Armadillo type fold

Overview
NameArmadillo type fold
Smed IDSMED30012166
Length (bp)2632
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Armadillo type fold (SMED30012166) t-SNE clustered cells

Violin plots show distribution of expression levels for Armadillo type fold (SMED30012166) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012166

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012166SMESG000066226.1 Contig2749newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012166SMESG000066226.1 Contig2749uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012166SMESG000081167.1 Contig2749newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012166SMESG000081167.1 Contig2749uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Armadillo type fold vs. TrEMBL
Match: A0A2G8K710 (Uncharacterized protein OS=Stichopus japonicus OX=307972 GN=BSL78_19410 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.574e-60
Identity = 112/285 (39.30%), Postives = 171/285 (60.00%), Query Frame = 2
Query:  641 KSLEAWMKCLEEIIKGLGVGFEKVVDDEMFDGVFEAVIHGNRFIRETGFYLL-------GHAAENHGCSNSRKIFLKMCESFRK----GMGDNWSQVRMSASVATRKILTVAKPPDVDINEIHSLLLPGICMNRYYLAEGVRLYNQETWKK---------------ETVSYYIEQSFSDNYAVRETACSCMSEIALKLNKNYVQPYFTRILDALLRCLNDKNWSVRDMACLTLGRLISRFPSETKKYREDAMIPLFYSHVTDKVICGRESGAFTISSIVAAFDHK 1417
            K+LE WM+CL+ +++G G GF   +D ++ D VF  + H NRF+RETG+Y+        G   EN     S    LK  + F +    G+ DNWSQVR++ASVATR+ LT   P +   +E   +L+P +C+NRYY+AEGV++Y QETW++               E V++Y+EQS +DN+AVRE AC+C++E+  K++K  V+PY  R+L ALL C  D +W VRD AC+  G  I  FP E   Y E  ++PLF+ ++ D ++  R+  A ++  +   + ++
Sbjct:  182 KNLETWMRCLQAVVEGCGPGFLSFIDQDLLDLVFGTLTHTNRFVRETGYYVCAAIVSCNGREGENVSTDLSENTILKYGQDFSQHFANGLADNWSQVRLAASVATRQFLT-NMPSEESRHEFFGILVPRLCLNRYYVAEGVKIYCQETWRQIVGEQGKALVEKYIEEVVNFYVEQSDADNHAVREAACACIAELGSKIDKEKVRPYVQRLLMALLICFEDDSWPVRDAACVACGNFILCFPEEASSYMEK-LLPLFFGNLEDNILSVRQGAAISLGKVANVYGNE 464          
BLAST of Armadillo type fold vs. TrEMBL
Match: A0A2C9KVE5 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106071150 PE=4 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.989e-60
Identity = 118/292 (40.41%), Postives = 172/292 (58.90%), Query Frame = 2
Query:  641 KSLEAWMKCLEEIIKGLGVGFEKVVDDEMFDGVFEAVIHGNRFIRETGFYLLG-----------------HAAENHGCSNSRKIFLKMCESFRKGMGDNWSQVRMSASVATRKILTVAKPPDVDINEIHSLLLPGICMNRYYLAEGVRLYNQETWKK---------------ETVSYYIEQSFSDNYAVRETACSCMSEIALKLNKNYVQPYFTRILDALLRCLNDKNWSVRDMACLTLGRLISRFPSETKKYREDAMIPLFYSHVTDKVICGRESGAFTISSIVAAFDHKE 1420
            KSLE +MKCL+ +I G G  F   VD E+ D +FEA++H NRF+RETGFY+ G                    E +      K+F    E   +G+ DNWSQVRM+ASVATR+ LT + P +    + + +L+P +C+NRYY+AEGVRLY+QETW++               + V YYI  + SDN+AVRE AC+C++E+  K++K+ V  Y +++L+ LL C ND +W VRD AC+  G  +  FP E+K     A+ PLF++++ D +   R   A  I++IV A+   E
Sbjct:   84 KSLETYMKCLQSVILGCGYRFNDFVDQELLDLIFEALMHTNRFVRETGFYVCGALVTCGAKEGSETDSEAKLTEENAIYRHGKVF---SEYLGRGVADNWSQVRMAASVATRQFLT-SLPTEEAREKFYPILIPRMCLNRYYMAEGVRLYSQETWRQITKGEGKHLVEKYIDQVVDYYILATDSDNHAVREAACACIAELGSKIDKSAVSSYVSKLLETLLVCFNDDSWPVRDAACIACGHFVLCFPQESKSSLP-ALFPLFFNNLQDNIPSVRHGAAVAITNIVKAYGPAE 370          
BLAST of Armadillo type fold vs. TrEMBL
Match: A0A4Z2DVY5 (Armadillo type fold (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_003415 PE=4 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 2.086e-60
Identity = 114/280 (40.71%), Postives = 169/280 (60.36%), Query Frame = 2
Query:  641 KSLEAWMKCLEEIIKGLGVG-FEKVVDDEMFDGVFEAVIHGNRFIRETGFYLLGHAAENHGC----SNSRKIFLKMCESFRKGMGDNWSQVRMSASVATRKILTVAKPPDVDINEIHSLLLPGICMNRYYLAEGVRLYNQETWKKET---------------VSYYIEQSFSDNYAVRETACSCMSEIALKLNKNYVQPYFTRILDALLRCLNDKNWSVRDMACLTLGRLISRFPSETKKYR-EDAMIPLFYSHVTDKVICGRESGAFTISSIVAAFDHK 1417
            K+LE WMKCL+E++  +    F KV    + + +F+AV H NRF+RETG+ +L      H C     +    ++ +     KG+ DNWSQVRM+AS A R +  V  PP    + I+ +LLP +C+NRYY+AEGVR+Y+Q+TW + T               V YYIEQS +DN+AVRE +C+ ++EI  KL+ N + P   ++LDAL  C  D++W VRD AC+ LG LIS FP+ET+    +D M P F  +++D +   R+  A +I++I+ A D +
Sbjct:  122 KNLETWMKCLQEMVSNISADDFIKVDRSVILELIFKAVQHINRFVRETGYDVLSTMISRHICYTGPDSKDATYINVAIQLAKGLSDNWSQVRMAASRAVRTVFEVDPPPGYTRDNIYPILLPAMCLNRYYVAEGVRIYSQDTWCRVTQGEGRKLLSQNLIPAVDYYIEQSDADNHAVREASCAAIAEIVTKLDSNLLLPCVNKLLDALTICFGDESWPVRDAACVALGSLISIFPNETRAAGYDDLMAPQFLRNLSDSIPSVRDGAAKSIAAILKAVDDQ 401          
BLAST of Armadillo type fold vs. TrEMBL
Match: A0A5K3F076 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 2.511e-60
Identity = 121/351 (34.47%), Postives = 191/351 (54.42%), Query Frame = 2
Query:  455 IGIIIRIFPSLRKLYEKNIINEQYFFHKLKTSFHFTNCDNQIFVKPMNFRFSNS*VVIVENS---KSLEAWMKCLEEIIKGLGVG-FEKVVDDEMFDGVFEAVIHGNRFIRETGFYLLGHAAENHGCSNSRK---------IFLKMCESFRKGMGDNWSQVRMSASVATRKILTVAKPPDVDINEIHSLLLPGICMNRYYLAEGVRLYNQETW---------------KKETVSYYIEQSFSDNYAVRETACSCMSEIALKLNKNYVQPYFTRILDALLRCLNDKNWSVRDMACLTLGRLISRFPSETKKYR-EDAMIPLFYSHVTDKVICGRESGAFTISSIVAAFDHKE 1420
            + + +R  P ++   E+N+  +     K +             V   N   S S + +  ++   K+LE WMKCL   I GLG   F+   D E+   VF+AV H NRF+RETG+ +LG   ENHGC  + K          ++ + +  R G+GDNWS+VRM+A   TR + +   PP     +++ +LLP +C+NRYY+AEGV++Y+Q TW                + T+ YY+EQS +DN+A+RE AC+CM+E+ +KL  + ++P+  R+L  L+ C  D++W VRD AC+ LG L+S  P+ET+     D M   F  ++ D +   RE  A +I+ ++   +  E
Sbjct:   33 VDVFLRFLPRIKMGIEENLNRDSLCPAKEQEEAQ----KELDLVTDTNPNLSKSSLTLFHDTAGWKNLETWMKCLHFCICGLGSERFKTFRDPEILSIVFKAVNHTNRFVRETGYDVLGTIIENHGCEGTNKRADGESSVSDYVLVAQQLRTGLGDNWSRVRMAALKTTRLLFSTPPPPGQRREDVYPILLPPLCLNRYYVAEGVKVYSQNTWCEVTGGRGREIVNSILEPTLDYYVEQSRTDNHAIREAACTCMAEVGIKLPLDSLRPHLKRLLQTLVTCFQDESWPVRDAACIALGNLVSVLPAETRAAGYTDLMAERFLHNLVDCIPSVREGAAASIAKVLQGANDPE 379          
BLAST of Armadillo type fold vs. TrEMBL
Match: V4AKU4 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_232463 PE=4 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 1.008e-59
Identity = 117/285 (41.05%), Postives = 168/285 (58.95%), Query Frame = 2
Query:  641 KSLEAWMKCLEEIIKGLGVGFEKVVDDEMFDGVFEAVIHGNRFIRETGFYLLG-----------HAAENHGCSNSRKIFL---KMCESFRKGMGDNWSQVRMSASVATRKILTVAKPPDVDINEIHSLLLPGICMNRYYLAEGVRLYNQETWKKET---------------VSYYIEQSFSDNYAVRETACSCMSEIALKLNKNYVQPYFTRILDALLRCLNDKNWSVRDMACLTLGRLISRFPSETKKYREDAMIPLFYSHVTDKVICGRESGAFTISSIVAAF 1408
            KSLE WMKCL+ +I G G  F K VD E+ D +F ++ H NRF+RETG+Y+              A E         I+    +  E   KG+ DNWSQVR++ SVATRK L+ + P D    + +  LLP +C+NRYY+AEGVR+Y+Q+TWK  T               V YYI+QS +DN+AVRE AC+C++E+ LK  K  V PY +++LDAL+ C ND +W VRD AC+  G  I  FP E++     A+ PLF++++ D +   R+  A  ++++  A+
Sbjct:  186 KSLETWMKCLQNVINGCGYSFNKFVDQELLDLIFSSLTHTNRFVRETGYYVCSSLVACGFNDQVKADEGINKLEENAIYQHGEQFAEYLGKGLSDNWSQVRLAGSVATRKFLS-SLPSDEIREKYYPDLLPRMCLNRYYVAEGVRIYSQDTWKTITHGEGRNLVERHIGAVVDYYIKQSDADNHAVREAACACIAELGLKAKKEVVSPYISQLLDALIICFNDDSWPVRDAACVACGNFIKCFPDESRSCMP-ALYPLFFTNLQDSISSVRQGAALALTNVFKAY 468          
BLAST of Armadillo type fold vs. Ensembl Nematostella
Match: EDO29281 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T431])

HSP 1 Score: 107.071 bits (266), Expect = 6.656e-24
Identity = 44/117 (37.61%), Postives = 77/117 (65.81%), Query Frame = 2
Query: 1067 VSYYIEQSFSDNYAVRETACSCMSEIALKLNKNYVQPYFTRILDALLRCLNDKNWSVRDMACLTLGRLISRFPSETKKYREDAMIPLFYSHVTDKVICGRESGAFTISSIVAAFDHK 1417
            V +Y+ Q+ +DN+AVRE AC+C++E+ LK++ +Y +P+   +LDAL+ C  D +W VRD AC+  G  I  FP+E +    D + PLF++++ DK+   R+  A  + ++V A+ ++
Sbjct:  272 VEFYVSQTKADNHAVREAACACIAELGLKVSADYTRPHVQSLLDALIICFMDDSWPVRDAACVACGNFIQSFPNECQPKMPD-LYPLFFTNLEDKIPSVRQGAAIALGNVVKAYGNE 387          

HSP 2 Score: 60.077 bits (144), Expect = 3.065e-9
Identity = 56/219 (25.57%), Postives = 89/219 (40.64%), Query Frame = 2
Query:  641 KSLEAWMKCLEEIIKGLGVGFEKVVDDEMFDGVFEAVIHGNRFIRETGFYLLGHAAENHGCSNSRKIFLKMCESFRKGMGDNWSQVRMSASVATRKILTVAKPPDVDINEIHSLLLPGICMNRYYLAEGVRLYNQETWKKETVSYYIEQSFSDNYAVRETACSCMSEIALKLNKNYVQPYFTRILDALLRCLNDKNWSVRDMACLTLGRLISRFPSETK 1297
            K LE  M+CL+ +I+G G  F + +  ++ D +F+A+ H NRF+RETG+ L G           ++ FL++     +   DN + VR  A+ A    L +    D     + SLL                               I     D++ VR+ AC       ++   N  QP    +       L DK  SVR  A + LG ++  + +E K
Sbjct:  205 KHLETSMRCLQSVIEGCGEEFNEHITQDLLDLIFQALNHTNRFVRETGYQLCGSLVS---LGRIQEFFLQVEFYVSQTKADNHA-VR-EAACACIAELGLKVSADYTRPHVQSLL----------------------------DALIICFMDDSWPVRDAACVACGNF-IQSFPNECQPKMPDLYPLFFTNLEDKIPSVRQGAAIALGNVVKAYGNEAK 389          
BLAST of Armadillo type fold vs. Planmine SMEST
Match: SMESG000066226.1 (SMESG000066226.1)

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 279/305 (91.48%), Postives = 280/305 (91.80%), Query Frame = 2
Query:  596 NFRFSN---S*VVIVENSKSLEAWMKCLEEIIKGLGVGFEKVVDDEMFDGVFEAVIHGNRFIRETGFYLLGHAAENHGCSNSRKIFLKMCESFRKGMGDNWSQVRMSASVATRKILTVAKPPDVDINEIHSLLLPGICMNRYYLAEGVRLYNQETWK---------------KETVSYYIEQSFSDNYAVRETACSCMSEIALKLNKNYVQPYFTRILDALLRCLNDKNWSVRDMACLTLGRLISRFPSETKKYREDAMIPLFYSHVTDKVICGRESGAFTISSIVAAFDHKETSYLK-VGLFIL 1453
            N R SN   S VVIVENSKSLEAWMKCLEEIIKGLGVGFEKVVDDEMFDGVFEAVIHGNRFIRETGFYLLGHAAENHGCSNSRKIFLKMCESFRKGMGDNWSQVRMSASVATRKILTVAKPPDVDINEIHSLLLPGICMNRYYLAEGVRLYNQETWK               +ETVSYYIEQSFSDNYAVRETACSCMSEIALKLNKNYVQPYFTRILDALLRCLNDKNWSVRDMACLTLGRLIS FPSETKKYREDAMIPLFYSHVTDKVICGRESGAFTISSIVAAFDHKETSYLK V  FIL
Sbjct:  138 NLRESNEADSSVVIVENSKSLEAWMKCLEEIIKGLGVGFEKVVDDEMFDGVFEAVIHGNRFIRETGFYLLGHAAENHGCSNSRKIFLKMCESFRKGMGDNWSQVRMSASVATRKILTVAKPPDVDINEIHSLLLPGICMNRYYLAEGVRLYNQETWKSVFKDRGRELLENHLEETVSYYIEQSFSDNYAVRETACSCMSEIALKLNKNYVQPYFTRILDALLRCLNDKNWSVRDMACLTLGRLISCFPSETKKYREDAMIPLFYSHVTDKVICGRESGAFTISSIVAAFDHKETSYLKNVVDFIL 442          
The following BLAST results are available for this feature:
BLAST of Armadillo type fold vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G8K7101.574e-6039.30Uncharacterized protein OS=Stichopus japonicus OX=... [more]
A0A2C9KVE51.989e-6040.41Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A4Z2DVY52.086e-6040.71Armadillo type fold (Fragment) OS=Schistosoma japo... [more]
A0A5K3F0762.511e-6034.47Uncharacterized protein OS=Mesocestoides corti OX=... [more]
V4AKU41.008e-5941.05Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Armadillo type fold vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO292816.656e-2437.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Armadillo type fold vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo type fold vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000066226.10.000e+091.48SMESG000066226.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012166 ID=SMED30012166|Name=Armadillo type fold|organism=Schmidtea mediterranea sexual|type=transcript|length=2632bp
AAATGGGTTAGGTTTGACAAAGATTAGTACCACATAATTTCAAAAACGCA
TAACAAAAAATTGACTGTAATAAATATAATTAAAAAATTATGGATTGACC
TAACCAATGCGAAAGACTTGTTTCGGTAATCAATGGGTGCCACGATGTCT
AACGAATTAATAATGAACGCTACATTGAAACAATTTGCTAAAGACAGGTT
TAACTAAATATAACTTGGTACGTATCATAAATTTATTTATAAGATTTCAA
ATAAACTTAAATATATTTGAGGCAATCAGTATATATTCAACATTACCGAA
TATTTATTTTATTCGCAATAATCAACTCAAGTGACAGTTTAGAATGTGAG
ATTACAATAAATGAATTACAAACATTTATATCACTAAAATACTTTATTTT
TTGATCACCTTTAATTTCTTATCTTTTTTTGATGATATTTCATTCCTTTT
CAAAATCGGAATTATTATCAGAATTTTTCCAAGTCTAAGAAAGTTGTATG
AAAAAAACATCATAAATGAACAATATTTTTTTCACAAATTGAAAACTTCA
TTCCATTTCACAAACTGTGATAACCAAATATTCGTAAAACCTATGAACTT
TAGATTTTCAAATTCTTAGGTTGTTATTGTTGAAAATTCCAAATCCCTGG
AAGCTTGGATGAAATGTCTTGAGGAAATTATCAAAGGTTTGGGTGTGGGA
TTTGAGAAAGTGGTTGATGATGAAATGTTTGATGGAGTTTTTGAGGCAGT
TATACACGGAAATCGTTTTATAAGGGAGACAGGATTTTATTTATTAGGTC
ATGCTGCTGAAAATCATGGCTGTAGTAATAGTCGAAAGATTTTCCTTAAA
ATGTGTGAAAGTTTTCGTAAAGGCATGGGTGACAATTGGAGTCAAGTTCG
TATGTCTGCTTCAGTGGCAACTCGTAAAATTTTAACTGTTGCAAAACCTC
CTGATGTAGACATTAATGAAATCCATTCACTATTATTGCCTGGAATCTGC
ATGAATAGATATTATTTAGCTGAAGGTGTAAGACTTTACAATCAGGAAAC
CTGGAAAAAAGAAACCGTATCTTACTATATTGAGCAAAGTTTTTCTGATA
ATTATGCTGTTAGAGAAACTGCATGTTCATGTATGTCTGAAATTGCACTC
AAATTGAATAAGAATTATGTCCAACCTTATTTTACCAGAATTTTGGATGC
ACTATTGAGATGTTTAAATGATAAAAACTGGTCTGTTCGCGATATGGCCT
GTTTGACTTTGGGACGTCTTATATCTCGCTTCCCATCGGAGACCAAAAAA
TATCGCGAAGACGCAATGATTCCACTGTTTTACTCTCATGTTACTGATAA
GGTTATTTGCGGACGAGAAAGTGGAGCGTTTACTATATCCAGTATAGTTG
CTGCTTTCGATCACAAAGAAACGTCTTATTTGAAAGTAGGTTTATTTATT
TTATTTGTGATATTTTAGCATCATTATCTTATTTTAAATTAAATATTTAT
TTTATCCATCAGATTTGATTGATAAATATAGTTTAATTTATATTTATATT
AATTTTTTGAGAATTCGATATGCATTTCAAAAATTTTCTTCAATAATTCA
ACTTATGACACTAATGCGAAGTTTCATATACACTACAAATCAAAACTGAA
CTGTTGGTAATTGGAAATTTATTTGAATTATTCTGTTGAAACTGTTGACG
TTATTCTTGTCTGACATTTTCTGTTTTTGTTGAACTTCTCATTTTTTTCT
GGATATGCAAACAAACTTTTTCATATTTTAAACTTTATATATATATTGAT
ATGTTGTCAATAATTATAGATATTGATAAAATTCTTCTATATTATAATTA
TAATTGAATTTCATGACCAGTACAGACATAATAACTGCATTTTTGGAATA
TATCTTTGCATCAGTTTAACCTTTTAATGACAATTGGATGTAATTAAAAG
TTTTATTAGGTTAACCGATATAATCCTGTTACTTTATTTGATAAAGAATA
ACCAAATCTAGTGGTATAATATTAGTTCGGTAAACCAATATAACTTTTCA
GAGACATCTAATAGATTCATTGGCGCTGGTTGAAATTTTCAGTATTTTTC
CTCTATATCAATTCATTGAACTTACAAGAACAACACTGATGGTGGGTTTC
ATATTGAGTCAGAGAAAATAAACTCCAAAATGCACAAAGAATATATTTTC
AAAATACCACACAATAAACTTTTGATTAGTTAAAACAAAGTTTTTAAAGG
ACTAAAAGAACATAATTTATAGCAAGTATAAGTTCAATACGCTGCCACAT
ACATACAATCCACCAGTTTGGCCACAAATTAAGGTTTACTATAAGAAACA
ATTAATTTACATAGAAAAAATATAAAGACAAAAATTATGAGCAATGACAT
CTATTAAATAAATTTAAAATAGAAGATGCAGAAAAAGATTTAGGTGAGAA
AAAATAAATACAAACACATTCAAAACACACGGCAACTTTTTACATCAAGG
ACCAATTAATAGGATATTTTAGAACATTAAAATTGTGCCTGAAATTATAT
AAATGCTTTTTAAGGTAAGTTTTTTTGGCTTATGTAAAATATTGATGAAA
ATTTATTAAAAGATAAATTTTCATATCTTTTC
back to top

protein sequence of SMED30012166-orf-1

>SMED30012166-orf-1 ID=SMED30012166-orf-1|Name=SMED30012166-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=270bp
MKCLEEIIKGLGVGFEKVVDDEMFDGVFEAVIHGNRFIRETGFYLLGHAA
ENHGCSNSRKIFLKMCESFRKGMGDNWSQVRMSASVATRKILTVAKPPDV
DINEIHSLLLPGICMNRYYLAEGVRLYNQETWKKETVSYYIEQSFSDNYA
VRETACSCMSEIALKLNKNYVQPYFTRILDALLRCLNDKNWSVRDMACLT
LGRLISRFPSETKKYREDAMIPLFYSHVTDKVICGRESGAFTISSIVAAF
DHKETSYLKVGLFILFVIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006606protein import into nucleus
GO:0016310phosphorylation
GO:0032957inositol trisphosphate metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR040122Importin_beta
IPR000357HEAT
IPR011989ARM-like
IPR001849PH_domain
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
GO:0000287magnesium ion binding
GO:0005524ATP binding
GO:0016301kinase activity
GO:0047325inositol tetrakisphosphate 1-kinase activity
GO:0052725inositol-1,3,4-trisphosphate 6-kinase activity
GO:0052726inositol-1,3,4-trisphosphate 5-kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000357HEAT repeatPFAMPF02985HEATcoord: 178..207
e-value: 8.1E-8
score: 31.9
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 130..254
e-value: 1.4E-10
score: 43.1
NoneNo IPR availablePANTHERPTHR10527:SF32coord: 1..250
IPR040122Importin beta familyPANTHERPTHR10527IMPORTIN BETAcoord: 1..250
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 2..259