Plastin-3

Overview
NamePlastin-3
Smed IDSMED30012175
Length (bp)1652
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Plastin-3 (SMED30012175) t-SNE clustered cells

Violin plots show distribution of expression levels for Plastin-3 (SMED30012175) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012175

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30012175h1SMcG0021476 DN315261smed_ncbi_20240424PMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30012175h1SMcG0021476 PL08008A2G05_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile stagecDNA to DNA expression microarray evidence
testis primordiumSMED30012175h1SMcG0021476 PL06020B1C06_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile stagecDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Plastin-3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 173.711 bits (439), Expect = 2.053e-46
Identity = 136/520 (26.15%), Postives = 247/520 (47.50%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKF-VSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE----RALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    +P+NPN+D+LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    + +G    VL  LWQI  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   NS   KI++F  ++ D   Y +L + +A    +     +  ++   N+  D K R   +L+  D +  + F+    + SG       K++L   A LF+++P +++ E   I    D   LE E+  E+  RN++N LGVNP   +++ D +D L+I Q+ + +   + +       + K     +++ N  N    LGK      +  +  + +  GN+ L   +++ LM  +   V  +    +K +   ++ WVN           I SF+D  I+    +  +ID + P  I++D +++ + +++     A Y +S+ARR G  ++  P  L     + +   FA L  +  + V
Sbjct:  125 EKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAI-NKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLE--NSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLK-RAESMLQQADKLGCRQFVTPADVVSG-----NPKLNLAFVANLFNKYPALTKPENQDI----DWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLEN-CNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV 630          
BLAST of Plastin-3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 173.711 bits (439), Expect = 2.053e-46
Identity = 136/520 (26.15%), Postives = 247/520 (47.50%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKF-VSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE----RALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    +P+NPN+D+LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    + +G    VL  LWQI  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   NS   KI++F  ++ D   Y +L + +A    +     +  ++   N+  D K R   +L+  D +  + F+    + SG       K++L   A LF+++P +++ E   I    D   LE E+  E+  RN++N LGVNP   +++ D +D L+I Q+ + +   + +       + K     +++ N  N    LGK      +  +  + +  GN+ L   +++ LM  +   V  +    +K +   ++ WVN           I SF+D  I+    +  +ID + P  I++D +++ + +++     A Y +S+ARR G  ++  P  L     + +   FA L  +  + V
Sbjct:  125 EKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAI-NKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLE--NSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLK-RAESMLQQADKLGCRQFVTPADVVSG-----NPKLNLAFVANLFNKYPALTKPENQDI----DWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLEN-CNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV 630          
BLAST of Plastin-3 vs. Ensembl Human
Match: PLS1 (plastin 1 [Source:HGNC Symbol;Acc:HGNC:9090])

HSP 1 Score: 168.318 bits (425), Expect = 1.576e-44
Identity = 149/523 (28.49%), Postives = 250/523 (47.80%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHS---HIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLG----KFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE----RALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAVK 1562
            EK  ++NWIN+ L    +    +P+NPN D LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC VV +  + +  G    VL  LWQI  VGL   I    N  ++ L ++ E  + + ++ PEE L R++NY ++  N+    IS+F Q++ D   Y +L + +A        A+  D+  IN+  D K R  L+L+  D +  + F+    + SG       K++L   A LF+ +P + +   + I    D   LE ES  E+  RN++N LGVNP   +++ D  D L+I Q+ +++   + +       +       ++I N  N    LG    KF  V IA    + +  GN  L   +++ LM  +   V  +    +K + + ++KWVN    S +    I+SF+D  I+    +  +ID + PN++  + +   + S E     A Y IS+AR+ G  ++  P  L     + +   FA L  K    +K
Sbjct:  124 EKVAFVNWINKALENDPDCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDERAI-NKKKLTPFTISENLNLALNSASAIGCTVVNIGASDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHLT--NAGWHTISNFSQDIKDSRAYFHLLNQIAPKGGEDGPAIAIDLSGINETNDLK-RAGLMLQEADKLGCKQFVTPADVVSG-----NPKLNLAFVANLFNTYPCLHKPNNNDI----DMNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIRVPVNWSHVNKPPYPALGGNMKKIEN-CNYAVELGKNKAKFSLVGIAG---QDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKKTSISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIRRENLSDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLMGKGLNRIK 629          
BLAST of Plastin-3 vs. Ensembl Human
Match: PLS1 (plastin 1 [Source:HGNC Symbol;Acc:HGNC:9090])

HSP 1 Score: 168.318 bits (425), Expect = 1.576e-44
Identity = 149/523 (28.49%), Postives = 250/523 (47.80%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHS---HIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLG----KFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE----RALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAVK 1562
            EK  ++NWIN+ L    +    +P+NPN D LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC VV +  + +  G    VL  LWQI  VGL   I    N  ++ L ++ E  + + ++ PEE L R++NY ++  N+    IS+F Q++ D   Y +L + +A        A+  D+  IN+  D K R  L+L+  D +  + F+    + SG       K++L   A LF+ +P + +   + I    D   LE ES  E+  RN++N LGVNP   +++ D  D L+I Q+ +++   + +       +       ++I N  N    LG    KF  V IA    + +  GN  L   +++ LM  +   V  +    +K + + ++KWVN    S +    I+SF+D  I+    +  +ID + PN++  + +   + S E     A Y IS+AR+ G  ++  P  L     + +   FA L  K    +K
Sbjct:  124 EKVAFVNWINKALENDPDCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDERAI-NKKKLTPFTISENLNLALNSASAIGCTVVNIGASDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHLT--NAGWHTISNFSQDIKDSRAYFHLLNQIAPKGGEDGPAIAIDLSGINETNDLK-RAGLMLQEADKLGCKQFVTPADVVSG-----NPKLNLAFVANLFNTYPCLHKPNNNDI----DMNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIRVPVNWSHVNKPPYPALGGNMKKIEN-CNYAVELGKNKAKFSLVGIAG---QDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKKTSISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIRRENLSDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLMGKGLNRIK 629          
BLAST of Plastin-3 vs. Ensembl Human
Match: PLS1 (plastin 1 [Source:HGNC Symbol;Acc:HGNC:9090])

HSP 1 Score: 168.318 bits (425), Expect = 1.576e-44
Identity = 149/523 (28.49%), Postives = 250/523 (47.80%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHS---HIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLG----KFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE----RALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAVK 1562
            EK  ++NWIN+ L    +    +P+NPN D LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC VV +  + +  G    VL  LWQI  VGL   I    N  ++ L ++ E  + + ++ PEE L R++NY ++  N+    IS+F Q++ D   Y +L + +A        A+  D+  IN+  D K R  L+L+  D +  + F+    + SG       K++L   A LF+ +P + +   + I    D   LE ES  E+  RN++N LGVNP   +++ D  D L+I Q+ +++   + +       +       ++I N  N    LG    KF  V IA    + +  GN  L   +++ LM  +   V  +    +K + + ++KWVN    S +    I+SF+D  I+    +  +ID + PN++  + +   + S E     A Y IS+AR+ G  ++  P  L     + +   FA L  K    +K
Sbjct:  124 EKVAFVNWINKALENDPDCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDERAI-NKKKLTPFTISENLNLALNSASAIGCTVVNIGASDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHLT--NAGWHTISNFSQDIKDSRAYFHLLNQIAPKGGEDGPAIAIDLSGINETNDLK-RAGLMLQEADKLGCKQFVTPADVVSG-----NPKLNLAFVANLFNTYPCLHKPNNNDI----DMNLLEGESKEERTFRNWMNSLGVNPYINHLYSDLADALVIFQLYEMIRVPVNWSHVNKPPYPALGGNMKKIEN-CNYAVELGKNKAKFSLVGIAG---QDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKKTSISSFKDKSISTSLPVLDLIDAIAPNAVRQEMIRRENLSDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLMGKGLNRIK 629          
BLAST of Plastin-3 vs. Ensembl Celegans
Match: plst-1 (PLaSTin (Actin bundling protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PMA7])

HSP 1 Score: 90.8929 bits (224), Expect = 1.420e-19
Identity = 74/340 (21.76%), Postives = 162/340 (47.65%), Query Frame = 3
Query:  501 RYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQIS-QINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYY-----EKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKER---ALYCISIARREGCPMFFTP 1481
            R++NY + +  +   ++ +F  ++ D  +Y +L   +A +      + +      P    R   +L+  + +  + F+    + +G      YK++L   A LF++ P + +    ++   + D I   +E+  EK  RN++N +GV+P    ++ D ++G++I Q+ DI+   +      ++ F K + + ++I N  N    LGK +   +  +  + I  GN+ L   +++ LM  +         ++ +     K+++ WVN    +      I SF+D  I+D +V+  +ID + PN ID   +++  +++++   A Y I+  R+ G  ++  P
Sbjct:    2 RWVNYHLERAGTQ-RRLHNFTSDIVDSEIYTHLLHQIAPNGSGVTLSPLGVHGNVP----RAGAMLDEAEKLDCREFVTATDVAAGN-----YKLNLAFVANLFNKHPNLPDPGADEVGFSVEDVI---EETREEKTYRNWMNSMGVDPYVNWLYADLQNGVVIFQLYDIIRPGMVTWKRVVRTFHKLRGMMDQIQN-CNYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMRAYTLSVLAQCTQSGDSLPADKDIVAWVNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDAIKPNVIDHSLVKSGKSNEDKMSNAKYAITCGRKIGAKIYALP 327          
BLAST of Plastin-3 vs. Ensembl Celegans
Match: plst-1 (PLaSTin (Actin bundling protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PMA7])

HSP 1 Score: 90.1225 bits (222), Expect = 2.284e-19
Identity = 74/339 (21.83%), Postives = 162/339 (47.79%), Query Frame = 3
Query:  501 RYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYY-----EKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKER---ALYCISIARREGCPMFFTP 1481
            R++NY + +  +   ++ +F  ++ D  +Y +L   +A +      + +      P    R   +L+  + +  + F+    + +G      YK++L   A LF++ P + +    ++  + D I   +E+  EK  RN++N +GV+P    ++ D ++G++I Q+ DI+   +      ++ F K + + ++I N  N    LGK +   +  +  + I  GN+ L   +++ LM  +         ++ +     K+++ WVN    +      I SF+D  I+D +V+  +ID + PN ID   +++  +++++   A Y I+  R+ G  ++  P
Sbjct:    2 RWVNYHLERAGTQ-RRLHNFTSDIVDSEIYTHLLHQIAPNGSGVTLSPLGVHGNVP----RAGAMLDEAEKLDCREFVTATDVAAGN-----YKLNLAFVANLFNKHPNLPDPGADEV--VEDVI---EETREEKTYRNWMNSMGVDPYVNWLYADLQNGVVIFQLYDIIRPGMVTWKRVVRTFHKLRGMMDQIQN-CNYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMRAYTLSVLAQCTQSGDSLPADKDIVAWVNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDAIKPNVIDHSLVKSGKSNEDKMSNAKYAITCGRKIGAKIYALP 324          
BLAST of Plastin-3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074442)

HSP 1 Score: 173.711 bits (439), Expect = 6.970e-47
Identity = 134/489 (27.40%), Postives = 241/489 (49.28%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLM----LYWVYYEKNTEKKFDKKELLKWVNS----FSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE---RALYCISIARREGCPMFFTP 1481
            E+  + +WIN NL   ++L   LPI+     L+  I DGI+ C II    P +ID   I  K  ++   +++NL LA  ++++ GCN+V +D + +  G    VL  LWQI  +GL   I+    P +  L  D+E  + + +M PE  L R++N+ + +   S  + ++FQ ++ D  +Y +L   +A +      + +    +E D + R  ++L+    +  ++FL    + +G      YK++L   A LF+  P + + E     QI     +E E+  EK  RN++N +GV P    ++ D  DGL+I Q+ D++   I       K FS  +   E++ N    ++ LGK +   +  +  + +  GN  L   +I+ LM    L  +    NT     +KE+++WVN+         ++ +F D  I D +++  +ID +   SI+++ + T  T ++    A Y IS+AR+ G  ++  P
Sbjct:  103 EQLAFSDWINSNLGHDKDLQHLLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAI-NKKNLTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGIS-RRCTNFQSDIVDSEIYSHLLKQIAGNDADVNLDAL----RESDLQSRAEIMLQQAAKLNCRSFLTPQDVVNG-----VYKLNLAFVANLFNNHPGLDKPE-----QIEGLESIE-ETREEKTYRNWMNSMGVAPHVNWLYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENCNYAVD-LGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPIIEKEIVQWVNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALP 573          
BLAST of Plastin-3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074443)

HSP 1 Score: 174.096 bits (440), Expect = 7.949e-47
Identity = 134/489 (27.40%), Postives = 241/489 (49.28%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLM----LYWVYYEKNTEKKFDKKELLKWVNS----FSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE---RALYCISIARREGCPMFFTP 1481
            E+  + +WIN NL   ++L   LPI+     L+  I DGI+ C II    P +ID   I  K  ++   +++NL LA  ++++ GCN+V +D + +  G    VL  LWQI  +GL   I+    P +  L  D+E  + + +M PE  L R++N+ + +   S  + ++FQ ++ D  +Y +L   +A +      + +    +E D + R  ++L+    +  ++FL    + +G      YK++L   A LF+  P + + E     QI     +E E+  EK  RN++N +GV P    ++ D  DGL+I Q+ D++   I       K FS  +   E++ N    ++ LGK +   +  +  + +  GN  L   +I+ LM    L  +    NT     +KE+++WVN+         ++ +F D  I D +++  +ID +   SI+++ + T  T ++    A Y IS+AR+ G  ++  P
Sbjct:  128 EQLAFSDWINSNLGHDKDLQHLLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAI-NKKNLTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGIS-RRCTNFQSDIVDSEIYSHLLKQIAGNDADVNLDAL----RESDLQSRAEIMLQQAAKLNCRSFLTPQDVVNG-----VYKLNLAFVANLFNNHPGLDKPE-----QIEGLESIE-ETREEKTYRNWMNSMGVAPHVNWLYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENCNYAVD-LGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPIIEKEIVQWVNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALP 598          
BLAST of Plastin-3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074441)

HSP 1 Score: 173.711 bits (439), Expect = 1.005e-46
Identity = 134/489 (27.40%), Postives = 241/489 (49.28%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLM----LYWVYYEKNTEKKFDKKELLKWVNS----FSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE---RALYCISIARREGCPMFFTP 1481
            E+  + +WIN NL   ++L   LPI+     L+  I DGI+ C II    P +ID   I  K  ++   +++NL LA  ++++ GCN+V +D + +  G    VL  LWQI  +GL   I+    P +  L  D+E  + + +M PE  L R++N+ + +   S  + ++FQ ++ D  +Y +L   +A +      + +    +E D + R  ++L+    +  ++FL    + +G      YK++L   A LF+  P + + E     QI     +E E+  EK  RN++N +GV P    ++ D  DGL+I Q+ D++   I       K FS  +   E++ N    ++ LGK +   +  +  + +  GN  L   +I+ LM    L  +    NT     +KE+++WVN+         ++ +F D  I D +++  +ID +   SI+++ + T  T ++    A Y IS+AR+ G  ++  P
Sbjct:  127 EQLAFSDWINSNLGHDKDLQHLLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAI-NKKNLTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGIS-RRCTNFQSDIVDSEIYSHLLKQIAGNDADVNLDAL----RESDLQSRAEIMLQQAAKLNCRSFLTPQDVVNG-----VYKLNLAFVANLFNNHPGLDKPE-----QIEGLESIE-ETREEKTYRNWMNSMGVAPHVNWLYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENCNYAVD-LGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPIIEKEIVQWVNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALP 597          
BLAST of Plastin-3 vs. Ensembl Zebrafish
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 174.866 bits (442), Expect = 4.597e-47
Identity = 129/505 (25.54%), Postives = 241/505 (47.72%), Query Frame = 3
Query:    9 AEVNAIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVN---SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERAL----YCISIARREGCPMFFTP 1481
            +E +     + + EK  ++NW+N+ L    +    LP++P++D+LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    +  G +  VL  LWQ+  +GL   I    N  ++ L  D E  + + ++ PEE L R+ NY + +  +  PKI++F  ++ D   Y  + + VA    +    A+  DI  I ++ D K R   +LE  D +  + F+    +  G       K++L   A LF+++P + + E   I    D   +E E+  E+  RN++N LGVNP   +++ D  D L+I Q+ + +   + +       + K     +++ N    +    K     +  +  + +  GNR L   +++ LM  +   +  +    +K   + +++WVN   + +    I+ F+D  I+    +  +ID + P SI +D ++    + E  L    Y IS+AR+ G  ++  P
Sbjct:  107 SEQSGTQHSYSEEEKVAFVNWVNKALEKDPDCQHVLPMDPSTDDLFTAVGDGIVLCKMINLSVPDTIDERTI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIEISRNEALIALLRDGESLEDLVKLSPEELLLRWANYHLEE--AGCPKINNFSSDIKDSKAYYNILNQVAPKGDEEGIPAIPIDISGIREKDDLK-RAECMLEQADRLGCRQFVTATDVVRG-----NPKLNLAYVANLFNKYPALKKPENQDI----DWSSIEGETREERTFRNWMNSLGVNPRVNHLYVDLADALVIFQLYEKIKVPVDWDKVNKPPYPKLGSNMKKLENCNYAVELGKKEAKFSLVGIAGQDLNEGNRTLTLALLWQLMRRYTLNILEDLGDGQKIIDETIVQWVNETLTQAGKGTISGFKDGSISSSMPVLDLIDAIQPGSIRYDLLKAEDLTDEEKLNNAKYAISMARKIGARVYALP 598          
BLAST of Plastin-3 vs. Ensembl Zebrafish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 165.622 bits (418), Expect = 8.555e-44
Identity = 132/494 (26.72%), Postives = 235/494 (47.57%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDI---YSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIK-DFSKQQIVSERIHNGANCINRLGKF-VSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSK----ERALYCISIARREGCPMFFTP 1481
            E+  ++NWIN  L    +    LP+NPN+D LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    +  G    VL  LWQI  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   N+   KI++F  ++ D   Y +L + +A       ++ I    S   E D   R   +L   D +  + F+    + SG       K++L   A LF+++P +++ E   I+       LE E+  E+  RN++N LGVNP   +++ D +D L+I Q+ + +   + + +   K  + K     +++ N  N    LGK   +  +  +  + +  GN  L   +++ LM  +   V       +K +   ++ WVN          +I++F+D  I+    +  +ID + P+SI++D ++  S S     + A Y +S+AR+ G  ++  P
Sbjct:  121 ERFAFVNWINTALEHDPDCKHKLPMNPNTDALFKAVGDGIVLCKMINLSVPDTIDERTI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGALDLREGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLE--NAGWSKINNFSHDIKDSRAYFHLLNQIAPKGQKDGESRIDIDMSGFTEKDDLKRAECMLLQADKLGCRQFVTSTDVMSG-----NPKLNLAFVANLFNKYPALTKPENQDINW----GLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYEKIKVPVDWNNKVNKPPYPKLGANMKKLEN-CNYAVELGKTKANFSLVGIGGQDLNDGNPTLTLALVWQLMRRYTLNVLENLGDGQKVNDDVIVSWVNKTLSQAGKSTKISNFKDKEISSSLAVLDLIDAIQPSSINYDLVKRGSLSDGDKLDNAKYAVSMARKIGARVYALP 601          
BLAST of Plastin-3 vs. Ensembl Zebrafish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 165.622 bits (418), Expect = 8.555e-44
Identity = 132/494 (26.72%), Postives = 235/494 (47.57%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDI---YSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIK-DFSKQQIVSERIHNGANCINRLGKF-VSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSK----ERALYCISIARREGCPMFFTP 1481
            E+  ++NWIN  L    +    LP+NPN+D LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    +  G    VL  LWQI  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   N+   KI++F  ++ D   Y +L + +A       ++ I    S   E D   R   +L   D +  + F+    + SG       K++L   A LF+++P +++ E   I+       LE E+  E+  RN++N LGVNP   +++ D +D L+I Q+ + +   + + +   K  + K     +++ N  N    LGK   +  +  +  + +  GN  L   +++ LM  +   V       +K +   ++ WVN          +I++F+D  I+    +  +ID + P+SI++D ++  S S     + A Y +S+AR+ G  ++  P
Sbjct:  121 ERFAFVNWINTALEHDPDCKHKLPMNPNTDALFKAVGDGIVLCKMINLSVPDTIDERTI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGALDLREGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLE--NAGWSKINNFSHDIKDSRAYFHLLNQIAPKGQKDGESRIDIDMSGFTEKDDLKRAECMLLQADKLGCRQFVTSTDVMSG-----NPKLNLAFVANLFNKYPALTKPENQDINW----GLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYEKIKVPVDWNNKVNKPPYPKLGANMKKLEN-CNYAVELGKTKANFSLVGIGGQDLNDGNPTLTLALVWQLMRRYTLNVLENLGDGQKVNDDVIVSWVNKTLSQAGKSTKISNFKDKEISSSLAVLDLIDAIQPSSINYDLVKRGSLSDGDKLDNAKYAVSMARKIGARVYALP 601          
BLAST of Plastin-3 vs. Ensembl Zebrafish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 155.606 bits (392), Expect = 3.103e-40
Identity = 125/522 (23.95%), Postives = 241/522 (46.17%), Query Frame = 3
Query:   36 HDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHI--ALKNDIYSIN-QEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSF----SIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERAL----YCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            + D EK  ++NW+N+ L    +    +P++P +D LF  + DGI+ C +I    P +ID  VI  K   +     +NL LA  +A + GC VV +D   + +G    VL  LWQI  +GL   I    N  ++ L  + E  D +  M PE+ L R++NY +    +   +I +F +++ D   Y +L + ++    +   ++ DI  +   E D + R  L+L     +  + F+    + +G      +K+++   A LF+ +P ++    + I     +  +E E+  ++  RN++N LGV+P   +++ D  DGL+I Q+ + +   + +       +       +++ N    +    K     +  +  E I  G+      +++ LM  +   V  +    +K   + ++ WVNS       +  I+SF+D  I+    +  +ID + P +I ++ +++   + E  L    Y IS+AR+ G  ++  P  L     + +   FA L  +  + V
Sbjct:  119 YSDEEKVAFVNWVNKALANDPDCKHLIPMDPGTDSLFKSVKDGILLCKMINLSQPDTIDERVINKKC--TPFTMTENLMLALNSASAIGCTVVNIDAQDMKAGTPHLVLGLLWQIIKIGLFADIEISRNEALIALLDESEELDHLMSMSPEDLLLRWVNYHLKA--AGWKQIRNFSEDIKDSRAYFHLLNQISPKGDLDDQMRIDIDMLGLTERDDEMRAELMLRQAARLDCRQFVTPKDVVAG-----NHKLNMAFVANLFNMYPALNRPTDNGI-----DYAIEGETREDRTFRNWMNSLGVSPYVNHLYSDLHDGLIILQLYERIQIPVDWPRVNKPPYPVLGSNMKKLENCNYAVALGKKEAKFSLVGIGGENINEGSPMHTLALVWQLMRRYTLKVLSDLGDGEKVSDQIIINWVNSTLKQGDKNSSISSFKDKSISTSLPVIDLIDTIVPKAIKYEMVKSGDMTAEDKLNNAKYAISVARKIGVKVYALPDDLVEVKPKMVMTVFACLMGRGLKKV 626          
BLAST of Plastin-3 vs. Ensembl Zebrafish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 155.606 bits (392), Expect = 4.706e-40
Identity = 125/522 (23.95%), Postives = 241/522 (46.17%), Query Frame = 3
Query:   36 HDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHI--ALKNDIYSIN-QEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSF----SIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERAL----YCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            + D EK  ++NW+N+ L    +    +P++P +D LF  + DGI+ C +I    P +ID  VI  K   +     +NL LA  +A + GC VV +D   + +G    VL  LWQI  +GL   I    N  ++ L  + E  D +  M PE+ L R++NY +    +   +I +F +++ D   Y +L + ++    +   ++ DI  +   E D + R  L+L     +  + F+    + +G      +K+++   A LF+ +P ++    + I     +  +E E+  ++  RN++N LGV+P   +++ D  DGL+I Q+ + +   + +       +       +++ N    +    K     +  +  E I  G+      +++ LM  +   V  +    +K   + ++ WVNS       +  I+SF+D  I+    +  +ID + P +I ++ +++   + E  L    Y IS+AR+ G  ++  P  L     + +   FA L  +  + V
Sbjct:  156 YSDEEKVAFVNWVNKALANDPDCKHLIPMDPGTDSLFKSVKDGILLCKMINLSQPDTIDERVINKKC--TPFTMTENLMLALNSASAIGCTVVNIDAQDMKAGTPHLVLGLLWQIIKIGLFADIEISRNEALIALLDESEELDHLMSMSPEDLLLRWVNYHLKA--AGWKQIRNFSEDIKDSRAYFHLLNQISPKGDLDDQMRIDIDMLGLTERDDEMRAELMLRQAARLDCRQFVTPKDVVAG-----NHKLNMAFVANLFNMYPALNRPTDNGI-----DYAIEGETREDRTFRNWMNSLGVSPYVNHLYSDLHDGLIILQLYERIQIPVDWPRVNKPPYPVLGSNMKKLENCNYAVALGKKEAKFSLVGIGGENINEGSPMHTLALVWQLMRRYTLKVLSDLGDGEKVSDQIIINWVNSTLKQGDKNSSISSFKDKSISTSLPVIDLIDTIVPKAIKYEMVKSGDMTAEDKLNNAKYAISVARKIGVKVYALPDDLVEVKPKMVMTVFACLMGRGLKKV 663          
BLAST of Plastin-3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 171.4 bits (433), Expect = 5.712e-46
Identity = 137/520 (26.35%), Postives = 243/520 (46.73%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDI---YSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKF-VSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDC----EITSFRDTLINDKRVLAKVIDKVFPNSIDWDYME-----TLSTSKERALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    LP+NPN+++LF  + DGI+ C +I    P +ID  VI  K +++     +NL LA  +A + GC+VV +    + +G     L  LWQ+  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   N+   KIS+F  ++ D   Y +L + +A       +  I    S   E D   R   +L+  D +  + F+    + SG       K++L   A LF+++P +++     ++Q  D   LE E+  E+  RN++N LGVNP   ++++D +D L+I Q+ D +   + +       + K     +++ N  N    LGK+     +  +  + +  GN  L   +++ +M  +   V       +K + + ++ WVN    D      I +F+D  I     +  +ID + P  I+++ ++     T     E A Y IS+ARR G  ++  P  L     + +   FA L  +  + V
Sbjct:   62 EKYAFVNWINKALENDPDCKHVLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKAGKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLE--NAGWQKISNFSSDIKDSRAYFHLLNQIAPKGQKEGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSG-----NPKLNLAFVANLFNKYPALTK----PVNQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYNDLQDALVILQLYDKIKVPVDWNKVNKPPYPKLGANMKKLEN-CNYAVELGKYPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRRYTLNVLECLGEGQKVNDEIIVNWVNRTLADAGKKTSIQNFKDKTICTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLVEVKPKMVMTVFACLMGRGMKKV 568          
BLAST of Plastin-3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 171.4 bits (433), Expect = 1.276e-45
Identity = 137/520 (26.35%), Postives = 243/520 (46.73%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDI---YSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKF-VSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDC----EITSFRDTLINDKRVLAKVIDKVFPNSIDWDYME-----TLSTSKERALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    LP+NPN+++LF  + DGI+ C +I    P +ID  VI  K +++     +NL LA  +A + GC+VV +    + +G     L  LWQ+  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   N+   KIS+F  ++ D   Y +L + +A       +  I    S   E D   R   +L+  D +  + F+    + SG       K++L   A LF+++P +++     ++Q  D   LE E+  E+  RN++N LGVNP   ++++D +D L+I Q+ D +   + +       + K     +++ N  N    LGK+     +  +  + +  GN  L   +++ +M  +   V       +K + + ++ WVN    D      I +F+D  I     +  +ID + P  I+++ ++     T     E A Y IS+ARR G  ++  P  L     + +   FA L  +  + V
Sbjct:  125 EKYAFVNWINKALENDPDCKHVLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKAGKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLE--NAGWQKISNFSSDIKDSRAYFHLLNQIAPKGQKEGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSG-----NPKLNLAFVANLFNKYPALTK----PVNQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYNDLQDALVILQLYDKIKVPVDWNKVNKPPYPKLGANMKKLEN-CNYAVELGKYPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRRYTLNVLECLGEGQKVNDEIIVNWVNRTLADAGKKTSIQNFKDKTICTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLVEVKPKMVMTVFACLMGRGMKKV 631          
BLAST of Plastin-3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 171.014 bits (432), Expect = 1.447e-45
Identity = 137/520 (26.35%), Postives = 243/520 (46.73%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDI---YSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKF-VSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDC----EITSFRDTLINDKRVLAKVIDKVFPNSIDWDYME-----TLSTSKERALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    LP+NPN+++LF  + DGI+ C +I    P +ID  VI  K +++     +NL LA  +A + GC+VV +    + +G     L  LWQ+  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   N+   KIS+F  ++ D   Y +L + +A       +  I    S   E D   R   +L+  D +  + F+    + SG       K++L   A LF+++P +++     ++Q  D   LE E+  E+  RN++N LGVNP   ++++D +D L+I Q+ D +   + +       + K     +++ N  N    LGK+     +  +  + +  GN  L   +++ +M  +   V       +K + + ++ WVN    D      I +F+D  I     +  +ID + P  I+++ ++     T     E A Y IS+ARR G  ++  P  L     + +   FA L  +  + V
Sbjct:  119 EKYAFVNWINKALENDPDCKHVLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKAGKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLE--NAGWQKISNFSSDIKDSRAYFHLLNQIAPKGQKEGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSG-----NPKLNLAFVANLFNKYPALTK----PVNQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYNDLQDALVILQLYDKIKVPVDWNKVNKPPYPKLGANMKKLEN-CNYAVELGKYPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRRYTLNVLECLGEGQKVNDEIIVNWVNRTLADAGKKTSIQNFKDKTICTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLVEVKPKMVMTVFACLMGRGMKKV 625          
BLAST of Plastin-3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 171.014 bits (432), Expect = 1.536e-45
Identity = 137/520 (26.35%), Postives = 243/520 (46.73%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDI---YSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKF-VSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDC----EITSFRDTLINDKRVLAKVIDKVFPNSIDWDYME-----TLSTSKERALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    LP+NPN+++LF  + DGI+ C +I    P +ID  VI  K +++     +NL LA  +A + GC+VV +    + +G     L  LWQ+  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   N+   KIS+F  ++ D   Y +L + +A       +  I    S   E D   R   +L+  D +  + F+    + SG       K++L   A LF+++P +++     ++Q  D   LE E+  E+  RN++N LGVNP   ++++D +D L+I Q+ D +   + +       + K     +++ N  N    LGK+     +  +  + +  GN  L   +++ +M  +   V       +K + + ++ WVN    D      I +F+D  I     +  +ID + P  I+++ ++     T     E A Y IS+ARR G  ++  P  L     + +   FA L  +  + V
Sbjct:  124 EKYAFVNWINKALENDPDCKHVLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKAGKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLE--NAGWQKISNFSSDIKDSRAYFHLLNQIAPKGQKEGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSG-----NPKLNLAFVANLFNKYPALTK----PVNQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYNDLQDALVILQLYDKIKVPVDWNKVNKPPYPKLGANMKKLEN-CNYAVELGKYPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRRYTLNVLECLGEGQKVNDEIIVNWVNRTLADAGKKTSIQNFKDKTICTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLVEVKPKMVMTVFACLMGRGMKKV 630          
BLAST of Plastin-3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 171.014 bits (432), Expect = 1.626e-45
Identity = 137/520 (26.35%), Postives = 243/520 (46.73%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDI---YSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKF-VSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDC----EITSFRDTLINDKRVLAKVIDKVFPNSIDWDYME-----TLSTSKERALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    LP+NPN+++LF  + DGI+ C +I    P +ID  VI  K +++     +NL LA  +A + GC+VV +    + +G     L  LWQ+  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   N+   KIS+F  ++ D   Y +L + +A       +  I    S   E D   R   +L+  D +  + F+    + SG       K++L   A LF+++P +++     ++Q  D   LE E+  E+  RN++N LGVNP   ++++D +D L+I Q+ D +   + +       + K     +++ N  N    LGK+     +  +  + +  GN  L   +++ +M  +   V       +K + + ++ WVN    D      I +F+D  I     +  +ID + P  I+++ ++     T     E A Y IS+ARR G  ++  P  L     + +   FA L  +  + V
Sbjct:  123 EKYAFVNWINKALENDPDCKHVLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKAGKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLE--NAGWQKISNFSSDIKDSRAYFHLLNQIAPKGQKEGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSG-----NPKLNLAFVANLFNKYPALTK----PVNQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYNDLQDALVILQLYDKIKVPVDWNKVNKPPYPKLGANMKKLEN-CNYAVELGKYPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRRYTLNVLECLGEGQKVNDEIIVNWVNRTLADAGKKTSIQNFKDKTICTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLVEVKPKMVMTVFACLMGRGMKKV 629          
BLAST of Plastin-3 vs. Ensembl Mouse
Match: Lcp1 (lymphocyte cytosolic protein 1 [Source:MGI Symbol;Acc:MGI:104808])

HSP 1 Score: 174.096 bits (440), Expect = 8.450e-47
Identity = 139/522 (26.63%), Postives = 249/522 (47.70%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHN---GANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDCE----ITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERAL----YCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    +P+NPN+D+LF+ + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    +  G    VL  LWQ+  +GL   I    N  ++ L  + E  + + ++ PEE L R+ NY +   N+   KI++F  ++ D   Y +L + VA    +    A+  D+  + +E D   R   +L+  + +  + F+    +  G       K++L   A LF+++P + + E   I    D   LE E+  E+  RN++N LGVNP   +++ D  D L+I Q+ + +   + +       + K     +++ N     +      KF  V IA    + +  GNR L   +++ LM  +   +  +    +K +   ++ WVN+   + +    I SF+D  I+    +  +ID + P SI++D ++T +   E  L    Y IS+AR+ G  ++  P  L   + + +   FA L  K  + V
Sbjct:  122 EKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLE--NAGCTKITNFSTDIKDSKAYYHLLEQVAPKGDEEGIPAVVIDMSGL-REKDDIQRAECMLQQAERLGCRQFVTATDVVRG-----NPKLNLAFIANLFNKYPALHKPENQDI----DWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAG---QDLNEGNRTLTLALVWQLMRRYTLNILEDIGGGQKVNDDIIVNWVNTTLKEAQKSSSIASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV 627          
BLAST of Plastin-3 vs. Ensembl Mouse
Match: Lcp1 (lymphocyte cytosolic protein 1 [Source:MGI Symbol;Acc:MGI:104808])

HSP 1 Score: 174.096 bits (440), Expect = 8.450e-47
Identity = 139/522 (26.63%), Postives = 249/522 (47.70%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHN---GANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDCE----ITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERAL----YCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    +P+NPN+D+LF+ + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    +  G    VL  LWQ+  +GL   I    N  ++ L  + E  + + ++ PEE L R+ NY +   N+   KI++F  ++ D   Y +L + VA    +    A+  D+  + +E D   R   +L+  + +  + F+    +  G       K++L   A LF+++P + + E   I    D   LE E+  E+  RN++N LGVNP   +++ D  D L+I Q+ + +   + +       + K     +++ N     +      KF  V IA    + +  GNR L   +++ LM  +   +  +    +K +   ++ WVN+   + +    I SF+D  I+    +  +ID + P SI++D ++T +   E  L    Y IS+AR+ G  ++  P  L   + + +   FA L  K  + V
Sbjct:  122 EKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLE--NAGCTKITNFSTDIKDSKAYYHLLEQVAPKGDEEGIPAVVIDMSGL-REKDDIQRAECMLQQAERLGCRQFVTATDVVRG-----NPKLNLAFIANLFNKYPALHKPENQDI----DWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAG---QDLNEGNRTLTLALVWQLMRRYTLNILEDIGGGQKVNDDIIVNWVNTTLKEAQKSSSIASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV 627          
BLAST of Plastin-3 vs. Ensembl Mouse
Match: Lcp1 (lymphocyte cytosolic protein 1 [Source:MGI Symbol;Acc:MGI:104808])

HSP 1 Score: 174.096 bits (440), Expect = 8.450e-47
Identity = 139/522 (26.63%), Postives = 249/522 (47.70%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHN---GANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDCE----ITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERAL----YCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    +P+NPN+D+LF+ + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    +  G    VL  LWQ+  +GL   I    N  ++ L  + E  + + ++ PEE L R+ NY +   N+   KI++F  ++ D   Y +L + VA    +    A+  D+  + +E D   R   +L+  + +  + F+    +  G       K++L   A LF+++P + + E   I    D   LE E+  E+  RN++N LGVNP   +++ D  D L+I Q+ + +   + +       + K     +++ N     +      KF  V IA    + +  GNR L   +++ LM  +   +  +    +K +   ++ WVN+   + +    I SF+D  I+    +  +ID + P SI++D ++T +   E  L    Y IS+AR+ G  ++  P  L   + + +   FA L  K  + V
Sbjct:  122 EKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLE--NAGCTKITNFSTDIKDSKAYYHLLEQVAPKGDEEGIPAVVIDMSGL-REKDDIQRAECMLQQAERLGCRQFVTATDVVRG-----NPKLNLAFIANLFNKYPALHKPENQDI----DWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAG---QDLNEGNRTLTLALVWQLMRRYTLNILEDIGGGQKVNDDIIVNWVNTTLKEAQKSSSIASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV 627          
BLAST of Plastin-3 vs. Ensembl Mouse
Match: Pls3 (plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:104807])

HSP 1 Score: 172.555 bits (436), Expect = 3.671e-46
Identity = 136/520 (26.15%), Postives = 246/520 (47.31%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKF-VSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE----RALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    +P+NPN+D+LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    + +G    VL  LWQI  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   NS   KI++F  ++ D   Y +L + +A    +     +  ++   N+  D K R   +L+  D +  + F+    + SG       K++L   A LF+++P +++ E   I    D   LE E+  E+  RN++N LGVNP   +++ D +D L+I Q+ + +   + +       + K     +++ N  N    LGK      +  +  + +  GN  L   +++ LM  +   V  +    +K +   ++ WVN           I SF+D  I+    +  +ID + P  I++D +++ + +++     A Y +S+ARR G  ++  P  L     + +   FA L  +  + V
Sbjct:  125 EKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAI-NKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLE--NSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLK-RAESMLQQADKLGCRQFVTPADVVSG-----NPKLNLAFVANLFNKYPALTKPENQDI----DWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLEN-CNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGEGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV 630          
BLAST of Plastin-3 vs. Ensembl Mouse
Match: Pls3 (plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:104807])

HSP 1 Score: 172.555 bits (436), Expect = 3.671e-46
Identity = 136/520 (26.15%), Postives = 246/520 (47.31%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKF-VSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE----RALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    +P+NPN+D+LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    + +G    VL  LWQI  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   NS   KI++F  ++ D   Y +L + +A    +     +  ++   N+  D K R   +L+  D +  + F+    + SG       K++L   A LF+++P +++ E   I    D   LE E+  E+  RN++N LGVNP   +++ D +D L+I Q+ + +   + +       + K     +++ N  N    LGK      +  +  + +  GN  L   +++ LM  +   V  +    +K +   ++ WVN           I SF+D  I+    +  +ID + P  I++D +++ + +++     A Y +S+ARR G  ++  P  L     + +   FA L  +  + V
Sbjct:  125 EKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAI-NKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLE--NSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLK-RAESMLQQADKLGCRQFVTPADVVSG-----NPKLNLAFVANLFNKYPALTKPENQDI----DWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLEN-CNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGEGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV 630          
BLAST of Plastin-3 vs. UniProt/SwissProt
Match: sp|Q6P698|PLSL_DANRE (Plastin-2 OS=Danio rerio OX=7955 GN=lcp1 PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.354e-46
Identity = 129/505 (25.54%), Postives = 242/505 (47.92%), Query Frame = 3
Query:    9 AEVNAIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVN---SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERAL----YCISIARREGCPMFFTP 1481
            +E +     + + EK  ++NW+N+ L    +    LP++P++D+LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    +  G +  VL  LWQ+  +GL   I    N  ++ L  D E  + + ++ PEE L R+ NY + +  +  PKI++F  ++ D   Y  + + VA    +    A+  DI  I ++ D K R   +LE  D +  + F+    +  G       K++L   A LF+++P + + E   I    D   +E E+  E+  RN++N LGVNP   +++ D  D L+I Q+ + +   + +       + K     +++ N    +    K     +  +  + +  GNR L   +++ LM  +   +  +    +K   + +++WVN   + +    I+ F+D  I+    +  +ID + P SI +D ++    + E+ L    Y IS+AR+ G  ++  P
Sbjct:  107 SEQSGTQHSYSEEEKVAFVNWVNKALEKDPDCQHVLPMDPSTDDLFTAVGDGIVLCKMINLSVPDTIDERTI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIEISRNEALIALLRDGESLEDLVKLSPEELLLRWANYHLEE--AGCPKINNFSSDIKDSKAYYNILNQVAPKRDEEGIPAIPIDISGIREKDDLK-RAECMLEQADRLGCRQFVTATDVVRG-----NPKLNLAYVANLFNKYPALKKPENQDI----DWSSIEGETREERTFRNWMNSLGVNPRVNHLYVDLADALVIFQLYEKIKVPVDWDKVNKPPYPKLGSNMKKLENCNYAVELGKKEAKFSLVGIAGQDLNEGNRTLTLALLWQLMRRYTLNILEDLGDGQKIIDETIVQWVNETLTQAGKGTISGFKDGSISSSMPVLDLIDAIQPGSIRYDLLKAEDLTDEKKLNNAKYAISMARKIGARVYALP 598          
BLAST of Plastin-3 vs. UniProt/SwissProt
Match: sp|Q63598|PLST_RAT (Plastin-3 OS=Rattus norvegicus OX=10116 GN=Pls3 PE=1 SV=2)

HSP 1 Score: 175.252 bits (443), Expect = 2.726e-46
Identity = 139/519 (26.78%), Postives = 243/519 (46.82%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDI---YSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGK-FVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNS----FSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE----RALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    +P+NPN+D+LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    + +G    VL  LWQI  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   NS   KI++F  ++ D   Y +L + +A       +  I    S   E D   R   +L+  D +  + F+    + SG       K++L   A LF+++P +++ E   I    D   LE E+  E+  RN++N LGVNP   +++ D +D L+I Q+ + +   + +       + K     +++ N  N    LGK      +  +  + +  GN  L   +++ LM  +   V  +    +K     ++ WVN           I SF+D  I+    +  +ID + P  I++D ++T + ++E     A Y +S+ARR G  ++  P  L     + +   FA L  +  ++V
Sbjct:  125 EKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAI-NKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLE--NSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSG-----NPKLNLAFVANLFNKYPALTKPENQDI----DWTLLEGETREERTFRNWMNSLGVNPHVNHLYVDLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLEN-CNYAVELGKNQAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVMEDLGEGQKATDDIIVNWVNGTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKTGNLTEEDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKSV 630          
BLAST of Plastin-3 vs. UniProt/SwissProt
Match: sp|A7E3Q8|PLST_BOVIN (Plastin-3 OS=Bos taurus OX=9913 GN=PLS3 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 5.503e-46
Identity = 137/519 (26.40%), Postives = 244/519 (47.01%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDI---YSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKF-VSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWV----NSFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE----RALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    +P+NPN+D+LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    + +G    VL  LWQI  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   NS   KI++F  ++ D   Y +L + +A       +  I    S   E D   R   +L+  D +  + F+    + SG       K++L   A LF+++P +++ E   I    D   LE E+  E+  RN++N LGVNP   +++ D +D L+I Q+ + +   + +       + K     +++ N  N    LGK      +  +  + +  GN+ L   +++ LM  +   V  +    +K +   ++ WV    N       I SF+D  I+    +  +ID + P  I++D +++ + +++     A Y +S+ARR G  ++  P  L     + +   FA L  +  + V
Sbjct:  125 EKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAI-NKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLE--NSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSG-----NPKLNLAFVANLFNKYPALTKPENQDI----DWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLEN-CNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVSWVNRTLNEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGTLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV 630          
BLAST of Plastin-3 vs. UniProt/SwissProt
Match: sp|Q61233|PLSL_MOUSE (Plastin-2 OS=Mus musculus OX=10090 GN=Lcp1 PE=1 SV=4)

HSP 1 Score: 174.096 bits (440), Expect = 5.911e-46
Identity = 139/522 (26.63%), Postives = 249/522 (47.70%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHN---GANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDCE----ITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERAL----YCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    +P+NPN+D+LF+ + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    +  G    VL  LWQ+  +GL   I    N  ++ L  + E  + + ++ PEE L R+ NY +   N+   KI++F  ++ D   Y +L + VA    +    A+  D+  + +E D   R   +L+  + +  + F+    +  G       K++L   A LF+++P + + E   I    D   LE E+  E+  RN++N LGVNP   +++ D  D L+I Q+ + +   + +       + K     +++ N     +      KF  V IA    + +  GNR L   +++ LM  +   +  +    +K +   ++ WVN+   + +    I SF+D  I+    +  +ID + P SI++D ++T +   E  L    Y IS+AR+ G  ++  P  L   + + +   FA L  K  + V
Sbjct:  122 EKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLE--NAGCTKITNFSTDIKDSKAYYHLLEQVAPKGDEEGIPAVVIDMSGL-REKDDIQRAECMLQQAERLGCRQFVTATDVVRG-----NPKLNLAFIANLFNKYPALHKPENQDI----DWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAG---QDLNEGNRTLTLALVWQLMRRYTLNILEDIGGGQKVNDDIIVNWVNTTLKEAQKSSSIASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV 627          
BLAST of Plastin-3 vs. UniProt/SwissProt
Match: sp|P13797|PLST_HUMAN (Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4)

HSP 1 Score: 173.711 bits (439), Expect = 9.858e-46
Identity = 136/520 (26.15%), Postives = 247/520 (47.50%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKF-VSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE----RALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            EK  ++NWIN+ L    +    +P+NPN+D+LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    + +G    VL  LWQI  +GL   I    N  +  L  D E  + + ++ PEE L R+ N+ +   NS   KI++F  ++ D   Y +L + +A    +     +  ++   N+  D K R   +L+  D +  + F+    + SG       K++L   A LF+++P +++ E   I    D   LE E+  E+  RN++N LGVNP   +++ D +D L+I Q+ + +   + +       + K     +++ N  N    LGK      +  +  + +  GN+ L   +++ LM  +   V  +    +K +   ++ WVN           I SF+D  I+    +  +ID + P  I++D +++ + +++     A Y +S+ARR G  ++  P  L     + +   FA L  +  + V
Sbjct:  125 EKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAI-NKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLE--NSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLK-RAESMLQQADKLGCRQFVTPADVVSG-----NPKLNLAFVANLFNKYPALTKPENQDI----DWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLEN-CNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV 630          
BLAST of Plastin-3 vs. TrEMBL
Match: A0A4U8V1H9 (Uncharacterized protein OS=Steinernema carpocapsae OX=34508 GN=L596_006250 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 3.426e-58
Identity = 142/487 (29.16%), Postives = 248/487 (50.92%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYY-----EKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERALYCISIARREGCPMFFTP 1481
            E+  + NWIN NL    +L  +LP+ PN +EL+  I DGIIFC ++    P +ID   +  K  ++   K +NL LA  +A+S GC++V +D + +  G    VL  LWQI  +GL   I     P +  L   DE  D +++M PEE L R++NY + ++     ++++FQ ++ D  +Y +L D +A   +  +  DI  I   PD   R   +L   D +  +AF++ N + +G      YK++L   A LF++ P +++ E ++++    E+++ +E+H E + RN++N LGV P    ++ D  +GL+  QI D +   I      +K   K   + + I N  N +  LGK +   +  +  + +  GNR L   +++ LM  +          + ++    KE++ W N    S      I SF+D+ I D +V+  ++D + P +ID+D   + +   E A Y I+  R+ G  ++  P
Sbjct:  113 EEVAFANWINSNLSTDLDLKFYLPVEPNGNELYVKIQDGIIFCKLVNLAVPETIDERAM-NKKNLNTYSKLENLTLALMSAQSIGCSIVNIDADDLSKGKPHLVLGLLWQIIRIGLFSQIDLRHVPGLFRLLRPDETLDDLRKMSPEEILMRWVNYHL-EHAKVERRLTNFQSDITDSFIYTHLLDQIAPMGY-NVCTDILHI---PDKSARAAAMLSEADKIGCRAFVMPNDVVNG-----NYKLNLAFVANLFNKHPNLADPEDNEMT---GEVEVYEETHEEFIYRNWMNSLGVEPFVNWLYSDLSNGLIYFQIYDAIRPGIVTWKRVVKQSRKLTGMMDHIQN-CNYVVELGKRMGFSLVGIQGKDLYDGNRTLTLALVWQLMRAYTLTVLAQCTDSGDRLATDKEIITWSNEKLKSAGKQTSIKSFQDSNIQDAKVVLDLVDAIKPGTIDYDLF-SANDYLENAKYAITSGRKIGAKIYALP 583          
BLAST of Plastin-3 vs. TrEMBL
Match: A0A1I8CM29 (Uncharacterized protein OS=Rhabditophanes sp. KR3021 OX=114890 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 2.206e-57
Identity = 142/500 (28.40%), Postives = 250/500 (50.00%), Query Frame = 3
Query:   18 NAIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA-QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYY------EKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSK-ERALYCISIARREGCPMFFTP 1481
            N I     D E+  + NWIN NL    +L   LP++P S EL+  INDG+I C +I      +ID  VI  K  ++   K +NL L+  +A++ GC ++ +D + +F G    VL  LWQI  +GL   I     P +L +   DE  + +++M PE+ L +++NY + K    G K+ +F  ++ D  +Y +L   +A + S + L     S++      DR   +LE  + + V+ F+      +G +    YK++L   A LF+++P + E +  ++  I   +  ++ES  EK  RN++N LGV+     ++ D ++GL+I Q+ DI+   +      ++ F K Q + E+I N  N    LG+ +   +  +  + +  GNR L   +++ LM  +           N  K    K++++W N    +   +  I  F+D+ I++ R +  +ID + P SID++ ++    SK   A Y IS  R+ G  ++  P
Sbjct:   20 NGIVHTICDEEEVAFSNWINNNLSDDGDLVQLLPLDPQSQELYTKINDGLILCKLINLAVRDTIDERVI-NKKNLNTYTKLENLTLSLMSAQAIGCAIINIDADDLFKGKPHLVLGLLWQIIRIGLFNQIDLSNVPGLLRILDKDENVESLRKMSPEDILVKWVNYHLEKA-GCGKKLGNFTNDVQDSVIYTHLLHQIAPKGSGVGLGP--LSVDGNV---DRAGAMLEEAEKIGVREFV-----SAGDVSNGVYKLNLAFVANLFNKYPSLPEPDVEEVELI---VAADKESREEKTYRNWMNSLGVSSCVNWLYADLQNGLVIFQLYDIIQPGVVNWKKVVQTFRKLQSMMEKISN-CNYAVELGRELRFSLVGIQGKDLYDGNRTLTLALVWQLMRAYTLVILSQCTHANDGKLVGDKDIIEWANQKLTASGKESSIKGFQDSTISNGRAVIDLIDAIAPGSIDYEMVKDQGESKLSNAKYAISSGRKIGAKIYALP 503          
BLAST of Plastin-3 vs. TrEMBL
Match: A0A0N4ZDI4 (Uncharacterized protein OS=Parastrongyloides trichosuri OX=131310 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 7.032e-56
Identity = 144/490 (29.39%), Postives = 240/490 (48.98%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVY------YEKNTEKKFDKKELLKWVNSFSID----CEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETL--STSKERALYCISIARREGCPMFFTP 1481
            E+  Y NWIN NL    +L   LP+N  S EL+  INDG+I C +I    P +ID  VI  K  ++   K +NL L   +A++ GCN+V +D + +  G +  VL  LWQI  +GL   I  +  P +  L  D E  D ++++ PEE L R++NY + K   +  ++ +F  ++ D  +Y +L + +A          +      P    R   +L+  D +  + F+  N + +G      YK++L   A LF++ P + E    +I Q+ D I   +E+  EK  RN++N +GV P    ++ D +DGL+I Q+ DI+   I      ++ F K Q + ++I N  N    LG+ +   +  +  + +  GN  L   +++ LM  +           N       KE++ WVN    D      I SF+D+ I+D +V+  +ID + P +I++D +     S+  E A Y IS  R+ G  ++  P
Sbjct:  114 EEVAYSNWINSNLSDDADLNKLLPVNAASHELYSKINDGLIICKLINLAVPDTIDERVI-NKKNLNTYTKLENLTLCLMSAQAIGCNIVNIDADDLSKGKQHLVLGLLWQIIRIGLFNQIDLVTVPGLFRLLKDGETLDDLRKLSPEEILLRWVNYHLEKAGCN-RRLHNFTTDVIDSEIYTHLINQIAPSGSNVTLAPLSVQGNIP----RAGAMLDQADKIGCREFVTPNDVANG-----VYKLNLAFVANLFNKHPNLPEPGADEIEQLEDVI---EETREEKTYRNWMNSMGVKPFVNWLYGDLQDGLIIFQLYDIIKPGIVNWKNVVQVFRKLQQMMDKISN-CNYAVDLGRQLKFSLVGIQGKDLYDGNTTLTLALVWQLMRAYTLTILSQCTNANDGTLVADKEIISWVNKKLADSGKTSSIKSFQDSSISDSKVVLDLIDSIAPGTINYDLLRIGDDSSKIENAKYAISSGRKIGAKIYALP 588          
BLAST of Plastin-3 vs. TrEMBL
Match: A0A0N5BSW3 (Uncharacterized protein OS=Strongyloides papillosus OX=174720 PE=4 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 2.081e-55
Identity = 141/491 (28.72%), Postives = 246/491 (50.10%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA-QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYY------EKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE--RALYCISIARREGCPMFFTP 1481
            E+  + NWIN +L    +L  HLP+N ++ EL+  ++DG++ C +I    P +ID  VI  K  ++   K +NL L+  +A++ GCN+V +D + +  G +  VL  LWQI  +GL   I  +  P +  L  D E  D ++++  EE L R++NY + K      ++ +F  ++ D  +Y +L   VA Q S + L     + N +     R   +L+  D +  + F+  N + +G      Y ++L   A LF+++  + E++  +  QIND   ++ E+  EK  RN++N +GV P    ++ D +DGL+I Q+ DI+   I      +  F K Q+  ++I N  N   +LG  +   +  +  + +  GNR L   +++ LM  +          KN       KE++ WVN    S      I SF+D  I+D  V+  +ID + P +I++D +++   S +   A Y IS  R+ G  ++  P
Sbjct:  114 EEVAFSNWINSHLSEDPDLKKHLPVNADTHELYQKLDDGLVLCKLINLAVPETIDERVI-NKKNLNTYSKLENLTLSLMSAQAIGCNIVNIDADDLSKGRQHLVLGLLWQIIRIGLFNQIDLIRVPGLFRLLKDGETADDLRKLSKEEILMRWVNYHL-KRAGCNRELKNFTTDVMDSEIYTHLLHQVAPQGSGVNLSPLNLTGNLQ-----RATAMLQQADKLNCREFVTPNDVCNG-----VYNLNLAFLANLFNKYANLPELDVEETEQIND---IDGETREEKTYRNWMNSMGVKPFVNWLYGDLQDGLIIFQLYDIIKPGIVNWKNVVTTFRKLQMFMDKISN-CNYAVQLGVQLRFSLVGIQGKDLYDGNRTLTLALVWQLMRAYTLAILSQCTNKNDGTLVTDKEIIAWVNEKLASSGKKTSIKSFQDPSISDGTVVIDLIDAIAPGTINYDMVKSGGESAKIANAKYAISSGRKIGAKIYALP 588          
BLAST of Plastin-3 vs. TrEMBL
Match: T1EDU2 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20194744 PE=4 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 2.297e-55
Identity = 138/490 (28.16%), Postives = 246/490 (50.20%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA-QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLM----LYWVYYEKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKER---ALYCISIARREGCPMFFTP 1481
            E+  + NWIN+N         +LPINP+++ELF   NDG+++C ++    P ++D   I   A++S  + ++NL LA  +A S GCN++ +  + +++G    VL  LWQI   GL+  I    +P +  L  D E  +   ++ PE+ L R++NY +++ N  G +I++   ++ D   Y++L   +A   S I    +      E D   R   +L+  + ++ +AF+  + +  G      YK++L   A LF+ +P + +     +S+I+ E +       EK+ RN++N +GV+P  + I+ D  DGL+I Q+ DI+ +     +  IK F+K + + E+I N  N    LG+     +  +  + I  GN  L   +++ LM    L  +     T     + E++ WVN           IT F D  I+  RV+  ++D   P SI++D ++   + +E+   A Y IS AR+ G  ++  P
Sbjct:  121 EQVAFANWINKNFGEDPECKKYLPINPDNNELFTKCNDGVLYCKLVNNSQPGTVDERTINRAAKLSIYQIHENLNLALNSASSIGCNIINIGPDDLYAGKPHLVLGLLWQIIRYGLLANIDLHNHPGLAALLLDGESLEDFMKLSPEQILIRWVNYHLARSN-CGRQIANLTGDIKDSVAYIHLLHQIAPPDSGITTHAE-----HEHDLHQRAERMLQEAEKIQCRAFVSPDDVVRG-----NYKLNLAFVANLFNMYPALDQAPNIDLSEIHPETRE------EKMYRNWMNSIGVSPYVSRIYSDLTDGLIIFQLYDIIKSGTVNWNKVIKKFNKMKAMMEKIEN-CNYAVELGRECKFSLVGIDGKNIYDGNETLTLALVWQLMKAYTLSMLTTLAGTGHPVLESEIVTWVNNKLQGAGKSRRITGFNDPTISSGRVVLDLVDACKPGSINYDLVKQGDSEEEKLSNAQYAISAARKIGARVYALP 592          
BLAST of Plastin-3 vs. Ensembl Cavefish
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 167.548 bits (423), Expect = 1.358e-44
Identity = 127/505 (25.15%), Postives = 238/505 (47.13%), Query Frame = 3
Query:    9 AEVNAIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSH----IALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDCE---ITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERAL----YCISIARREGCPMFFTP 1481
            +E +     + + EK  ++NWIN+ L    +    LP++P+S++LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  ++ + GC+VV +    +  G +  VL  LWQI  +GL+  I    N  ++ L  D E  + + ++ PEE L R+ NY + +   S  KI++F  ++ D   Y  + + VA          +  D+  + ++ D K R   +L+  D +  + F++   +  G       K++L   A LF+++P + + E   I    D   +E E+  E+  RN++N LGVNP   +++ D  D L+I Q+ + +   + +       + K     +++ N    +    K     +  +  + +  GNR L   +++ LM  +   +  +    +K +   ++ WVN      +   I+ F+D  I+    +  +ID + P SI +D ++    S E  L    Y IS+AR+ G  ++  P
Sbjct:  105 SEQSGTQHSYSEEEKVAFVNWINKALEKDPDCKHVLPMDPSSNDLFTAVGDGIVLCKMINLSVPDTIDERTI-NKKKLTPFTIQENLNLALNSSSAIGCHVVNIGAEDLKEGRQHLVLGLLWQIIKIGLLADIEISRNEALIALLRDGESLEDLMKLSPEELLLRWANYHLEQAGCS--KINNFSSDIKDSKAYYNILNQVAPKGDDEGIPPIIIDMTGLREKEDLK-RAECMLDQADRLGCRQFVMPPDVVRG-----NPKLNLAFVANLFNKYPALKKPENQDI----DWSSIEGETREERTFRNWMNSLGVNPRVNHLYGDLADALIIFQLYEKIKVPVDWDKVNKPPYPKLGSNMKKLENCNYAVELGKKEAKFSLVGIAGQDLNEGNRTLTLALLWQLMRRYTLNILEDLGDGQKVNDDTIVGWVNDTLKQADKKTISGFKDGSISSSMPVLDLIDAIQPGSIRYDLIKAEDLSDEEKLNNAKYAISMARKIGARVYALP 596          
BLAST of Plastin-3 vs. Ensembl Cavefish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 155.221 bits (391), Expect = 1.824e-40
Identity = 135/496 (27.22%), Postives = 232/496 (46.77%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFD-VINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDIYSIN----QEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIK-DFSKQQIVSERIHNGANCINRLGKFVS-VPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSK----ERALYCISIARREGCPMFFTP 1481
            EK  ++NWIN  L    +    LP+NPN+D LF   I DGI+F  I+           + I    ++ E  Y+NL LA  +A + GC+VV +    +  G    VL  LWQI  +GL   I    N  +  L  + E  + + ++ PEE L R+ N+ +   N+   KI++F  ++ D   Y +L + +A    +    D   IN     E D   R   +L   D +  + F+    + SG       K++L   A LF+++P +++ E   I    D   LE E+  E+  RN++N LGVNP   +++ D +D L+I Q+ + +   + + +   K  + K     +++ N  N    LGK  +   +  +  + +  GN  L   +++ LM  +   V  +    +K +   ++ WVN          +I+SF+D  I+    +  +ID + P S+ +D ++T S S     E A Y +S+AR+ G  ++  P
Sbjct:   65 EKFAFVNWINTALEKDPDCKHVLPMNPNTDSLFKFAIFDGIVFLDIV----------LLNICNTNVNFELNYENLNLALNSASAIGCHVVNIGALDLREGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLREGETLEDLMKLSPEELLLRWANFHLD--NAGWHKINNFSSDIKDSKAYFHLLNQIAPKG-LKENEDRIDINMAGFNEKDDLKRAEAMLVQADRLGCRQFVTPADVVSG-----NPKLNLAFVANLFNKYPALTKPENQDI----DWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYERIKVPVDWNNKVNKPPYPKLGANMKKLEN-CNYAVDLGKTTAKFSLVGIGGQDLNDGNPTLTLALVWQLMRRYTLNVLEDLGDGEKVNDDIIVNWVNKTLAGAGKSTKISSFKDKEISSSLPVLDLIDAIQPGSVHYDLVKTGSLSDQDKLENAKYAVSMARKIGARVYALP 537          
BLAST of Plastin-3 vs. Ensembl Cavefish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 112.464 bits (280), Expect = 7.875e-26
Identity = 129/528 (24.43%), Postives = 224/528 (42.42%), Query Frame = 3
Query:   42 DCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHS----HIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANC------INRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSF----SIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERAL----YCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAVK 1562
            D EK  ++NWIN+ L    +    +P++P +D L       ++   +I    P +ID  VI TK   +     +NL LA  +A + GC VV +D   + +G    VL  LWQI  +GL   I    N    L                  T  ++I+      +    +   F Q   D   Y +L D ++        + +  D+  +N+  D + R  L+L     +  + F+    + +G      +K+++   A LF+ FP +S    + I    D   LE ES  ++  RN++N LGVNP   +++ D  DGL+I Q+ + +   + ++      +S   I+   +    NC        R  KF  V I     E I  G+      +++ LM  +   V  +    +K + + ++ WVNS       D  I +F+D  I+    +  +ID + P +I  + ++    S E  L    Y IS++R+ G  ++  P  L   + + +   FA L  +S   V+
Sbjct:  121 DEEKVAFVNWINKALANDPDCKHLIPMDPTTDSLCAQFYT-LVELKMINLSQPDTIDERVINTKKRTTFT-MTENLILALNSASAIGCTVVNIDSQDMIAGTPHLVLGLLWQIIKIGLFADIEISRNEGQKL------------------TTIQHISQSCPWGSIHDLQCLFFSQ---DSRAYFHLLDQISPKGDGDDEMRISIDMSGLNERDDER-RAELMLRQAARLDCRQFVTPQDVVAGN-----HKLNMAFVANLFNMFPALSRPANNGI----DLAMLEGESREDRTFRNWMNSLGVNPYVNHLYSDLMDGLIILQLYERIQVPVDWRKVNRPPYS---ILGSNMKKLENCNYAVELGKREAKFSLVGIGG---ENINEGSAMHTLALVWQLMRRYTVKVLADIGHGEKVNDQIIVDWVNSTLQKGQKDSSIKNFKDKSISTSLPVIDLIDTIAPGAIKSEMVKRGDMSPEDKLNNAKYAISVSRKIGAKVYALPDDLVEVNPKMVMTVFACLMGRSLNKVQ 609          
BLAST of Plastin-3 vs. Ensembl Sea Lamprey
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 65.4698 bits (158), Expect = 7.573e-12
Identity = 66/271 (24.35%), Postives = 118/271 (43.54%), Query Frame = 3
Query:  780 KMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDC----EITSFRDTLINDKRVLAKVIDKVFPNSIDWDYM-ETLSTSKER---ALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            K++L   A LF+++P    + K     I+  +    ES  E+  RN++N LGVNP   +++ D  D L+I Q+ + +   + +       + K     +++ N  N    LGK     +  +  + +  GN  L   +++ LM  +   V  +    +K + + ++ WVN    D      I SF+            +ID + P SI +D + E   T  +R   A Y IS+AR+ G  ++  P  L     + +   FA L  +  + V
Sbjct:   69 KLNLAFVANLFNKYP---ALHKPANQDIDWGLLEAGESREERTFRNWMNSLGVNPFVNHLYSDLVDALVIIQLFEKIKTRVDWNKVNKPPYPKLGANMKKLEN-CNYAVELGKTTKFSLVGIGGQDLNDGNPTLTLALVWQLMRKYTIQVLEDLGEGEKVNDEIIVNWVNHTLRDAGKSSSIASFKVPPTALSTPCWDLIDAIQPGSIRYDLVKEEPLTDDDRLDNAKYAISMARKIGARVYALPDDLVEVKPKMVMTMFACLMGRGMKKV 335          
BLAST of Plastin-3 vs. Ensembl Yeast
Match: SAC6 (Fimbrin, actin-bundling protein; cooperates with Scp1p in organization and maintenance of the actin cytoskeleton; phosphorylated by Cdc28p/Clb2p in metaphase on T103, to regulate conformation, and modulate actin filament binding affinity and actin cable dynamics; relocalizes from the plasma membrane to the cytoplasm upon DNA replication stress; human homologs PLS3 and LCP1 implicated in spinocerebellar ataxia type 2 (SCA2) can each complement yeast null mutant [Source:SGD;Acc:S000002536])

HSP 1 Score: 137.117 bits (344), Expect = 7.424e-35
Identity = 120/496 (24.19%), Postives = 232/496 (46.77%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVI---ITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSV--AQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQIND-EIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMD-ILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYYEKNT----EKKFDKKELLKW----VNSFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKER---ALYCISIARREGCPMFFTP 1481
            E++ +   IN  L   +++G  LP   ++ +LFD   DG++   +I    P +ID+ V+       E++  +  +N  +   +A++ GC VV +    I  G    +L  +WQI   GL+  I    +PE+  L  DDE  +   R+ PE+ L R+ NY + + N +  ++++F ++++DG  Y  L + +  A  S   L        Q  D  +R   +L+N + +  + +L  + + +G       K++L   A LF+  P +  I++ +  +I + + + E+E+ +  L   ++N L V+P   ++  D KDGL++ Q  + ++   + +K    +  S  +I   +     N    LG+     +  +    I  GN+ L   +++ LM   +     T     +     ++LKW    V     +  I SF+D  +++   L  V++ + P  +D+D +   +T +ER   A   ISIAR+ G  ++  P
Sbjct:  141 ERREFTKHINSVLAGDQDIGDLLPFPTDTFQLFDECRDGLVLSKLINDSVPDTIDTRVLNWPKKGKELNNFQASENANIVINSAKAIGCVVVNVHSEDIIEGREHLILGLIWQIIRRGLLSKIDIKLHPELYRLLEDDETLEQFLRLPPEQILLRWFNYHLKQANWN-RRVTNFSKDVSDGENYTILLNQLDPALCSKAPL--------QTTDLMERAEQVLQNAEKLDCRKYLTPSSLVAG-----NPKLNLAFVAHLFNTHPGLEPIQEEEKPEIEEFDAEGEREARVFTL---WLNSLDVDPPVISLFDDLKDGLILLQAYEKVMPGAVDFKHVNKRPASGAEISRFKALENTNYAVDLGRAKGFSLVGIEGSDIVDGNKLLTLGLVWQLMRRNISITMKTLSSSGRDMSDSQILKWAQDQVTKGGKNSTIRSFKDQALSNAHFLLDVLNGIAPGYVDYDLVTPGNTEEERYANARLAISIARKLGALIWLVP 619          
BLAST of Plastin-3 vs. Ensembl Nematostella
Match: EDO32484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUX1])

HSP 1 Score: 153.295 bits (386), Expect = 4.297e-40
Identity = 128/514 (24.90%), Postives = 232/514 (45.14%), Query Frame = 3
Query:   42 DCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIK-DFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYYE----KNTEKKFDKKELLKWVN----SFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE---RALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKS 1547
            D E+  + +WIN  L   E+L          D LF+ + DG++ C +I    P++ID   I  K +++    ++N  L   +A + GCN+V +    +  G    VL  +WQ+  +GL   I+    P ++ L  D E  D ++R+ PE+ L R+ N+ +        ++++F  +++D   Y  L + +A      L  D   ++ E DP     L+L N D M  + F+    +  G       K++L     LF+ FP +  +E  +++ I       +E+  EK  RN+IN LG+ P   N++ D  DG+++ Q+ D +   I   D   K  F K     +++ N    I+ +   +   +  +  + I  GN+ LI  +++  M  +          +EK   + E++ WVN    S      IT  +D  I   + +  +ID + P +I++  +      ++    A Y IS+AR+ G  ++  P  L  G  + +   FA L  + 
Sbjct:  104 DDERIGFTDWINSCLGDDEDL------KEAQDGLFNAVKDGVVMCKLINWSVPHTIDERAINMK-KLNVYTIHENQTLVLNSAMAIGCNIVNIGAEDLIEGKPHLVLGLMWQVIRIGLFAKITIQNCPGLVQLLHDHEELDDLRRLAPEDILLRWFNFQLEDAGHH-RRVNNFSSDISDAENYSVLLNKIAPPE---LGIDTPHVS-ESDPTKLAELVLTNADKMACRKFVRAKDVVKG-----NAKLNLAFVCNLFNTFPCLEPVE-HEMTDI-------EETREEKTFRNWINSLGIKPFVQNLYLDLDDGMILFQLFDQVQPGIVNYDKVNKPPFKKMGAKMKKLENCNYAIS-VADLLKFSLVGVGGKDINDGNKMLILALLWQTMRAYTLTVLQKCAGSEKPVTEAEIVVWVNEKLSSAGKATTITGMKDPEIKTSKCVLDLIDAIKPKAINYSMVNAGECQEDAFLNAKYAISMARKVGARVYALPEDLVEGKSKMVMTVFACLMARG 591          
BLAST of Plastin-3 vs. Ensembl Nematostella
Match: EDO40382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7E1])

HSP 1 Score: 122.094 bits (305), Expect = 2.408e-29
Identity = 118/515 (22.91%), Postives = 226/515 (43.88%), Query Frame = 3
Query:   36 HDDCEKKVYINWINRNLFIHENLGPHLPINPNSD--ELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKY---------NSSGPKISSFQQNLNDGCMY-VYLFDSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINR------LGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYY----EKNTEKKFDKKELLKWVNSFSIDCEIT-------SFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKE----RALYCISIARREGCPMFFTP 1481
            H   E+  + +WIN +L   E++  +LPI+ + D  +L++ + DGI+ C +I    P +ID  VI  K  +     ++N  L   +A + GCN+V +    +  G +  VL  LWQ+  +GL   I+    P +  L  + E  +G+  + PEE L R++N+ + KY         +S    + +F  ++ D   Y + L+    Q S +      YS        +++    E + C K   F+    + SG       K+++   A LF  FP + E++  +  ++  + + ++E+  E   RN+IN +G       ++ D  DG+++ ++ + +       D   K   + +  + R+     CI        LGK  +  +  +  + I  G + L   +I+ +M  + Y         +    ++++++WVN      + T        F+D  I+    +  +ID + P  I+   +     S E     A Y IS+AR+ G  ++  P
Sbjct:  119 HSKEEQVAFADWINSSLKEDESVHKYLPIDASEDSSDLYEKVKDGILLCKMINLSAPGTIDERVI-NKPPLKVFTIHENQTLVINSALAIGCNLVNIGAGDLAEGKKHLVLGVLWQVIRIGLFSKITLTNVPGLARLLQEGETIEGLHHLSPEELLLRWVNFHLGKYYDGQNYPPDDSRRKVVHNFSDDIKDSEAYSILLYQIAPQSSGVDHPQSYYSTTDNSKKAEKMLRNAEKIGCRK---FVRAKDVVSG-----NQKLNMAFVANLFSTFPNLPELDDDEGKEVGLDEEYQEETREELTYRNWINSMGCGRYVNWLYSDFFDGIILFKMFEHIRPGCV--DWEKKVNPEGKCKNARMGGKVKCIENCNYAVDLGKQFNFSLIGIQGQDIHEGVQNLTLGLIWQMMRAYTYTLLARLSPDDDHMTEEKIVEWVNKTLQSKKKTHLINKGHGFKDPDISTSLAVLDLIDCISPKMINPALINPDPLSDEDKLPNAQYAISMARKIGAVVYALP 622          
BLAST of Plastin-3 vs. Ensembl Medaka
Match: pls3 (plastin-3 [Source:NCBI gene;Acc:101161915])

HSP 1 Score: 177.563 bits (449), Expect = 3.489e-48
Identity = 142/533 (26.64%), Postives = 255/533 (47.84%), Query Frame = 3
Query:    9 AEVNAIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIK-DFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDCE----ITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSK----ERALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAV 1559
            + V   + F ++ E+  ++NWIN  L    +    LP+NPN+D LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    +  G    VL  LWQI  +GL   I    N  +  L  D E  + + ++ PEE L R+ NY +   N+   KI++F  ++ D   Y +L + ++          +  ++   N++ D K R   +L+  D +  + F+    + +G       K++L   A LF+++P +++ E   I    D   LE E+  E+  RN++N LGVNP   +++ D +D L+I Q+ + +   + + +   K  + K     +++ N  N    LG+     +  +  + +  GN  L   +++ LM  +   V  +     K +   ++KWVN    D E    I+SF+D  I+    + ++ID + P S++++ ++T S S     E A Y IS+AR+ G  ++  P  L     + +   FA L  +  + V
Sbjct:  105 SSVGTQHSFSEE-ERFAFVNWINTALEKDPDCQHVLPMNPNTDSLFTSVGDGIVLCKMINLSAPDTIDERTI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGALDLKEGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANYHLE--NAGYKKINNFSSDIKDSKAYFHLLNQISPKGKDEGQPCIDINMAGFNEKDDLK-RAEAMLQQADRLGCRQFVTPTDVVNG-----NPKLNLAFVANLFNKYPALTKPENQDI----DWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYEKIKIPVDWNNKVNKPPYPKLGTNMKKLEN-CNYAVELGRSAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGDGDKVNDDIIVKWVNKTLADAEKSTKISSFKDKEISTSLSVLELIDAIQPGSVNYELIKTSSLSDADKLENAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV 622          
BLAST of Plastin-3 vs. Ensembl Medaka
Match: pls1 (plastin-1 [Source:NCBI gene;Acc:101168586])

HSP 1 Score: 175.252 bits (443), Expect = 5.244e-47
Identity = 138/498 (27.71%), Postives = 244/498 (49.00%), Query Frame = 3
Query:   42 DCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDI---YSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVS-VPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSF----SIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSK-------ERALYCISIARREGCPMFFTP 1481
            D EK  ++NWIN+ L    +    LP+NPN + LF  + DGI+ C +I    P +ID  VI TK +++  +  +NL LA  +A + GC VV +D + + +G    VL  LWQ+  VGL   I   +N +++ L  D E  + +  + PEE L R++NY +   N+   KI +F  ++ D   Y +L + +A    +  K  I        E + + R  L+L+    M  + F+    + +G       K++L   A LF+  P +   + ++     +   +E E+  EK  RN++N LGV+P   +++ D  DGL+I Q+M+ +   + +K      FS      +++ N  N   +LGK V+   +  +  E +  G+R     +++ LM  +   V  +    +K   + +L WVN+         +I++F+D LI+    +  +ID + P ++ WD ++  +  K       + A Y IS+AR+ G  ++  P
Sbjct:  158 DEEKVAFVNWINKALKNDPDCHHVLPMNPNDESLFSSLRDGILLCKMINFSQPDTIDERVINTK-KLTTFKMTENLILALNSASAIGCRVVNVDAHDLKAGKPHLVLGLLWQVIKVGLFADIELSKNEDLIALLEDGEKLEHLMSLSPEELLLRWVNYHLQ--NAKTQKIRNFSDDIKDSRAYFHLLNQLAIEEMLENKRGIRIDMGGLSEFNLERRAELMLQQAAKMDCRQFVSPRDITAG-----NSKLNLAFVANLFNMHPGLRGAKANK----GNWDSIEAETREEKTFRNWMNSLGVSPSVNHLYWDLCDGLVILQLMEKVKVPVNWKKVNNPPFSMLGGNMKKLEN-CNYAVQLGKNVAHFSLVGVGGENLNEGSRVHTLALVWQLMRRYTVMVLSDLGDGEKIGDQIILNWVNTTLGQKKKASQISNFKDKLISTSMPVFDLIDCIVPGAVKWDMVKKDARGKMSNEDKLDNAKYAISLARKIGARVYALP 642          
BLAST of Plastin-3 vs. Ensembl Medaka
Match: pls1 (plastin-1 [Source:NCBI gene;Acc:101168586])

HSP 1 Score: 174.481 bits (441), Expect = 5.385e-47
Identity = 138/498 (27.71%), Postives = 244/498 (49.00%), Query Frame = 3
Query:   42 DCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDI---YSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVS-VPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSF----SIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSK-------ERALYCISIARREGCPMFFTP 1481
            D EK  ++NWIN+ L    +    LP+NPN + LF  + DGI+ C +I    P +ID  VI TK +++  +  +NL LA  +A + GC VV +D + + +G    VL  LWQ+  VGL   I   +N +++ L  D E  + +  + PEE L R++NY +   N+   KI +F  ++ D   Y +L + +A    +  K  I        E + + R  L+L+    M  + F+    + +G       K++L   A LF+  P +   + ++     +   +E E+  EK  RN++N LGV+P   +++ D  DGL+I Q+M+ +   + +K      FS      +++ N  N   +LGK V+   +  +  E +  G+R     +++ LM  +   V  +    +K   + +L WVN+         +I++F+D LI+    +  +ID + P ++ WD ++  +  K       + A Y IS+AR+ G  ++  P
Sbjct:  121 DEEKVAFVNWINKALKNDPDCHHVLPMNPNDESLFSSLRDGILLCKMINFSQPDTIDERVINTK-KLTTFKMTENLILALNSASAIGCRVVNVDAHDLKAGKPHLVLGLLWQVIKVGLFADIELSKNEDLIALLEDGEKLEHLMSLSPEELLLRWVNYHLQ--NAKTQKIRNFSDDIKDSRAYFHLLNQLAIEEMLENKRGIRIDMGGLSEFNLERRAELMLQQAAKMDCRQFVSPRDITAG-----NSKLNLAFVANLFNMHPGLRGAKANK----GNWDSIEAETREEKTFRNWMNSLGVSPSVNHLYWDLCDGLVILQLMEKVKVPVNWKKVNNPPFSMLGGNMKKLEN-CNYAVQLGKNVAHFSLVGVGGENLNEGSRVHTLALVWQLMRRYTVMVLSDLGDGEKIGDQIILNWVNTTLGQKKKASQISNFKDKLISTSMPVFDLIDCIVPGAVKWDMVKKDARGKMSNEDKLDNAKYAISLARKIGARVYALP 605          
BLAST of Plastin-3 vs. Ensembl Medaka
Match: lcp1 (plastin-2 [Source:NCBI gene;Acc:101162720])

HSP 1 Score: 174.096 bits (440), Expect = 7.864e-47
Identity = 138/496 (27.82%), Postives = 239/496 (48.19%), Query Frame = 3
Query:   48 EKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLG----KFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDCE---ITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERAL----YCISIARREGCPMFFTP 1481
            EK  ++NWIN+ L    +    LP++P+SD+LF  + DGII C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    +  G +  VL  LWQ+  +GL   I    N  ++ L  D E  + + ++ PEE L R+ NY + +      KI++F  ++ D   Y  L + VA    +    A+  D+  I ++ D K R   +L+  D +  + F++   +  G       K++L   A LF+++P + + E   I    D   +E E+  E+  RN++N LGVNP   +++ D  D L+I Q+ + +   + +       + K     +++ N  N    LG    KF  V IA    + + +GNR L   +++ LM  +   +  +    +K     ++ WVN      E   I+SF+D  I+    +  +ID + P SI +D ++    ++E  L    Y IS+AR+ G  ++  P
Sbjct:  115 EKVAFVNWINKALEKDPDCKHVLPMDPDSDDLFTAMGDGIILCKMINLSVPDTIDERTI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIELSRNEALIALLRDGESLEDLMKLSPEELLLRWANYHLEEAGCG--KINNFSSDIKDSKAYYNLLNQVAPKGDEEGIAAIIVDMSGIREKEDLK-RAECMLDQADRLSCRQFVMPADVVRG-----NPKLNLAFVANLFNKYPALKKPENQDI----DWSSIEGETREERTFRNWMNSLGVNPRVNHLYADIDDALVIFQLYEKIKVPVNWDRVNKPPYPKLGSNMKKLEN-CNYAVELGKNEAKFSLVGIAG---QDLNAGNRTLTLALLWQLMRRYTLNILEDLGDGQKVTDDTIVSWVNDTLTHAEKNTISSFKDMSISSSMPVLDLIDAIQPGSIRYDLVKAEDLTEEEKLNNAKYAISMARKIGARVYALP 593          
BLAST of Plastin-3 vs. Ensembl Medaka
Match: pls3 (plastin-3 [Source:NCBI gene;Acc:101161915])

HSP 1 Score: 164.466 bits (415), Expect = 1.056e-43
Identity = 128/481 (26.61%), Postives = 233/481 (48.44%), Query Frame = 3
Query:    9 AEVNAIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVA----QHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIK-DFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYW---VYYEKNTEKKFDKKELLKWVNSFSIDCE----ITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTS 1415
            + V   + F ++ E+  ++NWIN  L    +    LP+NPN+D LF  + DGI+ C +I    P +ID   I  K +++     +NL LA  +A + GC+VV +    +  G    VL  LWQI  +GL   I    N  +  L  D E  + + ++ PEE L R+ NY +   N+   KI++F  ++ D   Y +L + ++          +  ++   N++ D K R   +L+  D +  + F+    + +G       K++L   A LF+++P +++ E   I    D   LE E+  E+  RN++N LGVNP   +++ D +D L+I Q+ + +   + + +   K  + K     +++ N  N    LG+     +  +  + +  GN  L   +++ LM  +   V  +     K +   ++KWVN    D E    I+SF+D  I+    + ++ID + P S++++ ++T S S
Sbjct:  105 SSVGTQHSFSEE-ERFAFVNWINTALEKDPDCQHVLPMNPNTDSLFTSVGDGIVLCKMINLSAPDTIDERTI-NKKKLTPFTIQENLNLALNSASAIGCHVVNIGALDLKEGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANYHLE--NAGYKKINNFSSDIKDSKAYFHLLNQISPKGKDEGQPCIDINMAGFNEKDDLK-RAEAMLQQADRLGCRQFVTPTDVVNG-----NPKLNLAFVANLFNKYPALTKPENQDI----DWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYEKIKIPVDWNNKVNKPPYPKLGTNMKKLEN-CNYAVELGRSAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGDGDKVNDDIIVKWVNKTLADAEKSTKISSFKDKEISTSLSVLELIDAIQPGSVNYELIKTSSLS 570          
BLAST of Plastin-3 vs. Planmine SMEST
Match: SMESG000078410.1 (SMESG000078410.1)

HSP 1 Score: 1085.48 bits (2806), Expect = 0.000e+0
Identity = 525/525 (100.00%), Postives = 525/525 (100.00%), Query Frame = 3
Query:    3 MPAEVNAIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYYEKNTEKKFDKKELLKWVNSFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAVKKYPQY 1577
            MPAEVNAIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYYEKNTEKKFDKKELLKWVNSFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAVKKYPQY
Sbjct:    1 MPAEVNAIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLFDSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMDSGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYYEKNTEKKFDKKELLKWVNSFSIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALLQNKSPQAVKKYPQY 525          
BLAST of Plastin-3 vs. Planmine SMEST
Match: SMESG000079216.1 (SMESG000079216.1)

HSP 1 Score: 221.861 bits (564), Expect = 2.472e-65
Identity = 153/516 (29.65%), Postives = 258/516 (50.00%), Query Frame = 3
Query:   21 AIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLF-----DSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFL-VENLMDSGCLDQACYKMHLLTAAVLFHRFPL-VSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYYEKNTEKKFDKKELLKWVNSF----SIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALL 1535
            ++Y  ++  EK V+  WIN  L   +    HLPI+P +DEL++ ++DG++   ++   FP SI    I +   ++R  K KN+ LA+ TA  YGCN+  ++I  +FSGV+  +LE +WQI  VG    ++ +  P+++LL+   E     + +   + + RYINY +S+   SG  + S+  N +DG +Y  L      +S   H+      D   I        +I + +  L+  K   FL  E  ++S     + +K H L     F  F L   E     I  +        E + EK  RNF+N  G+ P C ++  + ++ LL+ +++  +    F    FI  F +   VSERIHN A  +NR+ ++  +   NL+PEYI   ++  I +++  L+ +W+      +   + KEL  WVN      S   +I+SFRD  I  + + A ++D + P +I++D+++ +   KE   Y +SIARR G  +F  P      ++  + LAFA L
Sbjct:    9 SVYGPNEPLEKAVFAQWINHCLQNDKLTSHHLPISPGNDELYEKLSDGLVLIQLVNYHFPNSIHPRAIFSDIPITRRNKLKNIALAFITAICYGCNLDSINIYQVFSGVKTVILEMIWQIIKVGFTYEVNVINYPDLMLLRKQTESLYDFREVSASQLVLRYINYQLSRSGGSG-NVESYFDNFSDGNVYYNLVLKLFPNSSPLHARRGSSKDDKII-------VKIQMAMNILEENKANFFLKSEMFVNSLKNSMSVWKFHFLQFHWFFRNFRLEYHETVSKDIGNV--------EENKEKFLRNFLNSFGLEPFCNDLSANNRNSLLLMRLLMTIDRLGFRDRGFISVFDENYSVSERIHNAALILNRMDEY-KIKEDNLYPEYIAKSHKETIKNLLIKLLGWWL-----MKGNINVKELKNWVNKLMSTRSKPIKISSFRDIKIYRQYIFAIILDILEPKNINFDFLKCMDV-KEFTQYYVSIARRCGYLIFTIPEQFMACEYDFIVLAFATL 501          
BLAST of Plastin-3 vs. Planmine SMEST
Match: SMESG000079216.1 (SMESG000079216.1)

HSP 1 Score: 221.476 bits (563), Expect = 2.957e-65
Identity = 153/516 (29.65%), Postives = 258/516 (50.00%), Query Frame = 3
Query:   21 AIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLF-----DSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFL-VENLMDSGCLDQACYKMHLLTAAVLFHRFPL-VSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYYEKNTEKKFDKKELLKWVNSF----SIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALL 1535
            ++Y  ++  EK V+  WIN  L   +    HLPI+P +DEL++ ++DG++   ++   FP SI    I +   ++R  K KN+ LA+ TA  YGCN+  ++I  +FSGV+  +LE +WQI  VG    ++ +  P+++LL+   E     + +   + + RYINY +S+   SG  + S+  N +DG +Y  L      +S   H+      D   I        +I + +  L+  K   FL  E  ++S     + +K H L     F  F L   E     I  +        E + EK  RNF+N  G+ P C ++  + ++ LL+ +++  +    F    FI  F +   VSERIHN A  +NR+ ++  +   NL+PEYI   ++  I +++  L+ +W+      +   + KEL  WVN      S   +I+SFRD  I  + + A ++D + P +I++D+++ +   KE   Y +SIARR G  +F  P      ++  + LAFA L
Sbjct:   10 SVYGPNEPLEKAVFAQWINHCLQNDKLTSHHLPISPGNDELYEKLSDGLVLIQLVNYHFPNSIHPRAIFSDIPITRRNKLKNIALAFITAICYGCNLDSINIYQVFSGVKTVILEMIWQIIKVGFTYEVNVINYPDLMLLRKQTESLYDFREVSASQLVLRYINYQLSRSGGSG-NVESYFDNFSDGNVYYNLVLKLFPNSSPLHARRGSSKDDKII-------VKIQMAMNILEENKANFFLKSEMFVNSLKNSMSVWKFHFLQFHWFFRNFRLEYHETVSKDIGNV--------EENKEKFLRNFLNSFGLEPFCNDLSANNRNSLLLMRLLMTIDRLGFRDRGFISVFDENYSVSERIHNAALILNRMDEY-KIKEDNLYPEYIAKSHKETIKNLLIKLLGWWL-----MKGNINVKELKNWVNKLMSTRSKPIKISSFRDIKIYRQYIFAIILDILEPKNINFDFLKCMDV-KEFTQYYVSIARRCGYLIFTIPEQFMACEYDFIVLAFATL 502          
BLAST of Plastin-3 vs. Planmine SMEST
Match: SMESG000044168.1 (SMESG000044168.1)

HSP 1 Score: 219.935 bits (559), Expect = 1.120e-64
Identity = 154/516 (29.84%), Postives = 259/516 (50.19%), Query Frame = 3
Query:   21 AIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMY----VYLF-DSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFL-VENLMDSGCLDQACYKMHLLTAAVLFHRFPL-VSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYYEKNTEKKFDKKELLKWVNSF----SIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALL 1535
            ++Y  ++  EK V+  WIN  L   +    HLPI+P +DEL++ ++DG++   ++   FP SI    I     ++R  K KN+ LA+ TA  YGCN+  ++I  +FSGV+  +LE +WQI  VG    ++ +  P+++LL+   E     + +   + + RYINY +S+   SG  + S+  N +DG +Y    + LF +S   H+      D   I        +I + +  L+  K   FL  E  ++S     + +K H L     F  F L   E     I  +        E + EK  RNF+N  G+ P C ++  + ++ LL+ +++  +    F    FI  F +   VSERIHN A  +NR+ ++  +   NL+PEYI   ++  I +++  L+ +W+      +   + KEL  WVN      S   +I+SFRD  I  + + A ++D + P +I++D+++ +   KE   Y +SIARR G  +F  P      ++  + LAFA L
Sbjct:    9 SVYGPNEPLEKAVFAQWINHCLQNDKLTSHHLPISPGNDELYEKLSDGLVLIQLVNYHFPNSIHPRAIFYDIPITRRNKLKNIALAFITAICYGCNLDSINIYQVFSGVKTVILEMIWQIIKVGFTYEVNVINYPDLMLLRKQTESLYDFREVSASQLVLRYINYQLSRSGGSG-SVESYFDNFSDGNVYHNLVLKLFPNSSPLHARRGSSKDDKII-------VKIQMAMNILEENKANFFLKSEMFVNSLKNSMSVWKFHFLQFHWFFRNFRLEYHETVSKDIGNV--------EENKEKFLRNFLNSFGLEPFCNDLSANNRNSLLLMRLLMTIDRLGFRDRGFISVFDENYSVSERIHNAALILNRMDEY-KIKEDNLYPEYIAKSHKETIKNLLIKLLGWWL-----MKGNINVKELKNWVNKLMSTRSKPIKISSFRDIKIYRQYIFAIILDILEPKNINFDFLKCMDV-KEFTQYYVSIARRCGYLIFTIPEQFMACEYDFIVLAFATL 501          
BLAST of Plastin-3 vs. Planmine SMEST
Match: SMESG000044168.1 (SMESG000044168.1)

HSP 1 Score: 219.55 bits (558), Expect = 1.381e-64
Identity = 154/516 (29.84%), Postives = 259/516 (50.19%), Query Frame = 3
Query:   21 AIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDVINDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYGCNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDDEPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMY----VYLF-DSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFL-VENLMDSGCLDQACYKMHLLTAAVLFHRFPL-VSEIEKSQISQINDEIKLEQESHIEKLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDFSKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYNLMLYWVYYEKNTEKKFDKKELLKWVNSF----SIDCEITSFRDTLINDKRVLAKVIDKVFPNSIDWDYMETLSTSKERALYCISIARREGCPMFFTPFMLGIGDHRCLTLAFALL 1535
            ++Y  ++  EK V+  WIN  L   +    HLPI+P +DEL++ ++DG++   ++   FP SI    I     ++R  K KN+ LA+ TA  YGCN+  ++I  +FSGV+  +LE +WQI  VG    ++ +  P+++LL+   E     + +   + + RYINY +S+   SG  + S+  N +DG +Y    + LF +S   H+      D   I        +I + +  L+  K   FL  E  ++S     + +K H L     F  F L   E     I  +        E + EK  RNF+N  G+ P C ++  + ++ LL+ +++  +    F    FI  F +   VSERIHN A  +NR+ ++  +   NL+PEYI   ++  I +++  L+ +W+      +   + KEL  WVN      S   +I+SFRD  I  + + A ++D + P +I++D+++ +   KE   Y +SIARR G  +F  P      ++  + LAFA L
Sbjct:   10 SVYGPNEPLEKAVFAQWINHCLQNDKLTSHHLPISPGNDELYEKLSDGLVLIQLVNYHFPNSIHPRAIFYDIPITRRNKLKNIALAFITAICYGCNLDSINIYQVFSGVKTVILEMIWQIIKVGFTYEVNVINYPDLMLLRKQTESLYDFREVSASQLVLRYINYQLSRSGGSG-SVESYFDNFSDGNVYHNLVLKLFPNSSPLHARRGSSKDDKII-------VKIQMAMNILEENKANFFLKSEMFVNSLKNSMSVWKFHFLQFHWFFRNFRLEYHETVSKDIGNV--------EENKEKFLRNFLNSFGLEPFCNDLSANNRNSLLLMRLLMTIDRLGFRDRGFISVFDENYSVSERIHNAALILNRMDEY-KIKEDNLYPEYIAKSHKETIKNLLIKLLGWWL-----MKGNINVKELKNWVNKLMSTRSKPIKISSFRDIKIYRQYIFAIILDILEPKNINFDFLKCMDV-KEFTQYYVSIARRCGYLIFTIPEQFMACEYDFIVLAFATL 502          
The following BLAST results are available for this feature:
BLAST of Plastin-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLS32.053e-4626.15plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
PLS32.053e-4626.15plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
PLS11.576e-4428.49plastin 1 [Source:HGNC Symbol;Acc:HGNC:9090][more]
PLS11.576e-4428.49plastin 1 [Source:HGNC Symbol;Acc:HGNC:9090][more]
PLS11.576e-4428.49plastin 1 [Source:HGNC Symbol;Acc:HGNC:9090][more]
back to top
BLAST of Plastin-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
plst-11.420e-1921.76PLaSTin (Actin bundling protein) homolog [Source:... [more]
plst-12.284e-1921.83PLaSTin (Actin bundling protein) homolog [Source:... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Fim6.970e-4727.40gene:FBgn0024238 transcript:FBtr0074442[more]
Fim7.949e-4727.40gene:FBgn0024238 transcript:FBtr0074443[more]
Fim1.005e-4627.40gene:FBgn0024238 transcript:FBtr0074441[more]
back to top
BLAST of Plastin-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lcp14.597e-4725.54lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
pls38.555e-4426.72plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls38.555e-4426.72plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls13.103e-4023.95plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pls14.706e-4023.95plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
colgalt25.712e-4626.35collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
colgalt21.276e-4526.35collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
colgalt21.447e-4526.35collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
colgalt21.536e-4526.35collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
colgalt21.626e-4526.35collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lcp18.450e-4726.63lymphocyte cytosolic protein 1 [Source:MGI Symbol;... [more]
Lcp18.450e-4726.63lymphocyte cytosolic protein 1 [Source:MGI Symbol;... [more]
Lcp18.450e-4726.63lymphocyte cytosolic protein 1 [Source:MGI Symbol;... [more]
Pls33.671e-4626.15plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:1... [more]
Pls33.671e-4626.15plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Plastin-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P698|PLSL_DANRE1.354e-4625.54Plastin-2 OS=Danio rerio OX=7955 GN=lcp1 PE=2 SV=1[more]
sp|Q63598|PLST_RAT2.726e-4626.78Plastin-3 OS=Rattus norvegicus OX=10116 GN=Pls3 PE... [more]
sp|A7E3Q8|PLST_BOVIN5.503e-4626.40Plastin-3 OS=Bos taurus OX=9913 GN=PLS3 PE=2 SV=1[more]
sp|Q61233|PLSL_MOUSE5.911e-4626.63Plastin-2 OS=Mus musculus OX=10090 GN=Lcp1 PE=1 SV... [more]
sp|P13797|PLST_HUMAN9.858e-4626.15Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=... [more]
back to top
BLAST of Plastin-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4U8V1H93.426e-5829.16Uncharacterized protein OS=Steinernema carpocapsae... [more]
A0A1I8CM292.206e-5728.40Uncharacterized protein OS=Rhabditophanes sp. KR30... [more]
A0A0N4ZDI47.032e-5629.39Uncharacterized protein OS=Parastrongyloides trich... [more]
A0A0N5BSW32.081e-5528.72Uncharacterized protein OS=Strongyloides papillosu... [more]
T1EDU22.297e-5528.16Uncharacterized protein OS=Helobdella robusta OX=6... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lcp11.358e-4425.15lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
pls31.824e-4027.22plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls17.875e-2624.43plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lcp17.573e-1224.35lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SAC67.424e-3524.19Fimbrin, actin-bundling protein; cooperates with S... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO324844.297e-4024.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403822.408e-2922.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pls33.489e-4826.64plastin-3 [Source:NCBI gene;Acc:101161915][more]
pls15.244e-4727.71plastin-1 [Source:NCBI gene;Acc:101168586][more]
pls15.385e-4727.71plastin-1 [Source:NCBI gene;Acc:101168586][more]
lcp17.864e-4727.82plastin-2 [Source:NCBI gene;Acc:101162720][more]
pls31.056e-4326.61plastin-3 [Source:NCBI gene;Acc:101161915][more]
back to top
BLAST of Plastin-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078410.10.000e+0100.00SMESG000078410.1[more]
SMESG000079216.12.472e-6529.65SMESG000079216.1[more]
SMESG000079216.12.957e-6529.65SMESG000079216.1[more]
SMESG000044168.11.120e-6429.84SMESG000044168.1[more]
SMESG000044168.11.381e-6429.84SMESG000044168.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012175 ID=SMED30012175|Name=Plastin-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1652bp
TAATGCCAGCAGAAGTGAATGCAATTTATCAATTTCATGACGACTGTGAG
AAAAAAGTTTACATTAATTGGATTAATCGTAATCTTTTCATTCACGAAAA
TTTAGGACCTCATCTTCCTATCAATCCAAACAGCGATGAACTCTTTGATG
TTATAAATGATGGCATTATTTTTTGTTCAATTATAAAAACTCTATTTCCA
TATTCCATTGATTCGACAGTCATTATAACAAAAGCCGAAATGAGTAGAGA
AGAAAAATATAAAAACCTTCAATTAGCATATGAAACTGCTAGATCATATG
GTTGCAACGTCGTGGAACTCGACATTAATCATATTTTTAGTGGAGTTAGA
CAAAGTGTCCTAGAATTTCTTTGGCAGATATTTTTCGTTGGACTAGTTCA
ATGTATAAGTTATCTTGAAAATCCCGAAATTCTTTTATTAAAATCAGACG
ATGAACCAAAAGATGGGATAAAACGAATGAAACCCGAAGAGACTTTAACC
AGATACATAAATTATATGATATCCAAATACAATTCATCGGGACCAAAGAT
TTCCTCTTTTCAACAAAATTTAAATGATGGTTGCATGTATGTGTATCTTT
TTGACTCAGTAGCACAGCATAGCCATATAGCTTTGAAAAATGACATTTAT
TCAATTAATCAAGAACCAGATCCCAAAGATAGAATTTATTTATTGTTGGA
AAATCTAGACTGTATGAAAGTTCAAGCATTTCTCGTTGAGAACCTGATGG
ACTCGGGATGTCTTGATCAGGCATGCTATAAAATGCATTTATTAACGGCT
GCTGTGTTGTTTCACAGATTTCCTCTCGTTTCCGAAATTGAAAAAAGTCA
AATCAGTCAAATAAATGACGAAATCAAACTAGAACAAGAAAGTCACATTG
AGAAATTATGTCGCAATTTTATAAACTTTCTTGGAGTAAATCCGATTTGC
ACGAATATCCATCACGACTGTAAAGATGGTCTACTTATCGCTCAGATTAT
GGACATTCTGTCGAATGACATTTTCTATAAAGACACTTTTATTAAGGATT
TCAGTAAACAGCAAATTGTATCCGAAAGAATCCACAATGGAGCAAATTGC
ATTAACAGATTAGGCAAGTTCGTTAGCGTTCCCATAGCCAACCTCCATCC
CGAATATATCCAATCTGGAAACCGCGCTCTGATTTCAGATATTATCTATA
ATTTGATGCTTTATTGGGTTTATTATGAAAAGAATACCGAGAAAAAATTT
GATAAAAAAGAATTGCTAAAATGGGTTAATAGTTTCAGCATTGACTGCGA
AATAACTTCATTCCGTGACACATTGATAAATGACAAAAGAGTTTTAGCAA
AAGTGATTGACAAGGTTTTTCCTAATTCAATAGATTGGGATTATATGGAA
ACTTTGTCAACAAGTAAGGAAAGAGCTTTATATTGCATTTCTATAGCGAG
ACGCGAAGGTTGTCCAATGTTTTTCACTCCGTTTATGCTTGGAATAGGGG
ATCACCGATGTTTAACATTGGCATTTGCGTTATTACAAAATAAATCTCCG
CAGGCAGTGAAAAAATATCCGCAATATTGACATTAATTATTTTCCATGAC
TTTTTATACAAATTGCTTAATTTTAAACAACAACCCAAAATTTGTTTGCA
AT
back to top

protein sequence of SMED30012175-orf-1

>SMED30012175-orf-1 ID=SMED30012175-orf-1|Name=SMED30012175-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=526bp
MPAEVNAIYQFHDDCEKKVYINWINRNLFIHENLGPHLPINPNSDELFDV
INDGIIFCSIIKTLFPYSIDSTVIITKAEMSREEKYKNLQLAYETARSYG
CNVVELDINHIFSGVRQSVLEFLWQIFFVGLVQCISYLENPEILLLKSDD
EPKDGIKRMKPEETLTRYINYMISKYNSSGPKISSFQQNLNDGCMYVYLF
DSVAQHSHIALKNDIYSINQEPDPKDRIYLLLENLDCMKVQAFLVENLMD
SGCLDQACYKMHLLTAAVLFHRFPLVSEIEKSQISQINDEIKLEQESHIE
KLCRNFINFLGVNPICTNIHHDCKDGLLIAQIMDILSNDIFYKDTFIKDF
SKQQIVSERIHNGANCINRLGKFVSVPIANLHPEYIQSGNRALISDIIYN
LMLYWVYYEKNTEKKFDKKELLKWVNSFSIDCEITSFRDTLINDKRVLAK
VIDKVFPNSIDWDYMETLSTSKERALYCISIARREGCPMFFTPFMLGIGD
HRCLTLAFALLQNKSPQAVKKYPQY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0046872metal ion binding
GO:0051015actin filament binding
GO:0005515protein binding
GO:0003779actin binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0051017actin filament bundle assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR039959Fimbrin/Plastin
IPR001715CH-domain
IPR001589Actinin_actin-bd_CS
IPR003306WIF
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 299..404
e-value: 0.005
score: 26.0
coord: 16..129
e-value: 6.6E-11
score: 52.2
coord: 417..510
e-value: 0.061
score: 19.8
IPR001715Calponin homology domainPFAMPF00307CHcoord: 15..127
e-value: 1.3E-14
score: 54.3
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 14..131
score: 17.972
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 159..274
score: 11.015
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 297..406
score: 10.592
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 415..515
score: 10.98
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 409..509
e-value: 3.8E-11
score: 45.0
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 284..408
e-value: 2.1E-10
score: 42.6
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 11..133
e-value: 7.8E-23
score: 82.7
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 134..270
e-value: 6.0E-11
score: 44.4
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 14..509
IPR039959Fimbrin/PlastinPANTHERPTHR19961FIMBRIN/PLASTINcoord: 14..493
NoneNo IPR availablePANTHERPTHR19961:SF18FI19014P1coord: 14..493
IPR001589Actinin-type actin-binding domain, conserved sitePROSITEPS00019ACTININ_1coord: 16..25