          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Human
Match: NAP1L1 (nucleosome assembly protein 1 like 1 [Source:HGNC Symbol;Acc:HGNC:7637])

HSP 1 Score: 261.536 bits (667), Expect = 2.494e-83
Identity = 148/305 (48.52%), Postives = 200/305 (65.57%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA I    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    FVLEFHF  NEYF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP     G  ++  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   36 MMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESG--DLDDDAEAILAADFEIGHFLRERIIPRSVLYFT 337          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Human
Match: NAP1L1 (nucleosome assembly protein 1 like 1 [Source:HGNC Symbol;Acc:HGNC:7637])

HSP 1 Score: 261.536 bits (667), Expect = 2.883e-83
Identity = 148/305 (48.52%), Postives = 200/305 (65.57%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA I    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    FVLEFHF  NEYF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP     G  ++  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   42 MMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESG--DLDDDAEAILAADFEIGHFLRERIIPRSVLYFT 343          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Celegans
Match: nap-1 (Nucleosome Assembly Protein [Source:UniProtKB/TrEMBL;Acc:Q19007])

HSP 1 Score: 184.111 bits (466), Expect = 1.054e-54
Identity = 120/295 (40.68%), Postives = 171/295 (57.97%), Query Frame = 2
Query:  185 EIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECE---YDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPP-TESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            + GL        + LP+ +K+RV ALKNLQ+++I+IE  F+K +  LE +F   ++  +++R  IV G+ EPT  + +    +    D+LAE            +  E      GI +FWLT L   +L+   I+E+D PIL +LTD+    +  D  GF +EFHF+ N YF ++ LTK Y +  +   + P +++GP +IR  G  I W  GKNVT K VKK QK    + K  +TK VK DSFFNFFEPP ++    E+E   + E  LE D+EMGQ IR+ IIPRAVL+YTG
Sbjct:    8 DAGLLSTNFDMIQALPLNVKQRVCALKNLQMKTIQIESDFYKRVHELEIEFEGKFKSTFDQRKAIVAGEVEPTKEQIDTPILEGLEGDQLAELY----------KAAEADPSAKGIKDFWLTALRTHDLVAEAIEEHDVPILSYLTDVTTAASK-DPAGFKIEFHFATNPYFKNQVLTKTYLLGFDPDAEAPLQFDGPHVIRAVGDTIEWEDGKNVTKKAVKKKQKKGANAGK-FLTKTVKADSFFNFFEPPKSKDERNEDEDDEQAEEFLELDYEMGQAIRDTIIPRAVLFYTG 290          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Fly
Match: Nap1 (gene:FBgn0015268 transcript:FBtr0305990)

HSP 1 Score: 216.468 bits (550), Expect = 2.574e-66
Identity = 115/300 (38.33%), Postives = 175/300 (58.33%), Query Frame = 2
Query:  167 LASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEY---DSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            + +  + +  R    +  + LP  ++ R+  LKNLQL+ + IE  FF+++  LE K+   YQ +++KR EI+ GK +P + + ++   +S T +E   +   +A+ +     +    D  GIP FWLTV  N+ ++   +Q +D P ++ L DI    + G  H + LEFHF  NEYFS+  LTK+Y +      + PF +EGPEI +  GC I+W    N+TVK ++K QK K R   RT+ K V  DSFFNFF PP E    +EE+  + + +L  DFE+G ++R RIIP+AVLYYTG
Sbjct:   29 MPAYMNSVMRRQYLQQMVKMLPAPVQNRIVFLKNLQLQHLNIEAQFFEDVYKLEQKYQVQYQPLFDKRREIIEGKVDPAEEKPQWKEPESSTDNEADAEHFREALSSL----KSIPKDAKGIPGFWLTVFRNTAIMSEMVQPHDEPAIRKLIDISIKYDNG--HSYTLEFHFDKNEYFSNSVLTKQYVLKSTVDPNDPFAFEGPEIYKCTGCTINWEKKMNLTVKTIRKKQKHKERGAVRTIVKQVPTDSFFNFFSPP-EVPSDQEEVDDDSQQILATDFEIGHFLRARIIPKAVLYYTG 321          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Fly
Match: Nap1 (gene:FBgn0015268 transcript:FBtr0305989)

HSP 1 Score: 216.468 bits (550), Expect = 2.574e-66
Identity = 115/300 (38.33%), Postives = 175/300 (58.33%), Query Frame = 2
Query:  167 LASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEY---DSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            + +  + +  R    +  + LP  ++ R+  LKNLQL+ + IE  FF+++  LE K+   YQ +++KR EI+ GK +P + + ++   +S T +E   +   +A+ +     +    D  GIP FWLTV  N+ ++   +Q +D P ++ L DI    + G  H + LEFHF  NEYFS+  LTK+Y +      + PF +EGPEI +  GC I+W    N+TVK ++K QK K R   RT+ K V  DSFFNFF PP E    +EE+  + + +L  DFE+G ++R RIIP+AVLYYTG
Sbjct:   29 MPAYMNSVMRRQYLQQMVKMLPAPVQNRIVFLKNLQLQHLNIEAQFFEDVYKLEQKYQVQYQPLFDKRREIIEGKVDPAEEKPQWKEPESSTDNEADAEHFREALSSL----KSIPKDAKGIPGFWLTVFRNTAIMSEMVQPHDEPAIRKLIDISIKYDNG--HSYTLEFHFDKNEYFSNSVLTKQYVLKSTVDPNDPFAFEGPEIYKCTGCTINWEKKMNLTVKTIRKKQKHKERGAVRTIVKQVPTDSFFNFFSPP-EVPSDQEEVDDDSQQILATDFEIGHFLRARIIPKAVLYYTG 321          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Fly
Match: Nap1 (gene:FBgn0015268 transcript:FBtr0072219)

HSP 1 Score: 216.468 bits (550), Expect = 2.574e-66
Identity = 115/300 (38.33%), Postives = 175/300 (58.33%), Query Frame = 2
Query:  167 LASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEY---DSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            + +  + +  R    +  + LP  ++ R+  LKNLQL+ + IE  FF+++  LE K+   YQ +++KR EI+ GK +P + + ++   +S T +E   +   +A+ +     +    D  GIP FWLTV  N+ ++   +Q +D P ++ L DI    + G  H + LEFHF  NEYFS+  LTK+Y +      + PF +EGPEI +  GC I+W    N+TVK ++K QK K R   RT+ K V  DSFFNFF PP E    +EE+  + + +L  DFE+G ++R RIIP+AVLYYTG
Sbjct:   29 MPAYMNSVMRRQYLQQMVKMLPAPVQNRIVFLKNLQLQHLNIEAQFFEDVYKLEQKYQVQYQPLFDKRREIIEGKVDPAEEKPQWKEPESSTDNEADAEHFREALSSL----KSIPKDAKGIPGFWLTVFRNTAIMSEMVQPHDEPAIRKLIDISIKYDNG--HSYTLEFHFDKNEYFSNSVLTKQYVLKSTVDPNDPFAFEGPEIYKCTGCTINWEKKMNLTVKTIRKKQKHKERGAVRTIVKQVPTDSFFNFFSPP-EVPSDQEEVDDDSQQILATDFEIGHFLRARIIPKAVLYYTG 321          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Fly
Match: CG3708 (gene:FBgn0040345 transcript:FBtr0331301)

HSP 1 Score: 169.859 bits (429), Expect = 1.051e-48
Identity = 102/292 (34.93%), Postives = 165/292 (56.51%), Query Frame = 2
Query:  224 QLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEE-----REN----SDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKL--TKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLD---GEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            QL   ++ R+RAL++ QL+ ++I E FF+E+  LE +F      +++ R +I+ G  EP         +T     ED  D   +  G+ E     R+     S    G+P FWLTV +N  L+   +Q++D P+L+ L D++      D+  +++ F F  N +  D  L  TK YF+  +A  + PF +EGPEI+R  GC+IHW  G N+T++ V+   + +NR+ +  VTKV+  +SFF FF PP ++LD    +E+  + + N    DFE+G  +R +I+P+AVL+YTG
Sbjct:   64 QLAEPVQNRIRALRHNQLQQVRISEQFFREVYELERRFYGQSCALFDARRDILEGSVEPP-------IQTEKTWPEDPQDALYLDFGNNEELRQLRQKLAPVSPTTLGVPRFWLTVFQNVPLLSELVQDHDEPLLESLMDVRL---AYDQDSYMVIFQFRPNSFLHDSSLLLTKRYFLQHSADPEYPFLFEGPEIVRCEGCHIHWRDGSNLTLQTVES--RRRNRAHR--VTKVMPRESFFRFFAPP-QALDLSLADEKTKLILGN----DFEVGFLLRTQIVPKAVLFYTG 336          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Fly
Match: mil (gene:FBgn0267366 transcript:FBtr0085246)

HSP 1 Score: 116.701 bits (291), Expect = 1.375e-29
Identity = 81/272 (29.78%), Postives = 130/272 (47.79%), Query Frame = 2
Query:  242 KKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            KK +  LK L LE+I ++ +  +++  +E K+ + +  +++KR +I+   R+   G+ E +                                +P FWL VL+ S    F I + D  IL+ L+DI+  L       F +EFHF  N+YF++  LTK YF++     D P  Y+G EI +  GC I W        K  K   K +N+             SFF FF PP    D  +    ++  +L+ DFE+G Y++ER+IP+AV+++TG
Sbjct:   31 KKTLTELKQLYLETINLDVALQRDIYNIEKKYEDKHNIIFDKRKKILDEFRKQNHGDVETNQ------------------------------SVPNFWLRVLKAS-YTEF-ISKRDEKILECLSDIRSRLYNEPVVKFDIEFHFDPNDYFTNTVLTKTYFLNCLPDPDDPLAYDGAEIYKCEGCVIDW--------KQTKDQTKTENQEP-----------SFFEFFSPPLLPEDTLDPNYCDVNAMLQNDFEVGFYLKERVIPKAVIFFTG 251          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Zebrafish
Match: nap1l4b (nucleosome assembly protein 1-like 4b [Source:ZFIN;Acc:ZDB-GENE-041114-168])

HSP 1 Score: 265.388 bits (677), Expect = 2.970e-85
Identity = 148/311 (47.59%), Postives = 200/311 (64.31%), Query Frame = 2
Query:  134 VSEDLMNNPEILASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADE--LAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDE-HGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            VS+  M NP+ LA+LQD++     +    + LP  +K+RV AL+NLQ+ S  IE  F+KE+  LE K++ +YQ +++KR ++V+G+ EPTD ECE+ S+  DE  LAED+  KA I    E+  N +   GIPEFWLT+  + +++   +QE+D PILKHL DIK + +  D+   F LEFHF  NEYF++  LTK Y +      D PF +EGPEII   GC I W  GK+VTVK +KK QK K R   R +TK V NDSFFNFF P   S D  +E+  + E  L  DFE+G + RERI+PRAVLY+TG
Sbjct:   11 VSDQAMQNPQALAALQDKLDSVSHSASIMDSLPKSVKRRVNALRNLQVNSTHIEAKFYKEVHELERKYSALYQPLFDKRRKVVSGEVEPTDEECEWQSDHEDEAALAEDLKKKAAIEEKTEDA-NEEKPKGIPEFWLTIFRSVDMLSDMLQEHDEPILKHLHDIKVIFSGPDQPMSFTLEFHFEPNEYFTNTVLTKVYKMKSEPDADDPFSFEGPEIIDCEGCEIDWQKGKDVTVKTIKKKQKHKGRGTARVITKQVPNDSFFNFFNPIKVSPD--KELDEDSEYTLATDFEIGHFFRERIVPRAVLYFTG 318          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Zebrafish
Match: nap1l1 (nucleosome assembly protein 1-like 1 [Source:ZFIN;Acc:ZDB-GENE-030516-2])

HSP 1 Score: 253.447 bits (646), Expect = 2.609e-80
Identity = 144/312 (46.15%), Postives = 196/312 (62.82%), Query Frame = 2
Query:  134 VSEDLMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELA---EDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            ++  +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++   IE  F++E+  LE K+A +YQ +++KR+EIV    EPTD ECE+  +  +EL    ++   +      +++ E  +D  GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    F LEFHF  N++F+   LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP     G  E+  + E +L ADFE+G +IRERI+PRAVLY+T
Sbjct:   26 LTRQMMQNPQILAALQERLDGLVGSPSGYMESLPKVVKRRVNALKNLQVKCAHIEAKFYEEVHELERKYAALYQPLFDKRSEIVRAAYEPTDEECEWKQDEEEELTVSKQEEMKEKAKVEEEKKDEEKEDPKGIPEFWLTVFKNVDLLSEMLQEHDEPILKHLQDIKVKFSDAGQPMSFTLEFHFEPNDFFTQTILTKTYKMRSEPDESDPFSFDGPEIMGCTGCTIDWTKGKNVTLKTIKKKQKHKGRGTVRTVTKTVPNDSFFNFFSPPEVPESG--ELDEDSEAVLAADFEIGHFIRERIVPRAVLYFT 335          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Zebrafish
Match: nap1l4a (nucleosome assembly protein 1-like 4a [Source:ZFIN;Acc:ZDB-GENE-030131-9099])

HSP 1 Score: 230.72 bits (587), Expect = 4.360e-72
Identity = 136/293 (46.42%), Postives = 186/293 (63.48%), Query Frame = 2
Query:  185 EIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETA-DELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            E  L+++ +  +  LP  +K+RV ALK LQL+S  IE  F++E+  LE K+A +YQ + +KR EIVTG  EPTD ECE+ S+   DELA+D+  KA +     +  ++ D  GIP+FWLT+ ++ +++   +QE+D PILKHL D+    +  G    F LEFHF  N YFS+  LTK Y +        PF +EGPEI+   GC I W  GK+VTVK+VKK QK K R   RTV+K +  DSFFNFF P   S DG +E   +++  L  DFE+G + RER+IPRAVLY+TG
Sbjct:   22 EAFLQVERVPNFNLLPKNVKRRVYALKRLQLQSGNIEAKFYEEVHELERKYAGLYQPILDKRREIVTGAVEPTDEECEWHSDKEEDELADDLQKKAALEEKQADSASAVDPKGIPDFWLTIFKHVDMLGEMLQEHDEPILKHLQDVTVKFSEPGQPMSFTLEFHFEPNSYFSNTVLTKVYKMKSEPDAADPFSFEGPEIVDCEGCKIDWHKGKDVTVKIVKKKQKHKGRGTIRTVSKEIPQDSFFNFFNPVKASPDGMDE---DLDFTLATDFEIGHFFRERVIPRAVLYFTG 311          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Zebrafish
Match: nap1l4a (nucleosome assembly protein 1-like 4a [Source:ZFIN;Acc:ZDB-GENE-030131-9099])

HSP 1 Score: 230.72 bits (587), Expect = 6.416e-72
Identity = 136/293 (46.42%), Postives = 186/293 (63.48%), Query Frame = 2
Query:  185 EIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETA-DELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            E  L+++ +  +  LP  +K+RV ALK LQL+S  IE  F++E+  LE K+A +YQ + +KR EIVTG  EPTD ECE+ S+   DELA+D+  KA +     +  ++ D  GIP+FWLT+ ++ +++   +QE+D PILKHL D+    +  G    F LEFHF  N YFS+  LTK Y +        PF +EGPEI+   GC I W  GK+VTVK+VKK QK K R   RTV+K +  DSFFNFF P   S DG +E   +++  L  DFE+G + RER+IPRAVLY+TG
Sbjct:   22 EAFLQVERVPNFNLLPKNVKRRVYALKRLQLQSGNIEAKFYEEVHELERKYAGLYQPILDKRREIVTGAVEPTDEECEWHSDKEEDELADDLQKKAALEEKQADSASAVDPKGIPDFWLTIFKHVDMLGEMLQEHDEPILKHLQDVTVKFSEPGQPMSFTLEFHFEPNSYFSNTVLTKVYKMKSEPDAADPFSFEGPEIVDCEGCKIDWHKGKDVTVKIVKKKQKHKGRGTIRTVSKEIPQDSFFNFFNPVKASPDGMDE---DLDFTLATDFEIGHFFRERVIPRAVLYFTG 311          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Zebrafish
Match: nap1l4a (nucleosome assembly protein 1-like 4a [Source:ZFIN;Acc:ZDB-GENE-030131-9099])

HSP 1 Score: 229.565 bits (584), Expect = 1.309e-71
Identity = 136/293 (46.42%), Postives = 184/293 (62.80%), Query Frame = 2
Query:  185 EIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETA-DELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            E  L+++ +  +  LP  +K+RV ALK LQL+S  IE  F++E+  LE K+A +YQ + +KR EIVTG  EPTD ECE+ S+   DELA+D+  KA +     +  ++ D  GIP+FWLT+ ++ +++   +QE+D PILKHL D+    +  G    F LEFHF  N YFS+  LTK Y +        PF +EGPEI+   GC I W  GK+VTVK+VKK QK K R   RTV+K +  DSFFNFF P   S DG     V ++  L  DFE+G + RER+IPRAVLY+TG
Sbjct:   22 EAFLQVERVPNFNLLPKNVKRRVYALKRLQLQSGNIEAKFYEEVHELERKYAGLYQPILDKRREIVTGAVEPTDEECEWHSDKEEDELADDLQKKAALEEKQADSASAVDPKGIPDFWLTIFKHVDMLGEMLQEHDEPILKHLQDVTVKFSEPGQPMSFTLEFHFEPNSYFSNTVLTKVYKMKSEPDAADPFSFEGPEIVDCEGCKIDWHKGKDVTVKIVKKKQKHKGRGTIRTVSKEIPQDSFFNFFNPVKASPDG----MVNLDFTLATDFEIGHFFRERVIPRAVLYFTG 310          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Xenopus
Match: nap1l1 (nucleosome assembly protein 1 like 1 [Source:NCBI gene;Acc:407956])

HSP 1 Score: 247.284 bits (630), Expect = 9.888e-78
Identity = 137/309 (44.34%), Postives = 200/309 (64.72%), Query Frame = 2
Query:  134 VSEDLMNNPEILASLQDEIGLRMKAMKKY-EQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            ++  +M NP++LA+LQ+ +   +     Y E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR++I+    EPT+ ECE+  +  ++++ +  +       +++ E  +D  GIPEFWLTV +N +L+   +QE+D PILKHL DIK   +  G    F LEFHF  N++F++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  E+  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   44 LTAQMMQNPQVLAALQERLDDLVGTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHELERKYAALYQPLFDKRSDIINATYEPTEEECEWKVDEEEDISVNWKEDKAKLEEEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSEAGQPMSFTLEFHFEPNDFFTNEVLTKTYKMRSEPDESDPFSFDGPEIMGCTGCLIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVPNDSFFNFFSPPEVPENG--ELDDDAEAILTADFEIGHFLRERIIPRSVLYFT 350          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Xenopus
Match: nap1l1 (nucleosome assembly protein 1 like 1 [Source:NCBI gene;Acc:407956])

HSP 1 Score: 247.284 bits (630), Expect = 1.093e-77
Identity = 141/309 (45.63%), Postives = 202/309 (65.37%), Query Frame = 2
Query:  134 VSEDLMNNPEILASLQDEIGLRMKAMKKY-EQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            ++  +M NP++LA+LQ+ +   +     Y E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR++I+    EPT+ ECE+  +  ++++ D+ DKA +    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK   +  G    F LEFHF  N++F++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  E+  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   48 LTAQMMQNPQVLAALQERLDDLVGTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHELERKYAALYQPLFDKRSDIINATYEPTEEECEWKVDEEEDISGDLKDKAKLEEEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSEAGQPMSFTLEFHFEPNDFFTNEVLTKTYKMRSEPDESDPFSFDGPEIMGCTGCLIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVPNDSFFNFFSPPEVPENG--ELDDDAEAILTADFEIGHFLRERIIPRSVLYFT 353          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Xenopus
Match: nap1l1 (nucleosome assembly protein 1 like 1 [Source:NCBI gene;Acc:407956])

HSP 1 Score: 246.899 bits (629), Expect = 1.156e-77
Identity = 141/309 (45.63%), Postives = 202/309 (65.37%), Query Frame = 2
Query:  134 VSEDLMNNPEILASLQDEIGLRMKAMKKY-EQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            ++  +M NP++LA+LQ+ +   +     Y E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR++I+    EPT+ ECE+  +  ++++ D+ DKA +    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK   +  G    F LEFHF  N++F++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  E+  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   37 LTAQMMQNPQVLAALQERLDDLVGTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHELERKYAALYQPLFDKRSDIINATYEPTEEECEWKVDEEEDISGDLKDKAKLEEEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSEAGQPMSFTLEFHFEPNDFFTNEVLTKTYKMRSEPDESDPFSFDGPEIMGCTGCLIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVPNDSFFNFFSPPEVPENG--ELDDDAEAILTADFEIGHFLRERIIPRSVLYFT 342          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Xenopus
Match: nap1l1 (nucleosome assembly protein 1 like 1 [Source:NCBI gene;Acc:407956])

HSP 1 Score: 247.284 bits (630), Expect = 1.212e-77
Identity = 141/309 (45.63%), Postives = 202/309 (65.37%), Query Frame = 2
Query:  134 VSEDLMNNPEILASLQDEIGLRMKAMKKY-EQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            ++  +M NP++LA+LQ+ +   +     Y E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR++I+    EPT+ ECE+  +  ++++ D+ DKA +    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK   +  G    F LEFHF  N++F++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  E+  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   48 LTAQMMQNPQVLAALQERLDDLVGTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHELERKYAALYQPLFDKRSDIINATYEPTEEECEWKVDEEEDISGDLKDKAKLEEEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSEAGQPMSFTLEFHFEPNDFFTNEVLTKTYKMRSEPDESDPFSFDGPEIMGCTGCLIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVPNDSFFNFFSPPEVPENG--ELDDDAEAILTADFEIGHFLRERIIPRSVLYFT 353          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Xenopus
Match: nap1l1 (nucleosome assembly protein 1 like 1 [Source:NCBI gene;Acc:407956])

HSP 1 Score: 244.973 bits (624), Expect = 2.472e-77
Identity = 141/304 (46.38%), Postives = 199/304 (65.46%), Query Frame = 2
Query:  149 MNNPEILASLQDEIGLRMKAMKKY-EQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            M NP++LA+LQ+ +   +     Y E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR++I+    EPT+ ECE+  +  ++++ D+ DKA +    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK   +  G    F LEFHF  N++F++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  E+  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:    1 MQNPQVLAALQERLDDLVGTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHELERKYAALYQPLFDKRSDIINATYEPTEEECEWKVDEEEDISGDLKDKAKLEEEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSEAGQPMSFTLEFHFEPNDFFTNEVLTKTYKMRSEPDESDPFSFDGPEIMGCTGCLIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVPNDSFFNFFSPPEVPENG--ELDDDAEAILTADFEIGHFLRERIIPRSVLYFT 301          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Mouse
Match: Nap1l1 (nucleosome assembly protein 1-like 1 [Source:MGI Symbol;Acc:MGI:1855693])

HSP 1 Score: 263.077 bits (671), Expect = 4.197e-84
Identity = 148/306 (48.37%), Postives = 202/306 (66.01%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA I    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    FVLEFHF  N+YF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  ++  + E +L ADFE+G ++RERIIPR+VLY+TG
Sbjct:   42 MMQNPQILAALQERLDGLVDTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEVSEELKEKAKIEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNDYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPENG--DLDDDAEAILAADFEIGHFLRERIIPRSVLYFTG 344          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Mouse
Match: Nap1l1 (nucleosome assembly protein 1-like 1 [Source:MGI Symbol;Acc:MGI:1855693])

HSP 1 Score: 260.766 bits (665), Expect = 2.441e-83
Identity = 147/305 (48.20%), Postives = 201/305 (65.90%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA I    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    FVLEFHF  N+YF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  ++  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   42 MMQNPQILAALQERLDGLVDTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEVSEELKEKAKIEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNDYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPENG--DLDDDAEAILAADFEIGHFLRERIIPRSVLYFT 343          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Mouse
Match: Nap1l1 (nucleosome assembly protein 1-like 1 [Source:MGI Symbol;Acc:MGI:1855693])

HSP 1 Score: 260.766 bits (665), Expect = 4.343e-83
Identity = 147/305 (48.20%), Postives = 201/305 (65.90%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA I    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    FVLEFHF  N+YF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  ++  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   42 MMQNPQILAALQERLDGLVDTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEVSEELKEKAKIEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNDYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPENG--DLDDDAEAILAADFEIGHFLRERIIPRSVLYFT 343          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Mouse
Match: Nap1l1 (nucleosome assembly protein 1-like 1 [Source:MGI Symbol;Acc:MGI:1855693])

HSP 1 Score: 260.766 bits (665), Expect = 4.343e-83
Identity = 147/305 (48.20%), Postives = 201/305 (65.90%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA I    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    FVLEFHF  N+YF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  ++  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   42 MMQNPQILAALQERLDGLVDTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEVSEELKEKAKIEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNDYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPENG--DLDDDAEAILAADFEIGHFLRERIIPRSVLYFT 343          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Mouse
Match: Nap1l1 (nucleosome assembly protein 1-like 1 [Source:MGI Symbol;Acc:MGI:1855693])

HSP 1 Score: 260.766 bits (665), Expect = 4.343e-83
Identity = 147/305 (48.20%), Postives = 201/305 (65.90%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA I    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    FVLEFHF  N+YF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  ++  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   42 MMQNPQILAALQERLDGLVDTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEVSEELKEKAKIEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNDYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPENG--DLDDDAEAILAADFEIGHFLRERIIPRSVLYFT 343          
BLAST of Nucleosome assembly protein 1-like 1 vs. UniProt/SwissProt
Match: sp|Q2TA40|NP1L4_BOVIN (Nucleosome assembly protein 1-like 4 OS=Bos taurus OX=9913 GN=NAP1L4 PE=2 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 2.820e-83
Identity = 146/321 (45.48%), Postives = 198/321 (61.68%), Query Frame = 2
Query:  107 ARKDKNDSSVSEDLMNNPEILASLQDEIGLRMKAMKKY-EQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETA--DELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            A+   N   +++ +M NP++LA+LQ+ +         Y E LP  +K+R+ ALK LQ++   IE  F++E+  LE K+A +YQ +++KR E +TG  EPTD E E+ SET   D+LA D+ +KA+I   +          GIPEFW T+  N +++   +QEYD PILKHL DIK    + G    FVLEFHF  ++YF++  LTK Y +        PF +EGPEI+   GC I W  GKNVTVK +KK QK K R   RT+TK V NDSFFNFF P   S DG E +  + E  L +DFE+G + RERI+PRAVLY+TG
Sbjct:   18 AKNASNTEKLTDQVMQNPQVLAALQERLDNVSHTPSSYIETLPKAVKRRINALKQLQVKCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSETEEEDKLAGDMKNKAVIAEKEAAAAEEPAPRGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPDDYFTNPVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNDSFFNFFSPLRASGDG-ESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTG 337          
BLAST of Nucleosome assembly protein 1-like 1 vs. UniProt/SwissProt
Match: sp|P55209|NP1L1_HUMAN (Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 1.384e-82
Identity = 148/305 (48.52%), Postives = 200/305 (65.57%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA I    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    FVLEFHF  NEYF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP     G  ++  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   42 MMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESG--DLDDDAEAILAADFEIGHFLRERIIPRSVLYFT 343          
BLAST of Nucleosome assembly protein 1-like 1 vs. UniProt/SwissProt
Match: sp|Q5R4D4|NP1L1_PONAB (Nucleosome assembly protein 1-like 1 OS=Pongo abelii OX=9601 GN=NAP1L1 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 1.832e-82
Identity = 148/305 (48.52%), Postives = 200/305 (65.57%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA I    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK   +  G    FVLEFHF  NEYF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP     G  ++  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   42 MMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSGAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESG--DLDDDAEAILAADFEIGHFLRERIIPRSVLYFT 343          
BLAST of Nucleosome assembly protein 1-like 1 vs. UniProt/SwissProt
Match: sp|P28656|NP1L1_MOUSE (Nucleosome assembly protein 1-like 1 OS=Mus musculus OX=10090 GN=Nap1l1 PE=1 SV=2)

HSP 1 Score: 260.766 bits (665), Expect = 3.038e-82
Identity = 147/305 (48.20%), Postives = 201/305 (65.90%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA I    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    FVLEFHF  N+YF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  ++  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   42 MMQNPQILAALQERLDGLVDTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEVSEELKEKAKIEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNDYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPENG--DLDDDAEAILAADFEIGHFLRERIIPRSVLYFT 343          
BLAST of Nucleosome assembly protein 1-like 1 vs. UniProt/SwissProt
Match: sp|A6H767|NP1L1_BOVIN (Nucleosome assembly protein 1-like 1 OS=Bos taurus OX=9913 GN=NAP1L1 PE=2 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 3.728e-82
Identity = 147/305 (48.20%), Postives = 200/305 (65.57%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++  +IE  F++E+  LE K+A +YQ +++KR EI+    EPT+ ECE+  +  DE++E++ +KA +    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    FVLEFHF  NEYF++E LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP     G  ++  + E +L ADFE+G ++RERIIPR+VLY+T
Sbjct:   42 MMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKVEDEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESG--DLDDDSEAILAADFEIGHFLRERIIPRSVLYFT 343          
BLAST of Nucleosome assembly protein 1-like 1 vs. TrEMBL
Match: C1LHF8 (NAP-1-related protein OS=Schistosoma japonicum OX=6182 GN=hNRP PE=2 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 7.838e-99
Identity = 150/291 (51.55%), Postives = 205/291 (70.45%), Query Frame = 2
Query:  197 RMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEY----DSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            +++A+++Y  LP  +K+RVRALK LQ E++KI+  F+KEL  LEAK+   +Q V+ KR ++V+G  EP DGEC++    D    D L+E +   A +T      +   +  GIP+FWL  L+N  L    +QE+DR ILKHL DIKC+L+TGD  GF LEF+FS N+YF+++ LTK Y+ +   P D PF YEGPEI+RT GC I+W PGKNVTVKLVKKVQK K+   KRTVTK V+ DSFFNFF PP ++L   +E+  + E LLE+DF++GQ++RE +IP+AVLY+TG
Sbjct:   29 KLQALQEYHLLPASVKRRVRALKKLQHETLKIDSEFYKELFELEAKYDVKHQLVFKKRRDVVSGSIEPNDGECDWPTDDDDSCLDNLSERLKSTANVTKESNNEDPQSEIKGIPDFWLKTLQNISLFDEIVQEHDRDILKHLVDIKCVLHTGDSPGFTLEFYFSPNKYFTNDVLTKTYYFNYEIPKDDPFSYEGPEIVRTVGCVIYWNPGKNVTVKLVKKVQKRKSGGAKRTVTKSVREDSFFNFFSPPAQAL--SDELDEDTEMLLESDFKLGQFLRESVIPKAVLYFTG 317          
BLAST of Nucleosome assembly protein 1-like 1 vs. TrEMBL
Match: A0A4Z2DHG2 (Nucleosome assembly protein 1-like 4 isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_000920 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 3.717e-97
Identity = 149/291 (51.20%), Postives = 204/291 (70.10%), Query Frame = 2
Query:  197 RMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEY----DSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            +++A+++Y  LP  +K+RVRALK LQ E++KI+  F+KEL  LEAK+   +Q V+ KR ++V+G  EP D EC++    D    D L+E +   A +T      +   +  GIP+FWL  L+N  L    +QE+DR ILKHL DIKC+L+TGD  GF LEF+FS N+YF+++ LTK Y+ +   P D PF YEGPEI+RT GC I+W PGKNVTVKLVKKVQK K+   KRTVTK V+ DSFFNFF PP ++L   +E+  + E LLE+DF++GQ++RE +IP+AVLY+TG
Sbjct:   29 KLQALQEYHLLPASVKRRVRALKKLQHETLKIDSEFYKELFELEAKYDVKHQLVFKKRRDVVSGSIEPNDEECDWPTDDDDSCLDNLSERLKSTANVTKEANNEDPQSEIKGIPDFWLKTLQNISLFDEIVQEHDRDILKHLVDIKCVLHTGDSPGFTLEFYFSPNKYFTNDVLTKTYYFNYEIPKDDPFSYEGPEIVRTVGCVIYWNPGKNVTVKLVKKVQKRKSGGAKRTVTKSVREDSFFNFFSPPAQAL--SDELDEDTEMLLESDFKLGQFLRESVIPKAVLYFTG 317          
BLAST of Nucleosome assembly protein 1-like 1 vs. TrEMBL
Match: A0A4Z2DHH7 (Nucleosome assembly protein 1-like 4 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_000920 PE=3 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 5.992e-97
Identity = 149/291 (51.20%), Postives = 204/291 (70.10%), Query Frame = 2
Query:  197 RMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEY----DSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            +++A+++Y  LP  +K+RVRALK LQ E++KI+  F+KEL  LEAK+   +Q V+ KR ++V+G  EP D EC++    D    D L+E +   A +T      +   +  GIP+FWL  L+N  L    +QE+DR ILKHL DIKC+L+TGD  GF LEF+FS N+YF+++ LTK Y+ +   P D PF YEGPEI+RT GC I+W PGKNVTVKLVKKVQK K+   KRTVTK V+ DSFFNFF PP ++L   +E+  + E LLE+DF++GQ++RE +IP+AVLY+TG
Sbjct:   29 KLQALQEYHLLPASVKRRVRALKKLQHETLKIDSEFYKELFELEAKYDVKHQLVFKKRRDVVSGSIEPNDEECDWPTDDDDSCLDNLSERLKSTANVTKEANNEDPQSEIKGIPDFWLKTLQNISLFDEIVQEHDRDILKHLVDIKCVLHTGDSPGFTLEFYFSPNKYFTNDVLTKTYYFNYEIPKDDPFSYEGPEIVRTVGCVIYWNPGKNVTVKLVKKVQKRKSGGAKRTVTKSVREDSFFNFFSPPAQAL--SDELDEDTEMLLESDFKLGQFLRESVIPKAVLYFTG 317          
BLAST of Nucleosome assembly protein 1-like 1 vs. TrEMBL
Match: G4VFS5 (Putative nucleosome assembly protein OS=Schistosoma mansoni OX=6183 GN=Smp_023530 PE=3 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.337e-96
Identity = 151/291 (51.89%), Postives = 207/291 (71.13%), Query Frame = 2
Query:  197 RMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSE----TADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            ++ A+ +Y  LP  +K+RVRALK LQ E++KI+  F+KEL  LE K+   +Q +++KR +IV G  EPTD +C++ ++    + D L+E +   A +T    E++   D  G+PEFWL  LEN  L    +Q++DR ILKHL DIKC+LNTG+E GF LEF+FS N YF++  LTK Y+ + + P D PF YEGPEI+RT GC I+W PGKNVTVKLVKKVQK K+   KRT+TK V+ DSFFNFFEPP E+L   +++  + E LLE+DF++GQ++RE +IPRAVLY+TG
Sbjct:   29 KLSALHEYHHLPGPVKRRVRALKKLQYETLKIDSEFYKELFTLEVKYNVQHQQIFSKRRDIVLGGIEPTDEDCDWPTDDDDISLDNLSERLKSTANVTKDTSEKDCQSDIKGVPEFWLKTLENISLFDEMVQDHDRDILKHLIDIKCVLNTGEESGFTLEFYFSTNNYFTNSVLTKRYYFNYDIPNDDPFGYEGPEIVRTKGCVINWHPGKNVTVKLVKKVQKRKSGGAKRTITKSVREDSFFNFFEPPAETL--SDDLDKDTEMLLESDFKLGQFLRESVIPRAVLYFTG 317          
BLAST of Nucleosome assembly protein 1-like 1 vs. TrEMBL
Match: A0A4Z2DHH5 (Nucleosome assembly protein 1-like 4 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_000920 PE=3 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 1.864e-96
Identity = 149/291 (51.20%), Postives = 204/291 (70.10%), Query Frame = 2
Query:  197 RMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEY----DSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            +++A+++Y  LP  +K+RVRALK LQ E++KI+  F+KEL  LEAK+   +Q V+ KR ++V+G  EP D EC++    D    D L+E +   A +T      +   +  GIP+FWL  L+N  L    +QE+DR ILKHL DIKC+L+TGD  GF LEF+FS N+YF+++ LTK Y+ +   P D PF YEGPEI+RT GC I+W PGKNVTVKLVKKVQK K+   KRTVTK V+ DSFFNFF PP ++L   +E+  + E LLE+DF++GQ++RE +IP+AVLY+TG
Sbjct:   29 KLQALQEYHLLPASVKRRVRALKKLQHETLKIDSEFYKELFELEAKYDVKHQLVFKKRRDVVSGSIEPNDEECDWPTDDDDSCLDNLSERLKSTANVTKEANNEDPQSEIKGIPDFWLKTLQNISLFDEIVQEHDRDILKHLVDIKCVLHTGDSPGFTLEFYFSPNKYFTNDVLTKTYYFNYEIPKDDPFSYEGPEIVRTVGCVIYWNPGKNVTVKLVKKVQKRKSGGAKRTVTKSVREDSFFNFFSPPAQAL--SDELDEDTEMLLESDFKLGQFLRESVIPKAVLYFTG 317          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Cavefish
Match: nap1l4b (nucleosome assembly protein 1-like 4 [Source:NCBI gene;Acc:103028024])

HSP 1 Score: 257.299 bits (656), Expect = 2.399e-82
Identity = 149/318 (46.86%), Postives = 202/318 (63.52%), Query Frame = 2
Query:  116 DKNDSS--VSEDLMNNPEILASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADE-LAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            DKN++   V + +M NP+ LA+LQ+ +     +    + LP  +++RV ALKNLQ++S  IE  F++E+  LE K+A +YQ +++KR +IVTG  EPTD ECE+ S+  DE LA+++  KA I    EE    ++  GIPEFWLT+  + +++   +QE+D PILKHL DIK L +  G+   F LEFHF  N YF +  LTK Y +     ++ PF +EGPEII   GC I W  GK+VTVK +KK QK K R   RTVTK V  DSFFNFF P   S D   E+  + E  L  DFE+G + RERI+PRAVLY+TG
Sbjct:    4 DKNEAKGKVGDQVMQNPQALAALQERLDSVTHSPSVMDSLPASVRRRVNALKNLQVKSAHIEAKFYEEVHELERKYAALYQPLFDKRKDIVTGTVEPTDEECEWQSDHEDEELADELQKKASIEEPKEEAAAEENPKGIPEFWLTIFRSVDMLSDMLQEHDEPILKHLQDIKVLFSGPGEPMSFKLEFHFEPNNYFKNTVLTKVYKMKSEPDSEDPFSFEGPEIIDCEGCEIDWHKGKDVTVKTIKKKQKHKGRGVVRTVTKQVPTDSFFNFFTPIKVSPDS--ELDEDSEFTLATDFEIGHFFRERIVPRAVLYFTG 319          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Cavefish
Match: nap1l4b (nucleosome assembly protein 1-like 4 [Source:NCBI gene;Acc:103028024])

HSP 1 Score: 257.684 bits (657), Expect = 2.418e-82
Identity = 149/318 (46.86%), Postives = 202/318 (63.52%), Query Frame = 2
Query:  116 DKNDSS--VSEDLMNNPEILASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADE-LAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            DKN++   V + +M NP+ LA+LQ+ +     +    + LP  +++RV ALKNLQ++S  IE  F++E+  LE K+A +YQ +++KR +IVTG  EPTD ECE+ S+  DE LA+++  KA I    EE    ++  GIPEFWLT+  + +++   +QE+D PILKHL DIK L +  G+   F LEFHF  N YF +  LTK Y +     ++ PF +EGPEII   GC I W  GK+VTVK +KK QK K R   RTVTK V  DSFFNFF P   S D   E+  + E  L  DFE+G + RERI+PRAVLY+TG
Sbjct:    4 DKNEAKGKVGDQVMQNPQALAALQERLDSVTHSPSVMDSLPASVRRRVNALKNLQVKSAHIEAKFYEEVHELERKYAALYQPLFDKRKDIVTGTVEPTDEECEWQSDHEDEELADELQKKASIEEPKEEAAAEENPKGIPEFWLTIFRSVDMLSDMLQEHDEPILKHLQDIKVLFSGPGEPMSFKLEFHFEPNNYFKNTVLTKVYKMKSEPDSEDPFSFEGPEIIDCEGCEIDWHKGKDVTVKTIKKKQKHKGRGVVRTVTKQVPTDSFFNFFTPIKVSPDS--ELDEDSEFTLATDFEIGHFFRERIVPRAVLYFTG 319          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Cavefish
Match: nap1l4a (nucleosome assembly protein 1-like 4 [Source:NCBI gene;Acc:103025072])

HSP 1 Score: 240.736 bits (613), Expect = 6.992e-76
Identity = 137/293 (46.76%), Postives = 187/293 (63.82%), Query Frame = 2
Query:  185 EIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADE-LAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            EI  + + +  +  LP  +K+RV ALK LQ++S  IE  F++E+  LE K+A +YQ +++KR E+V+G  EPTD ECE+ SE  +E LAED+  KA +    E+   ++D  GIPEFWLT+ ++ +++   +QE+D PILKHL DI    +  G    F LEFHF  N +FS+  LTK Y +     +  PF +EGPEI+   GC I W  GK+VTVK +KK QK K R   RT+TK V  DSFFNFF P   S DG +E   +++  L  DFE+G + RERIIPRAVLY+TG
Sbjct:   26 EIMPQAERIPNFSALPQAVKRRVYALKRLQVQSAHIEAKFYEEVHELERKYAGLYQPIFDKRREVVSGAVEPTDEECEWHSEGEEEDLAEDLKKKAALEEKKEDAAPAEDPKGIPEFWLTIFKHVDMLGEMLQEHDEPILKHLQDITVTFSEPGQPMSFTLEFHFEPNSFFSNTVLTKMYKMKSEPDSADPFSFEGPEIVDCEGCKIDWQKGKDVTVKTIKKKQKHKGRGTVRTITKEVPQDSFFNFFNPAKASPDGMDE---DLDFTLATDFEIGHFFRERIIPRAVLYFTG 315          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Cavefish
Match: nap1l4a (nucleosome assembly protein 1-like 4 [Source:NCBI gene;Acc:103025072])

HSP 1 Score: 240.736 bits (613), Expect = 8.985e-76
Identity = 137/293 (46.76%), Postives = 187/293 (63.82%), Query Frame = 2
Query:  185 EIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADE-LAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            EI  + + +  +  LP  +K+RV ALK LQ++S  IE  F++E+  LE K+A +YQ +++KR E+V+G  EPTD ECE+ SE  +E LAED+  KA +    E+   ++D  GIPEFWLT+ ++ +++   +QE+D PILKHL DI    +  G    F LEFHF  N +FS+  LTK Y +     +  PF +EGPEI+   GC I W  GK+VTVK +KK QK K R   RT+TK V  DSFFNFF P   S DG +E   +++  L  DFE+G + RERIIPRAVLY+TG
Sbjct:   26 EIMPQAERIPNFSALPQAVKRRVYALKRLQVQSAHIEAKFYEEVHELERKYAGLYQPIFDKRREVVSGAVEPTDEECEWHSEGEEEDLAEDLKKKAALEEKKEDAAPAEDPKGIPEFWLTIFKHVDMLGEMLQEHDEPILKHLQDITVTFSEPGQPMSFTLEFHFEPNSFFSNTVLTKMYKMKSEPDSADPFSFEGPEIVDCEGCKIDWQKGKDVTVKTIKKKQKHKGRGTVRTITKEVPQDSFFNFFNPAKASPDGMDE---DLDFTLATDFEIGHFFRERIIPRAVLYFTG 315          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Cavefish
Match: nap1l1 (nucleosome assembly protein 1 like 1 [Source:NCBI gene;Acc:103031993])

HSP 1 Score: 237.269 bits (604), Expect = 3.874e-74
Identity = 146/305 (47.87%), Postives = 197/305 (64.59%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++   IE  F++E+  LE K+A +YQ +++KR++I+    EPTD ECE+  E  +EL E++ +KA +    ++ E  D   GIPEFWLTV +N +L+   +QE+D PILKHL DIK    + G    F LEFHF  N++F++  LTK Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP     G  E+  + E +L ADFE+G +IRERI+PRAVLY+T
Sbjct:   43 MMQNPQILAALQERLDGLVGSPSGYMESLPKVVKRRVNALKNLQVKCAHIEAKFYEEVHELERKYAALYQPLFDKRSDIIKAVYEPTDEECEWKQEEEEELTEEMKEKAKLEEEKKDEEKEDP-KGIPEFWLTVFKNVDLLSEMLQEHDEPILKHLQDIKVKFSDAGQPMSFTLEFHFEPNDFFTNTVLTKTYKMRSEPDESDPFSFDGPEIMGCTGCTIDWTKGKNVTLKTIKKKQKHKGRGTVRTVTKTVPNDSFFNFFTPPEVPESG--ELDEDSEAVLAADFEIGHFIRERIVPRAVLYFT 344          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Sea Lamprey
Match: nap1l1 (nucleosome assembly protein 1-like 1 [Source:ZFIN;Acc:ZDB-GENE-030516-2])

HSP 1 Score: 244.202 bits (622), Expect = 3.898e-78
Identity = 148/316 (46.84%), Postives = 200/316 (63.29%), Query Frame = 2
Query:  134 VSEDLMNNPEILASLQDEIGLRMKAMKKY-EQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEY------DSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            +S  +M +P+ LA++Q+    R  +   Y E LP V+K+RV AL+NLQ++   IE  F++E+  LE K+A +YQ  +N+R EIV+G+ EPTD ECE+      D+E ADE+ E V  K      D E  N +   GIPEFWLTV  N +L+   +QE+D PIL+HL DIK   +  G    F L+F FS NEYF++  LTK Y +        PF +EGPEI+   G  I W  GK+VTVK++KK QK K R   RT+TK V NDSFFNFF PP +  +G EE+  + E +L ADFE+G + RER++PRAVLY+TG
Sbjct:    1 LSAKMMQDPQALAAMQERGDTRTTSPSVYMESLPKVVKRRVNALRNLQVKCAHIEAKFYEEVHELERKYAALYQPHFNRRREIVSGEIEPTDQECEWVEEKDEDAELADEVMEKV--KLSEEQNDAESANPN---GIPEFWLTVFRNVDLLSDMVQEHDEPILRHLHDIKVKFSEQGIPMSFTLDFCFSPNEYFTNAVLTKTYVMKSEPDASDPFSFEGPEIVSCTGSQIDWKKGKDVTVKVIKKKQKHKGRGTVRTLTKTVPNDSFFNFFNPP-QVAEG-EELDEDSEVILTADFEIGHFFRERVVPRAVLYFTG 309          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Sea Lamprey
Match: nap1l4b (nucleosome assembly protein 1-like 4b [Source:ZFIN;Acc:ZDB-GENE-041114-168])

HSP 1 Score: 210.69 bits (535), Expect = 1.533e-64
Identity = 134/316 (42.41%), Postives = 193/316 (61.08%), Query Frame = 2
Query:  134 VSEDLMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFE---YEGP-EIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPP--TESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            ++  +M NP++LA+LQ+ + GL        E LP V+K+RV ALKNLQ++   IE  F++E+  LE K+A +YQ ++++R +IVT   EP D ECE+ ++  ++L ++V +KA +    E++E  +D  GIPEFWLTV +N +++   +QEYD PIL++L D++   +  G    + L+  +S N       LT  Y +  + PT  P     Y GP + +    C I W  GKN+TVK +KK QK K R   RTVTK V N+SFFNFF PP   E  DG E+   E E  L  DFE+G + RERI+PRAVLY+TG
Sbjct:   39 LTAQMMKNPQVLAALQERLDGLSGTPSGYIESLPKVVKRRVTALKNLQVKCALIEAKFYEEVHDLERKYAALYQPLFDRRRDIVTALVEPDDAECEWPNDKEEDLVDEVKEKAKLEE--EKKEKEEDPKGIPEFWLTVFKNVDMLGDLVQEYDEPILRYLKDVRVQFSEAGQPMNYTLKVVYSCNLLCLQPMLTSVYELSSHNPTPPPTTCVVYGGPHQSMGLVECKIDWKKGKNITVKTIKKKQKHKGRGTIRTVTKTVANESFFNFFSPPEVPEDSDGPED--EEAETQLATDFEIGHFFRERIVPRAVLYFTG 350          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Yeast
Match: NAP1 (Histone chaperone; involved in histone exchange by removing and replacing histone H2A-H2B dimers or histone variant dimers from assembled nucleosomes; involved in the transport of H2A and H2B histones to the nucleus; required for the regulation of microtubule dynamics during mitosis; interacts with mitotic cyclin Clb2p; controls bud morphogenesis; phosphorylated by CK2; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001756])

HSP 1 Score: 145.976 bits (367), Expect = 5.043e-40
Identity = 102/312 (32.69%), Postives = 169/312 (54.17%), Query Frame = 2
Query:  146 LMNNPEILASLQDEIGLRMKAMKKY-EQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDD---FTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHF--SHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLP-GKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPP-TESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            L N P +L S+QD +G  +     Y   LP  +K+++ +LK LQ E  ++E+ F  E+  LE KF + Y+ ++ +R+ I++G+ +P   +         E+ E +N+  ++   +E+ +N  +     GIP FWLT LEN  ++   I + D  +L++L DI     T    GF L F F  S N +F+++ L K YF          F Y+  E     GC I W     NVTV L  + Q+ K   + RT+ K+   +SFFNFF+PP  ++ D +EE+  ++E  L  D+ +G+ +++++IPRAV ++TG
Sbjct:   60 LANQPLLLQSIQDRLGSLVGQDSGYVGGLPKNVKEKLLSLKTLQSELFEVEKEFQVEMFELENKFLQKYKPIWEQRSRIISGQEQPKPEQIA----KGQEIVESLNETELLVDEEEKAQNDSEEEQVKGIPSFWLTALENLPIVCDTITDRDAEVLEYLQDIGLEYLTDGRPGFKLLFRFDSSANPFFTNDILCKTYFYQKELGYSGDFIYDHAE-----GCEISWKDNAHNVTVDLEMRKQRNKTTKQVRTIEKITPIESFFNFFDPPKIQNEDQDEELEEDLEERLALDYSIGEQLKDKLIPRAVDWFTG 362          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Nematostella
Match: EDO43162 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZK7])

HSP 1 Score: 267.7 bits (683), Expect = 3.975e-86
Identity = 147/347 (42.36%), Postives = 212/347 (61.10%), Query Frame = 2
Query:  119 KNDSSV-SEDLMNNPEILASLQDEIGLRMKAMKKYEQ-LPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSET----------------ADELAEDVNDKAIITSGDEER----ENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEH------------GFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            +N +++ +  LM NPE+LA++Q  +G  +     Y Q LP  +++R++ALKN+Q+E  K+E  F++E+  LE K+AE ++  Y KR  I +G  EPTD EC + S+                   +L+ +V +K  I   DEE+    +  +D  GIPEFWLT ++N EL+   IQE+D PILKHL D++ +  TG E             GFVLEFHF+ N +F++  LTK Y +      D PF +EGPEI+ T+GC I W  GKN+T K++KK Q+ K R + R V K VKNDSFFNFF PP E  + + ++  E E LL ADFE+G ++RER++P+AVLY+TG
Sbjct:   21 QNQAAITAAGLMQNPELLAAIQGGLGRLIGQPSGYIQSLPKSVQRRIKALKNIQVECCKLEGKFYEEVHALECKYAEKFKPFYEKRRNIASGGVEPTDEECRWPSDAEDEDEAEEKEEKEATEVSKLSGEVEEKVKID--DEEKIETEQLPEDTKGIPEFWLTAMKNVELLSEMIQEHDEPILKHLHDVRVIF-TGPESTNTTQYPQPTPMGFVLEFHFTPNPFFTNTVLTKSYKMKCEPDEDDPFSFEGPEIVSTSGCKIDWKKGKNITQKVIKKKQRHKGRGQTRFVNKTVKNDSFFNFFSPP-EVTEDDADMDEETETLLAADFEIGHFVRERLVPKAVLYFTG 363          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Nematostella
Match: EDO27320 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9K4])

HSP 1 Score: 90.8929 bits (224), Expect = 2.110e-20
Identity = 46/101 (45.54%), Postives = 60/101 (59.41%), Query Frame = 2
Query:  572 NIQEYDRPILKHLTDIKCLLNTGDEH------------GFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLV 838
            N +E+D PILKHL D++ +  TG E             GFVLEFHF+ N +F++  LTK Y +      D PF +EGPEI+ T+GC I W  GKN+T K V
Sbjct:    7 NNKEHDEPILKHLHDVRVIF-TGPESTNTTQYPQPTPMGFVLEFHFTPNPFFTNTVLTKSYKMKCEPDEDDPFSFEGPEIVSTSGCKIDWKKGKNITQKAV 106          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Nematostella
Match: EDO44259 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW70])

HSP 1 Score: 50.0618 bits (118), Expect = 5.409e-7
Identity = 41/177 (23.16%), Postives = 80/177 (45.20%), Query Frame = 2
Query:  521 IPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYY 1051
            IP FW+TV  N   I+  + E D  +L+++  ++       + G+ ++F F  N YF+++++ KE+ ++ N          G ++ R+    I W  G ++T +  K+  K + R    +        SFF +F                  +L++   E+G+ I++ I P  + YY
Sbjct:   77 IPNFWITVFLNHPQIQMLLNEDDEEVLQYMAYVEVEEFEDIKSGYKIKFGFEDNPYFTNQEICKEFILNDN----------GEQMSRST--TIKWKQGMDLTQRF-KENSKGRKRDHPPS--------SFFCWF-----------------TDLMDNSDELGELIKDDIWPNPLQYY 215          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Medaka
Match: nap1l1 (nucleosome assembly protein 1 like 1 [Source:NCBI gene;Acc:101170971])

HSP 1 Score: 247.284 bits (630), Expect = 1.024e-78
Identity = 144/306 (47.06%), Postives = 198/306 (64.71%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++   IE  F++E+  LE K+A +YQ +++KR++IV    EPTD ECE+ ++  +EL E++ +KA +    ++ E  D   GIPEFWLTV +N +L+   +QE+D PIL HL DIK    + G    F LEF+F  NE+F++  L K Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  E+  + E +L ADFE+G +IRERI+PRA+LY+TG
Sbjct:    1 MMQNPQILAALQERLDGLNGSPSGYMESLPKVVKRRVNALKNLQVKCAHIEAKFYEEVHELERKYAALYQPLFDKRSDIVRAAYEPTDEECEWKADEEEELTEEMKEKAKLEEEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMLQEHDEPILTHLQDIKVKFSDPGQPMSFTLEFYFEPNEFFTNTVLIKTYKMRSEPDESDPFSFDGPEIMSCTGCTIDWTKGKNVTLKTIKKKQKHKGRGTVRTVTKTVPNDSFFNFFSPPEVPENG--ELDEDSEAILAADFEIGHFIRERIVPRAILYFTG 303          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Medaka
Match: nap1l1 (nucleosome assembly protein 1 like 1 [Source:NCBI gene;Acc:101170971])

HSP 1 Score: 248.054 bits (632), Expect = 2.198e-78
Identity = 140/308 (45.45%), Postives = 195/308 (63.31%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELA---EDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++   IE  F++E+  LE K+A +YQ +++KR++IV    EPTD ECE+ ++  +EL    ++   +      +++ E  +D  GIPEFWLTV +N +L+   +QE+D PIL HL DIK    + G    F LEF+F  NE+F++  L K Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  E+  + E +L ADFE+G +IRERI+PRA+LY+T
Sbjct:   43 MMQNPQILAALQERLDGLNGSPSGYMESLPKVVKRRVNALKNLQVKCAHIEAKFYEEVHELERKYAALYQPLFDKRSDIVRAAYEPTDEECEWKADEEEELTVSKQEEMKEKAKLEEEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMLQEHDEPILTHLQDIKVKFSDPGQPMSFTLEFYFEPNEFFTNTVLIKTYKMRSEPDESDPFSFDGPEIMSCTGCTIDWTKGKNVTLKTIKKKQKHKGRGTVRTVTKTVPNDSFFNFFSPPEVPENG--ELDEDSEAILAADFEIGHFIRERIVPRAILYFT 348          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Medaka
Match: nap1l1 (nucleosome assembly protein 1 like 1 [Source:NCBI gene;Acc:101170971])

HSP 1 Score: 245.358 bits (625), Expect = 3.109e-77
Identity = 143/305 (46.89%), Postives = 197/305 (64.59%), Query Frame = 2
Query:  146 LMNNPEILASLQDEI-GLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKC-LLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            +M NP+ILA+LQ+ + GL        E LP V+K+RV ALKNLQ++   IE  F++E+  LE K+A +YQ +++KR++IV    EPTD ECE+ ++  +EL E++ +KA +    ++ E  D   GIPEFWLTV +N +L+   +QE+D PIL HL DIK    + G    F LEF+F  NE+F++  L K Y +        PF ++GPEI+   GC I W  GKNVT+K +KK QK K R   RTVTK V NDSFFNFF PP    +G  E+  + E +L ADFE+G +IRERI+PRA+LY+T
Sbjct:   43 MMQNPQILAALQERLDGLNGSPSGYMESLPKVVKRRVNALKNLQVKCAHIEAKFYEEVHELERKYAALYQPLFDKRSDIVRAAYEPTDEECEWKADEEEELTEEMKEKAKLEEEKKDEEKEDP-KGIPEFWLTVFKNVDLLSDMLQEHDEPILTHLQDIKVKFSDPGQPMSFTLEFYFEPNEFFTNTVLIKTYKMRSEPDESDPFSFDGPEIMSCTGCTIDWTKGKNVTLKTIKKKQKHKGRGTVRTVTKTVPNDSFFNFFSPPEVPENG--ELDEDSEAILAADFEIGHFIRERIVPRAILYFT 344          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Medaka
Match: nap1l4b (nucleosome assembly protein 1-like 4 [Source:NCBI gene;Acc:101172303])

HSP 1 Score: 219.55 bits (558), Expect = 1.034e-67
Identity = 124/281 (44.13%), Postives = 173/281 (61.57%), Query Frame = 2
Query:  227 LPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENS---DDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            LP  +++R+ AL+ LQ++   IE  F++E+  LE K+A +YQ +++KR ++V+G  EPTD ECE+ S+  +E       K   +  D ++E +   +   GIPEFWL + ++ +++   +QE+D PILKHL DI+   +  G    F LEFHF  N YF++  LTK Y +        PF +EGPEII   GC I W  GK+VTVK +KK QK K R   RTVTK V NDSFFNFF P     +G  E+  + E  L  DFE+G + RERI+PRAVLY+TG
Sbjct:   27 LPKAVRRRINALRKLQVQCAHIEAKFYEEVHELERKYAALYQPLFDKRRDVVSGAVEPTDEECEWPSDKDEEEELAEEVKEKASIEDAKKEEATPEEGPKGIPEFWLAIFKSVDMLSDMLQEHDEPILKHLKDIQVKFSEPGQPMSFTLEFHFEPNGYFNNAVLTKVYKMKSEPDASDPFSFEGPEIIDCEGCQIDWHKGKDVTVKTIKKKQKHKGRGTIRTVTKQVSNDSFFNFFNPIKAPPNG--ELDEDSELTLATDFEIGHFFRERIVPRAVLYFTG 305          
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Medaka
Match: nap1l4b (nucleosome assembly protein 1-like 4 [Source:NCBI gene;Acc:101172303])

HSP 1 Score: 219.164 bits (557), Expect = 1.088e-67
Identity = 125/285 (43.86%), Postives = 174/285 (61.05%), Query Frame = 2
Query:  227 LPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENS---DDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLN-TGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFF----EPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            LP  +++R+ AL+ LQ++   IE  F++E+  LE K+A +YQ +++KR ++V+G  EPTD ECE+ S+  +E       K   +  D ++E +   +   GIPEFWL + ++ +++   +QE+D PILKHL DI+   +  G    F LEFHF  N YF++  LTK Y +        PF +EGPEII   GC I W  GK+VTVK +KK QK K R   RTVTK V NDSFFNFF     PP   LD + E++      L  DFE+G + RERI+PRAVLY+TG
Sbjct:   27 LPKAVRRRINALRKLQVQCAHIEAKFYEEVHELERKYAALYQPLFDKRRDVVSGAVEPTDEECEWPSDKDEEEELAEEVKEKASIEDAKKEEATPEEGPKGIPEFWLAIFKSVDMLSDMLQEHDEPILKHLKDIQVKFSEPGQPMSFTLEFHFEPNGYFNNAVLTKVYKMKSEPDASDPFSFEGPEIIDCEGCQIDWHKGKDVTVKTIKKKQKHKGRGTIRTVTKQVSNDSFFNFFNPIKAPPNGELDEDSELT------LATDFEIGHFFRERIVPRAVLYFTG 305          
BLAST of Nucleosome assembly protein 1-like 1 vs. Planmine SMEST
Match: SMESG000073379.1 (SMESG000073379.1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 371/373 (99.46%), Postives = 373/373 (100.00%), Query Frame = 2
Query:   77 MNKGSRHSHIARKDKNDSSVSEDLMNNPEILASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTGXXXXXXXXXXXXXXXXXXXXXXXXXXQRPNNNAQVSNGEKPECKQQ 1195
            MNKGSRHSHIARKDKNDSSVSED+MNNPEILASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQH+YNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTGEGIEEDFDEDGDDDEDDEEDSEDSDFQRPNNNAQVSNGEKPECKQQ
Sbjct:    1 MNKGSRHSHIARKDKNDSSVSEDVMNNPEILASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHIYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTGEGIEEDFDEDGDDDEDDEEDSEDSDFQRPNNNAQVSNGEKPECKQQ 373          
BLAST of Nucleosome assembly protein 1-like 1 vs. Planmine SMEST
Match: SMESG000073379.1 (SMESG000073379.1)

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 325/327 (99.39%), Postives = 327/327 (100.00%), Query Frame = 2
Query:   77 MNKGSRHSHIARKDKNDSSVSEDLMNNPEILASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 1057
            MNKGSRHSHIARKDKNDSSVSED+MNNPEILASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQH+YNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG
Sbjct:    1 MNKGSRHSHIARKDKNDSSVSEDVMNNPEILASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHIYNKRNEIVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYTG 327          
BLAST of Nucleosome assembly protein 1-like 1 vs. Planmine SMEST
Match: SMESG000022916.1 (SMESG000022916.1)

HSP 1 Score: 241.506 bits (615), Expect = 3.676e-76
Identity = 125/312 (40.06%), Postives = 190/312 (60.90%), Query Frame = 2
Query:  155 NPEIL--ASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADEL---AEDVNDKAII------TSGDEERENSD-DFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            NP  L  + ++  IG R  A+  +E+ P  IK RV ALKNLQ E+ K+E  F+KEL+ LE K+ + Y  +  KR +I  G  EPT  EC    +  +++   + ++N+K  I       S D    + D D  GIP+FW  + +N  L+   ++EYD PILK L D+  ++      GF + F+F+ NEYF++  L++ ++V+   P++ P  +EGPEI+ + GC I W P KNVTVK +K+++K + + EKR++TK  + +SFFNFFE      +G+     E  N +++DFE+GQY+RERIIPRA+LYYT
Sbjct:   16 NPSNLDYSDIESAIGARESALFNFEKQPQTIKNRVNALKNLQFETFKLESEFYKELNSLEVKYEDSYFQINKKRRDIYLGHVEPTTEECSLKFKITNDMEMVSSEINNKLTIKELKENVSIDMNVADGDRDIKGIPDFWYIIFKNVPLLSERVEEYDWPILKSLIDVSSVMINDINPGFRINFYFAANEYFTNTVLSRTFYVNFELPSENPLLFEGPEIVMSKGCKIEWKPNKNVTVKNIKQMKKSRVKGEKRSITKTCRTNSFFNFFEDVVSKNEGKLSEDPETLNQIDSDFEIGQYLRERIIPRAILYYT 327          
BLAST of Nucleosome assembly protein 1-like 1 vs. Planmine SMEST
Match: SMESG000022916.1 (SMESG000022916.1)

HSP 1 Score: 240.35 bits (612), Expect = 8.395e-76
Identity = 125/312 (40.06%), Postives = 191/312 (61.22%), Query Frame = 2
Query:  155 NPEIL--ASLQDEIGLRMKAMKKYEQLPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNEIVTGKREPTDGECEYDSETADEL---AEDVNDKAIITSGDEEREN-------SDDFTGIPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIENLLEADFEMGQYIRERIIPRAVLYYT 1054
            NP  L  + ++  IG R  A+  +E+ P  IK RV ALKNLQ E+ K+E  F+KEL+ LE K+ + Y  +  KR +I  G  EPT  EC    +  +++   + ++N+K  I    E +EN       +D   GIP+FW  + +N  L+   ++EYD PILK L D+  ++      GF + F+F+ NEYF++  L++ ++V+   P++ P  +EGPEI+ + GC I W P KNVTVK +K+++K + + EKR++TK  + +SFFNFFE      +G+     E  N +++DFE+GQY+RERIIPRA+LYYT
Sbjct:   16 NPSNLDYSDIESAIGARESALFNFEKQPQTIKNRVNALKNLQFETFKLESEFYKELNSLEVKYEDSYFQINKKRRDIYLGHVEPTTEECSLKFKITNDMEMVSSEINNKLTIK---ELKENVSIDMNVADGDRGIPDFWYIIFKNVPLLSERVEEYDWPILKSLIDVSSVMINDINPGFRINFYFAANEYFTNTVLSRTFYVNFELPSENPLLFEGPEIVMSKGCKIEWKPNKNVTVKNIKQMKKSRVKGEKRSITKTCRTNSFFNFFEDVVSKNEGKLSEDPETLNQIDSDFEIGQYLRERIIPRAILYYT 324          
BLAST of Nucleosome assembly protein 1-like 1 vs. Planmine SMEST
Match: SMESG000027817.1 (SMESG000027817.1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.559e-9
Identity = 40/138 (28.99%), Postives = 61/138 (44.20%), Query Frame = 2
Query:  521 IPEFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFSHNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVTVKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPT 934
            IP FW     N       I + D  IL++L ++    +   + G+ + F F+ N YF +  LTK++ V+ N                +    I W PGK+VT        K  N+ +KR+   +   DSFFNFF+  T
Sbjct:   70 IPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEA-------------SESTKIEWYPGKDVTA-------KSHNKEKKRSAEAM--QDSFFNFFDDNT 185          
The following BLAST results are available for this feature:
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NAP1L12.081e-8448.69nucleosome assembly protein 1 like 1 [Source:HGNC ... [more]
NAP1L18.428e-8448.52nucleosome assembly protein 1 like 1 [Source:HGNC ... [more]
NAP1L11.362e-8348.52nucleosome assembly protein 1 like 1 [Source:HGNC ... [more]
NAP1L12.494e-8348.52nucleosome assembly protein 1 like 1 [Source:HGNC ... [more]
NAP1L12.883e-8348.52nucleosome assembly protein 1 like 1 [Source:HGNC ... [more]
back to top
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nap-11.054e-5440.68Nucleosome Assembly Protein [Source:UniProtKB/TrE... [more]
back to top
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nap12.574e-6638.33gene:FBgn0015268 transcript:FBtr0305990[more]
Nap12.574e-6638.33gene:FBgn0015268 transcript:FBtr0305989[more]
Nap12.574e-6638.33gene:FBgn0015268 transcript:FBtr0072219[more]
CG37081.051e-4834.93gene:FBgn0040345 transcript:FBtr0331301[more]
mil1.375e-2929.78gene:FBgn0267366 transcript:FBtr0085246[more]
back to top
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nap1l4b2.970e-8547.59nucleosome assembly protein 1-like 4b [Source:ZFIN... [more]
nap1l12.609e-8046.15nucleosome assembly protein 1-like 1 [Source:ZFIN;... [more]
nap1l4a4.360e-7246.42nucleosome assembly protein 1-like 4a [Source:ZFIN... [more]
nap1l4a6.416e-7246.42nucleosome assembly protein 1-like 4a [Source:ZFIN... [more]
nap1l4a1.309e-7146.42nucleosome assembly protein 1-like 4a [Source:ZFIN... [more]
back to top
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nap1l19.888e-7844.34nucleosome assembly protein 1 like 1 [Source:NCBI ... [more]
nap1l11.093e-7745.63nucleosome assembly protein 1 like 1 [Source:NCBI ... [more]
nap1l11.156e-7745.63nucleosome assembly protein 1 like 1 [Source:NCBI ... [more]
nap1l11.212e-7745.63nucleosome assembly protein 1 like 1 [Source:NCBI ... [more]
nap1l12.472e-7746.38nucleosome assembly protein 1 like 1 [Source:NCBI ... [more]
back to top
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nap1l14.197e-8448.37nucleosome assembly protein 1-like 1 [Source:MGI S... [more]
Nap1l12.441e-8348.20nucleosome assembly protein 1-like 1 [Source:MGI S... [more]
Nap1l14.343e-8348.20nucleosome assembly protein 1-like 1 [Source:MGI S... [more]
Nap1l14.343e-8348.20nucleosome assembly protein 1-like 1 [Source:MGI S... [more]
Nap1l14.343e-8348.20nucleosome assembly protein 1-like 1 [Source:MGI S... [more]
back to top
BLAST of Nucleosome assembly protein 1-like 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2TA40|NP1L4_BOVIN2.820e-8345.48Nucleosome assembly protein 1-like 4 OS=Bos taurus... [more]
sp|P55209|NP1L1_HUMAN1.384e-8248.52Nucleosome assembly protein 1-like 1 OS=Homo sapie... [more]
sp|Q5R4D4|NP1L1_PONAB1.832e-8248.52Nucleosome assembly protein 1-like 1 OS=Pongo abel... [more]
sp|P28656|NP1L1_MOUSE3.038e-8248.20Nucleosome assembly protein 1-like 1 OS=Mus muscul... [more]
sp|A6H767|NP1L1_BOVIN3.728e-8248.20Nucleosome assembly protein 1-like 1 OS=Bos taurus... [more]
back to top
BLAST of Nucleosome assembly protein 1-like 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1LHF87.838e-9951.55NAP-1-related protein OS=Schistosoma japonicum OX=... [more]
A0A4Z2DHG23.717e-9751.20Nucleosome assembly protein 1-like 4 isoform 3 OS=... [more]
A0A4Z2DHH75.992e-9751.20Nucleosome assembly protein 1-like 4 isoform 2 OS=... [more]
G4VFS51.337e-9651.89Putative nucleosome assembly protein OS=Schistosom... [more]
A0A4Z2DHH51.864e-9651.20Nucleosome assembly protein 1-like 4 isoform 1 OS=... [more]
back to top
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nap1l4b2.399e-8246.86nucleosome assembly protein 1-like 4 [Source:NCBI ... [more]
nap1l4b2.418e-8246.86nucleosome assembly protein 1-like 4 [Source:NCBI ... [more]
nap1l4a6.992e-7646.76nucleosome assembly protein 1-like 4 [Source:NCBI ... [more]
nap1l4a8.985e-7646.76nucleosome assembly protein 1-like 4 [Source:NCBI ... [more]
nap1l13.874e-7447.87nucleosome assembly protein 1 like 1 [Source:NCBI ... [more]
back to top
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nap1l13.898e-7846.84nucleosome assembly protein 1-like 1 [Source:ZFIN;... [more]
nap1l4b1.533e-6442.41nucleosome assembly protein 1-like 4b [Source:ZFIN... [more]
back to top
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NAP15.043e-4032.69Histone chaperone; involved in histone exchange by... [more]
back to top
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO431623.975e-8642.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273202.110e-2045.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442595.409e-723.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nucleosome assembly protein 1-like 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nap1l11.024e-7847.06nucleosome assembly protein 1 like 1 [Source:NCBI ... [more]
nap1l12.198e-7845.45nucleosome assembly protein 1 like 1 [Source:NCBI ... [more]
nap1l13.109e-7746.89nucleosome assembly protein 1 like 1 [Source:NCBI ... [more]
nap1l4b1.034e-6744.13nucleosome assembly protein 1-like 4 [Source:NCBI ... [more]
nap1l4b1.088e-6743.86nucleosome assembly protein 1-like 4 [Source:NCBI ... [more]
back to top
BLAST of Nucleosome assembly protein 1-like 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073379.10.000e+099.46SMESG000073379.1[more]
SMESG000073379.10.000e+099.39SMESG000073379.1[more]
SMESG000022916.13.676e-7640.06SMESG000022916.1[more]
SMESG000022916.18.395e-7640.06SMESG000022916.1[more]
SMESG000027817.11.559e-928.99SMESG000027817.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012187 ID=SMED30012187|Name=Nucleosome assembly protein 1-like 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1244bp
ATTAGTTTTAATAGTTTGTTTGCCTAATTAAAGTGAATATTCTATTATAT
TTGGATTAATTAAATTTAACATCAAAATGAATAAAGGATCCAGACATTCA
CACATAGCACGCAAAGATAAAAATGATTCTAGTGTCTCTGAAGATTTAAT
GAACAATCCAGAAATACTTGCATCATTACAAGACGAAATTGGTCTTCGAA
TGAAAGCAATGAAAAAATATGAACAGTTACCGATAGTCATCAAAAAACGT
GTTCGTGCTTTGAAAAACCTTCAACTTGAATCCATCAAAATTGAAGAATC
GTTTTTTAAAGAGTTGAGTGTGTTAGAAGCCAAATTTGCAGAAATATATC
AACATGTTTACAACAAACGAAATGAAATTGTCACCGGTAAACGAGAACCT
ACTGATGGTGAGTGTGAATATGATTCGGAAACTGCTGATGAATTGGCTGA
GGATGTAAATGATAAGGCTATTATTACAAGTGGTGATGAAGAACGAGAGA
ATAGTGACGATTTTACAGGAATACCAGAATTCTGGTTGACTGTTTTAGAG
AATTCTGAACTTATTAGGTTCAATATTCAGGAATATGATAGGCCAATTTT
AAAACATTTGACAGACATAAAATGTCTTTTAAATACTGGAGATGAGCATG
GATTCGTTTTGGAATTTCATTTCTCGCATAATGAATATTTCAGTGATGAA
AAGCTTACTAAGGAATATTTTGTACATGTTAACGCACCAACTGATTGTCC
GTTTGAATATGAAGGACCTGAGATTATTAGGACTGCTGGTTGTAATATCC
ACTGGTTACCTGGAAAGAACGTAACTGTAAAATTGGTTAAAAAAGTTCAA
AAATGTAAAAACCGGTCTGAAAAACGAACTGTGACCAAAGTTGTTAAAAA
TGATTCATTTTTCAATTTTTTCGAACCCCCTACAGAATCACTGGATGGAG
AAGAGGAAATTTCTGTAGAAATTGAAAACCTTTTGGAAGCTGATTTTGAA
ATGGGACAATATATTCGTGAAAGAATAATTCCTCGGGCAGTACTGTATTA
TACAGGAGAAGGAATTGAAGAAGACTTTGATGAGGATGGAGATGATGACG
AAGACGATGAGGAGGATTCGGAAGATAGTGATTTTCAGAGACCAAATAAT
AATGCACAAGTATCCAATGGCGAGAAACCAGAGTGCAAACAGCAATAAAT
ATGTTTTAGTTACAGAGTTTTATTGAAATAAATTTGGTGTTGCT
back to top

protein sequence of SMED30012187-orf-1

>SMED30012187-orf-1 ID=SMED30012187-orf-1|Name=SMED30012187-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=374bp
MNKGSRHSHIARKDKNDSSVSEDLMNNPEILASLQDEIGLRMKAMKKYEQ
LPIVIKKRVRALKNLQLESIKIEESFFKELSVLEAKFAEIYQHVYNKRNE
IVTGKREPTDGECEYDSETADELAEDVNDKAIITSGDEERENSDDFTGIP
EFWLTVLENSELIRFNIQEYDRPILKHLTDIKCLLNTGDEHGFVLEFHFS
HNEYFSDEKLTKEYFVHVNAPTDCPFEYEGPEIIRTAGCNIHWLPGKNVT
VKLVKKVQKCKNRSEKRTVTKVVKNDSFFNFFEPPTESLDGEEEISVEIE
NLLEADFEMGQYIRERIIPRAVLYYTGEGIEEDFDEDGDDDEDDEEDSED
SDFQRPNNNAQVSNGEKPECKQQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0000464GABAergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR037231NAP-like_sf
IPR002164NAP_family
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0042470melanosome
Vocabulary: biological process
TermDefinition
GO:0006334nucleosome assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.1120.90coord: 145..328
e-value: 3.1E-60
score: 205.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 329..373
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 329..351
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..24
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 354..373
NoneNo IPR availablePANTHERPTHR11875:SF75NUCLEOSOME ASSEMBLY PROTEIN 1-LIKE 4coord: 10..361
IPR002164Nucleosome assembly protein (NAP)PFAMPF00956NAPcoord: 57..328
e-value: 1.9E-88
score: 296.2
IPR002164Nucleosome assembly protein (NAP)PANTHERPTHR11875TESTIS-SPECIFIC Y-ENCODED PROTEINcoord: 10..361
IPR037231NAP-like superfamilySUPERFAMILYSSF143113NAP-likecoord: 45..327