Lysine-specific demethylase 5A

Overview
NameLysine-specific demethylase 5A
Smed IDSMED30012152
Length (bp)7617
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lysine-specific demethylase 5A (SMED30012152) t-SNE clustered cells

Violin plots show distribution of expression levels for Lysine-specific demethylase 5A (SMED30012152) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lysine-specific demethylase 5A (SMED30012152) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lysine-specific demethylase 5A (SMED30012152) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012152

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30012152h1SMcG0019561 SmedASXL_081749SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012152h1SMcG0019561 SmedASXL_012601SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30012152h1SMcG0019561 dd_Smed_v4_4933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012152h1SMcG0019561 dd_Smed_v4_4933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012152h1SMcG0019561 dd_Smed_v4_4933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012152h1SMcG0019561 dd_Smed_v4_4933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012152h1SMcG0019561 dd_Smed_v4_4933_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lysine-specific demethylase 5A vs. Ensembl Human
Match: KDM5B (lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC:18039])

HSP 1 Score: 585.489 bits (1508), Expect = 8.383e-176
Identity = 305/713 (42.78%), Postives = 436/713 (61.15%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINK------NPDLFPE-NIQPKTMKYKTALTLESPKMTRSKAL---IVQKPV--------NE------------------LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            F  PP  PVF P+ +EF DP  +I KIRP+A++ GICK+  P  W PPFA D     F PR+QRLNE+ A +R+K NF+  I  +WE Q + L+IP V+   LDLF+L+  V + GG   V K+++WT I  ++G+    K + S +R ++E+I+ PY     N+F++       N  + PE   + +T   +  +   +PK    K +   I Q+P+        NE                  +C +C S      ++ C  CD  YH  C+ PPL DVPK  W C +CL   C K       E FGF Q+   Y+L +F   AD FK  YFN   ++   E VE+E+WRLV+   + +DV V+YGADI+S    SGFP R  +   + ++++Y+DSGWNLNN+PV+++S+   ++ DI GM +PW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ E++M++ A ELF   PDLLH + T +NP  L+ +++ VYRT+Q AGEFV+TFPRAYH+GFNQGFNFAEAVNFC  DWL  GR  VE YRL+ R  VFSH+E+ICKMAS  + LD+++   V  +M I+ ++EK  R+ +  +  GV  +ER+  + +P+D+R+C+ C+TT ++S ++CS  C+  L   + CL HV +LCSC   +   L+YRY+LD++  +++ +  + E Y  W   V
Sbjct:   26 FLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLNFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFA-PGKAVGSHIRGHYERILNPY-----NLFLSGDSLRAMNIKIEPEETTEARTHNLRRRMGCPTPKCENEKEMKSSIKQEPIERKDYIVENEKEKPKSRSKKATNAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQECSKP-----QEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVS--TIEEDVTVEYGADIASKEFGSGFPVRDGKIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKL--GVIDSERMDFELLPDDERQCVKCKTTCFMSAISCS--CKPGL---LVCLHHVKELCSCPPYK-YKLRYRYTLDDLYPMMNALKLRAESYNEWALNV 717          

HSP 2 Score: 68.5514 bits (166), Expect = 2.038e-10
Identity = 72/309 (23.30%), Postives = 129/309 (41.75%), Query Frame = 1
Query: 3253 QKLQQCRRLVHVEEMQTLIKQADSLCVAFDRLSDLKSLFRTIDAWKKNLHGLFIKNSHNSYLTTPTLLEVLFPRPQRQFKLMIAREAVSSKLVDDCKTESTMKESSVKDEPESCDEEKQTDDQKSIKTNRSCRKSRGRQKRSSLAPDDPQIARLDNVVVFESHLRSGYVGESEFNGNYKKMCVNELEWMWNLRELNEDKASKDSSGHDF-YCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFS 4176
            + LQ   R+  ++ +  L+ +  S+ V  + L  L++L   + AWK+     F+   ++ Y    +LLEVL PR                 L+   + +  +KE     + +S   E  +D ++++        +  ++  S++A             + E+ LR                   E+E + +LR  NE K        D   C C+K         + C+LC+D FH SC+ + +     + +LCP C RS++PP E IL     L++    +++PE  AL  M +R +N+      L S
Sbjct:  980 EGLQAGGRVPVLDTLIELVTRGRSIPVHLNSLPRLETLVAEVQAWKECAVNTFL-TENSPY----SLLEVLCPR-------------CDIGLLGLKRKQRKLKEPLPNGKKKSTKLESLSDLERAL--------TESKETASAMA------------TLGEARLR-------------------EMEALQSLRLANEGKLLSPLQDVDIKICLCQKA---PAAPMIQCELCRDAFHTSCVAVPSISQGLRIWLCPHCRRSEKPPLEKILPLLASLQR--IRVRLPEGDALRYMIERTVNWQHRAQQLLS 1226          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Human
Match: KDM5C (lysine demethylase 5C [Source:HGNC Symbol;Acc:HGNC:11114])

HSP 1 Score: 452.595 bits (1163), Expect = 1.745e-131
Identity = 219/467 (46.90%), Postives = 305/467 (65.31%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            +C++C        ++ C  CD  YHI C+ PPL ++PK  W C +C+   C++       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV   ++ +DV V+YGADI S    SGFP   ++     ++++Y  SGWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE  E++M++   ELF+  PDLLH + T +NP  L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  +E YR ++R  VFSH ELICKMA+  E LDL L  AV+ EM I+ QEE+  RK +  + +G+   ER   + +P+D+R+C+ C+TT ++S + C  C      D + CL H++ LC C+S     L+YRY+LDE+  ++  +  + E +  W ++V
Sbjct:  259 VCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRP-----PEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLV--NSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKAL--LEKGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDC-----PDGLVCLSHINDLCKCSSSRQY-LRYRYTLDELPAMLHKLKVRAESFDTWANKV 710          

HSP 2 Score: 58.9214 bits (141), Expect = 1.588e-7
Identity = 26/42 (61.90%), Postives = 29/42 (69.05%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISP 204
            F  PP  PVF P+  EF DPL YI KIRP+A+K GICKI  P
Sbjct:    8 FLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPP 49          

HSP 3 Score: 58.151 bits (139), Expect = 2.962e-7
Identity = 41/131 (31.30%), Postives = 60/131 (45.80%), Query Frame = 1
Query: 3883 CFCRKRGMDQKGAQVM-CDLCQDWFHLSCLGIQNKDMSKK----------------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQ--TELGAAFAEYKR 4218
            C C   G    GA  + CDLCQDWFH  C+ +     S +                KFLCP C RS+RP  E ILA    L++    +++PE  AL  +++R I++        + +  T L    AE ++
Sbjct: 1121 CVC---GQVLAGAGALQCDLCQDWFHGRCVSVPRLLSSPRPNPTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQRLP--VRLPEGEALQCLTERAISWQGRARQALASEDVTALLGRLAELRQ 1246          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Human
Match: KDM5B (lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC:18039])

HSP 1 Score: 449.514 bits (1155), Expect = 2.736e-131
Identity = 221/467 (47.32%), Postives = 309/467 (66.17%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            +C +C S      ++ C  CD  YH  C+ PPL DVPK  W C +CL   C K       E FGF Q+   Y+L +F   AD FK  YFN   ++   E VE+E+WRLV+   + +DV V+YGADI+S    SGFP R  +   + ++++Y+DSGWNLNN+PV+++S+   ++ DI GM +PW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ E++M++ A ELF   PDLLH + T +NP  L+ +++ VYRT+Q AGEFV+TFPRAYH+GFNQGFNFAEAVNFC  DWL  GR  VE YRL+ R  VFSH+E+ICKMAS  + LD+++   V  +M I+ ++EK  R+ +  +  GV  +ER+  + +P+D+R+C+ C+TT ++S ++CS  C+  L   + CL HV +LCSC   +   L+YRY+LD++  +++ +  + E Y  W   V
Sbjct:  153 VCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQECSKP-----QEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVS--TIEEDVTVEYGADIASKEFGSGFPVRDGKIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKL--GVIDSERMDFELLPDDERQCVKCKTTCFMSAISCS--CKPGL---LVCLHHVKELCSCPPYK-YKLRYRYTLDDLYPMMNALKLRAESYNEWALNV 604          

HSP 2 Score: 68.5514 bits (166), Expect = 1.679e-10
Identity = 72/309 (23.30%), Postives = 129/309 (41.75%), Query Frame = 1
Query: 3253 QKLQQCRRLVHVEEMQTLIKQADSLCVAFDRLSDLKSLFRTIDAWKKNLHGLFIKNSHNSYLTTPTLLEVLFPRPQRQFKLMIAREAVSSKLVDDCKTESTMKESSVKDEPESCDEEKQTDDQKSIKTNRSCRKSRGRQKRSSLAPDDPQIARLDNVVVFESHLRSGYVGESEFNGNYKKMCVNELEWMWNLRELNEDKASKDSSGHDF-YCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFS 4176
            + LQ   R+  ++ +  L+ +  S+ V  + L  L++L   + AWK+     F+   ++ Y    +LLEVL PR                 L+   + +  +KE     + +S   E  +D ++++        +  ++  S++A             + E+ LR                   E+E + +LR  NE K        D   C C+K         + C+LC+D FH SC+ + +     + +LCP C RS++PP E IL     L++    +++PE  AL  M +R +N+      L S
Sbjct:  867 EGLQAGGRVPVLDTLIELVTRGRSIPVHLNSLPRLETLVAEVQAWKECAVNTFL-TENSPY----SLLEVLCPR-------------CDIGLLGLKRKQRKLKEPLPNGKKKSTKLESLSDLERAL--------TESKETASAMA------------TLGEARLR-------------------EMEALQSLRLANEGKLLSPLQDVDIKICLCQKA---PAAPMIQCELCRDAFHTSCVAVPSISQGLRIWLCPHCRRSEKPPLEKILPLLASLQR--IRVRLPEGDALRYMIERTVNWQHRAQQLLS 1113          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Human
Match: KDM5C (lysine demethylase 5C [Source:HGNC Symbol;Acc:HGNC:11114])

HSP 1 Score: 453.366 bits (1165), Expect = 8.541e-131
Identity = 219/467 (46.90%), Postives = 305/467 (65.31%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            +C++C        ++ C  CD  YHI C+ PPL ++PK  W C +C+   C++       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV   ++ +DV V+YGADI S    SGFP   ++     ++++Y  SGWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE  E++M++   ELF+  PDLLH + T +NP  L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  +E YR ++R  VFSH ELICKMA+  E LDL L  AV+ EM I+ QEE+  RK +  + +G+   ER   + +P+D+R+C+ C+TT ++S + C  C      D + CL H++ LC C+S     L+YRY+LDE+  ++  +  + E +  W ++V
Sbjct:  285 VCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRP-----PEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLV--NSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKAL--LEKGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDC-----PDGLVCLSHINDLCKCSSSRQY-LRYRYTLDELPAMLHKLKVRAESFDTWANKV 736          

HSP 2 Score: 108.997 bits (271), Expect = 9.682e-23
Identity = 59/158 (37.34%), Postives = 79/158 (50.00%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY 552
            F  PP  PVF P+  EF DPL YI KIRP+A+K GICKI  P  W PPFAV+   F+F PR+QRLNE                         LEI                V + GG   + K+++W  + + L Y    K + S++RS++E+I+ PY
Sbjct:    8 FLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDNFRFTPRIQRLNE-------------------------LEI----------------VVEEGGYEAICKDRRWARVAQRLNY-PPGKNIGSLLRSHYERIVYPY 123          

HSP 3 Score: 58.151 bits (139), Expect = 2.844e-7
Identity = 41/131 (31.30%), Postives = 60/131 (45.80%), Query Frame = 1
Query: 3883 CFCRKRGMDQKGAQVM-CDLCQDWFHLSCLGIQNKDMSKK----------------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQ--TELGAAFAEYKR 4218
            C C   G    GA  + CDLCQDWFH  C+ +     S +                KFLCP C RS+RP  E ILA    L++    +++PE  AL  +++R I++        + +  T L    AE ++
Sbjct: 1147 CVC---GQVLAGAGALQCDLCQDWFHGRCVSVPRLLSSPRPNPTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQRLP--VRLPEGEALQCLTERAISWQGRARQALASEDVTALLGRLAELRQ 1272          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Human
Match: KDM5C (lysine demethylase 5C [Source:HGNC Symbol;Acc:HGNC:11114])

HSP 1 Score: 453.751 bits (1166), Expect = 9.927e-131
Identity = 219/467 (46.90%), Postives = 305/467 (65.31%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            +C++C        ++ C  CD  YHI C+ PPL ++PK  W C +C+   C++       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV   ++ +DV V+YGADI S    SGFP   ++     ++++Y  SGWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE  E++M++   ELF+  PDLLH + T +NP  L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  +E YR ++R  VFSH ELICKMA+  E LDL L  AV+ EM I+ QEE+  RK +  + +G+   ER   + +P+D+R+C+ C+TT ++S + C  C      D + CL H++ LC C+S     L+YRY+LDE+  ++  +  + E +  W ++V
Sbjct:  326 VCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRP-----PEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLV--NSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKAL--LEKGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDC-----PDGLVCLSHINDLCKCSSSRQ-YLRYRYTLDELPAMLHKLKVRAESFDTWANKV 777          

HSP 2 Score: 160.229 bits (404), Expect = 2.315e-38
Identity = 73/158 (46.20%), Postives = 102/158 (64.56%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY 552
            F  PP  PVF P+  EF DPL YI KIRP+A+K GICKI  P  W PPFAV+   F+F PR+QRLNE+ A +R+K N++  I  FWE Q + L+IP V+   LDL+ L   V + GG   + K+++W  + + L Y    K + S++RS++E+I+ PY
Sbjct:    8 FLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYEAICKDRRWARVAQRLNY-PPGKNIGSLLRSHYERIVYPY 164          

HSP 3 Score: 58.5362 bits (140), Expect = 2.498e-7
Identity = 41/131 (31.30%), Postives = 60/131 (45.80%), Query Frame = 1
Query: 3883 CFCRKRGMDQKGAQVM-CDLCQDWFHLSCLGIQNKDMSKK----------------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQ--TELGAAFAEYKR 4218
            C C   G    GA  + CDLCQDWFH  C+ +     S +                KFLCP C RS+RP  E ILA    L++    +++PE  AL  +++R I++        + +  T L    AE ++
Sbjct: 1188 CVC---GQVLAGAGALQCDLCQDWFHGRCVSVPRLLSSPRPNPTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQRLP--VRLPEGEALQCLTERAISWQGRARQALASEDVTALLGRLAELRQ 1313          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Celegans
Match: rbr-2 (Lysine-specific demethylase rbr-2 [Source:UniProtKB/Swiss-Prot;Acc:Q23541])

HSP 1 Score: 357.836 bits (917), Expect = 1.988e-100
Identity = 181/469 (38.59%), Postives = 281/469 (59.91%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCF--ECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFN--DRKNVSLKEVEEEYWR-LVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKD--QKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLW 2094
             C  C        ++ C    C+   H  C DP L +VP+  W C +C++     E A++  + +GF  ++ +Y+L+SF+ +A+ +K  YF   D   VS   VE  +W+ +++ EN    V VKYGAD+ +    SGFP + ++    +    Q+Y    WNLNN+PVL++S+    +  ISGM VPW YVGM FS FCWH EDHW+YS+NY H G+ K WYGV   DAEKFED +++ A  L  +  DL HH+TT  NP LL    + ++   Q AGEFV+TFPRAYHAGFN+G NFAEAVNF P DWL+KGR  VESY  V+R  VFSH+EL+ KM  +++ L + +  A ++E++ I +++K+ R+ +  +     + ++++ ++IP++ R C  C+TTL++  + C+         +M+C++H   LC+  + ++   +YR+ LD++  +   + K+   Y  W
Sbjct:  288 FCVACNEGKDEDLLLLCDIDGCNNGRHTYCCDPVLDEVPEGEWRCPKCIE----SEDAKIGLD-WGFYDADTEYNLNSFTEFANKWKCDYFGVKDVSQVSCDAVERSFWKNVISHEN---PVSVKYGADLITSRVGSGFPRKEDKHTGPDLKLKQQYASHAWNLNNMPVLRESVLSHFNTGISGMMVPWVYVGMCFSTFCWHTEDHWTYSVNYNHFGERKIWYGVGGEDAEKFEDALKKIAPGLTGRQRDLFHHMTTAANPHLLRSLGVPIHSVHQNAGEFVITFPRAYHAGFNEGLNFAEAVNFAPIDWLSKGRECVESYSNVRRYLVFSHDELLFKMVEAMDKLGISMSLATHEELIRIYEKQKMLRELLARLGVSNRQMQQVMFEKIPDEQRSCRFCKTTLFMCALVCNK------HKKMTCVEHHDHLCNSCTTKDYRYQYRFELDQLNNMCDELGKRTVNYNGW 742          

HSP 2 Score: 130.568 bits (327), Expect = 9.759e-30
Identity = 61/164 (37.20%), Postives = 100/164 (60.98%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKN-NPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQ-----LCSIVRSYFEKIIQPY 552
            F RPP AP++ PT +EF DP++Y+ KIR  A+K+G+ KI+ P  + PPFA+D   F FRPR Q+LNE+ A  + K+ FI  +  F        E P+ ++ N +DL+ LH  V+ +GGC +V ++++W  + RE    E+  +       +++RS++   I+P+
Sbjct:   17 FVRPPMAPIYYPTEEEFSDPIEYVAKIRHEAEKFGVVKIVPPANFKPPFAIDKEAFTFRPRTQKLNEVEAIVKEKHTFIDRLINFNRYSGLTFEFPVDRDGNIVDLYRLHRIVQNFGGCEEVNEDEKWRDVAREYLPKEQMARGVPSAFINLIRSHYNLHIEPF 180          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Celegans
Match: rbr-2 (Lysine-specific demethylase rbr-2 [Source:UniProtKB/Swiss-Prot;Acc:Q23541])

HSP 1 Score: 357.836 bits (917), Expect = 2.588e-100
Identity = 181/469 (38.59%), Postives = 281/469 (59.91%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCF--ECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFN--DRKNVSLKEVEEEYWR-LVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKD--QKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLW 2094
             C  C        ++ C    C+   H  C DP L +VP+  W C +C++     E A++  + +GF  ++ +Y+L+SF+ +A+ +K  YF   D   VS   VE  +W+ +++ EN    V VKYGAD+ +    SGFP + ++    +    Q+Y    WNLNN+PVL++S+    +  ISGM VPW YVGM FS FCWH EDHW+YS+NY H G+ K WYGV   DAEKFED +++ A  L  +  DL HH+TT  NP LL    + ++   Q AGEFV+TFPRAYHAGFN+G NFAEAVNF P DWL+KGR  VESY  V+R  VFSH+EL+ KM  +++ L + +  A ++E++ I +++K+ R+ +  +     + ++++ ++IP++ R C  C+TTL++  + C+         +M+C++H   LC+  + ++   +YR+ LD++  +   + K+   Y  W
Sbjct:  321 FCVACNEGKDEDLLLLCDIDGCNNGRHTYCCDPVLDEVPEGEWRCPKCIE----SEDAKIGLD-WGFYDADTEYNLNSFTEFANKWKCDYFGVKDVSQVSCDAVERSFWKNVISHEN---PVSVKYGADLITSRVGSGFPRKEDKHTGPDLKLKQQYASHAWNLNNMPVLRESVLSHFNTGISGMMVPWVYVGMCFSTFCWHTEDHWTYSVNYNHFGERKIWYGVGGEDAEKFEDALKKIAPGLTGRQRDLFHHMTTAANPHLLRSLGVPIHSVHQNAGEFVITFPRAYHAGFNEGLNFAEAVNFAPIDWLSKGRECVESYSNVRRYLVFSHDELLFKMVEAMDKLGISMSLATHEELIRIYEKQKMLRELLARLGVSNRQMQQVMFEKIPDEQRSCRFCKTTLFMCALVCNK------HKKMTCVEHHDHLCNSCTTKDYRYQYRFELDQLNNMCDELGKRTVNYNGW 775          

HSP 2 Score: 130.568 bits (327), Expect = 1.060e-29
Identity = 61/164 (37.20%), Postives = 100/164 (60.98%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKN-NPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQ-----LCSIVRSYFEKIIQPY 552
            F RPP AP++ PT +EF DP++Y+ KIR  A+K+G+ KI+ P  + PPFA+D   F FRPR Q+LNE+ A  + K+ FI  +  F        E P+ ++ N +DL+ LH  V+ +GGC +V ++++W  + RE    E+  +       +++RS++   I+P+
Sbjct:   50 FVRPPMAPIYYPTEEEFSDPIEYVAKIRHEAEKFGVVKIVPPANFKPPFAIDKEAFTFRPRTQKLNEVEAIVKEKHTFIDRLINFNRYSGLTFEFPVDRDGNIVDLYRLHRIVQNFGGCEEVNEDEKWRDVAREYLPKEQMARGVPSAFINLIRSHYNLHIEPF 213          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Celegans
Match: jmjd-2 (Lysine-specific demethylase 4 [Source:UniProtKB/Swiss-Prot;Acc:Q9U297])

HSP 1 Score: 116.701 bits (291), Expect = 1.099e-25
Identity = 72/228 (31.58%), Postives = 109/228 (47.81%), Query Frame = 1
Query:  970 YFNDRKNVSLKEVEEEYW-RLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPD---LLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASV 1641
            Y N R ++   E+E+ Y+  ++  E +       YGAD             T  + ++ + ++     WN+N L     +I    + +I G+   + Y GM  + F WH ED   YSIN+LH G  K W+ +    A++FE  M Q+ S   E +P     L H T  + P LL +  I      Q   EF++TFPR YH GFN G+N AE+ NF    W+  G+ +V
Sbjct:  186 YRNPRPDLKGSEIEKHYFDNILHGEPI-------YGAD-------------TEGSFYDAQVEE-----WNMNRL----GTILEDTNYEIKGVNTVYLYFGMYKTTFPWHAEDMDLYSINFLHFGAPKYWFAISSEHADRFERFMSQQFSYQNEYAPQCKAFLRHKTYLVTPELLRQAGIPYATMVQRPNEFIITFPRGYHMGFNLGYNLAESTNFASQRWIDYGKDAV 384          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Celegans
Match: phf-14 (PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q9GRZ5])

HSP 1 Score: 53.9138 bits (128), Expect = 1.413e-6
Identity = 26/65 (40.00%), Postives = 33/65 (50.77%), Query Frame = 1
Query:  673 SKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKT---GWICKRCLQVS 858
            S A+I  K +N  C +C   T       C EC   YHI C+ PPL+ +PK    GWIC  C + S
Sbjct:  502 SPAIIAPKKMNYTCVVCRKSTEQHKQTQCDECHKSYHIGCLSPPLTRLPKRNNFGWICHECNESS 566          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Fly
Match: lid (gene:FBgn0031759 transcript:FBtr0079231)

HSP 1 Score: 446.047 bits (1146), Expect = 4.918e-127
Identity = 224/478 (46.86%), Postives = 303/478 (63.39%), Query Frame = 1
Query:  679 ALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSL---KEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSR 2103
            ALIV   +  +C IC       +M+ C  CD  YH  C+ PPL+ +PK  W+C RC+     K       E FGF Q+  +Y+L  F   AD FK+ YF  RK V L   + VE E+WR+V++  + +DV V+YGAD+ +    SGFPT+++  +    DQ+Y +S WNLNNLP+L+ SI   ++ DISGM  PW YVGM F+ FCWH EDHWSYSINYLH G+ KTWYGVP S AE+FE+ M+Q A ELF   PDLLH + T +NP +L+ N + V+RTDQ AGEFV+TFPRAYHAGFNQG+NFAEAVNF PADWL  GR  V  Y +++R  VFSH+EL+CKMA     L   +  A Y +M  +   EK  RK +  +  GV R ER   + + +D+R C  C TT ++S V C   C DKL   + CL H + LC CA +++ ++ YRY+LDE+ +++  +  +   ++ W+SR
Sbjct:  440 ALIVDPLMKYICHICNRGDVEESMLLCDGCDDSYHTFCLLPPLTSIPKGEWLCPRCVVEEVSKP-----QEAFGFEQAEREYTLQQFGQMADQFKQEYF--RKPVHLVPTEMVEREFWRIVSS--IDEDVTVEYGADLHTMDHGSGFPTKSSLYLL-PGDQEYAESSWNLNNLPLLEDSILGHINADISGMNAPWMYVGMCFAAFCWHNEDHWSYSINYLHWGEPKTWYGVPGSCAEQFEETMKQAAPELFSSQPDLLHQLVTIMNPNILMNNRVPVFRTDQHAGEFVITFPRAYHAGFNQGYNFAEAVNFAPADWLKMGRECVNHYSMLRRFCVFSHDELVCKMALEPAKLTFGIATACYIDMAEMVDTEKKLRKSL--LEWGVTRAERRAFELVNDDERHCQECNTTCFLSAVACE--CNDKL---IVCLRHYTVLCGCAPEKHTLI-YRYTLDEMPLMLQKLKVKAHSFERWLSR 899          

HSP 2 Score: 167.933 bits (424), Expect = 5.959e-41
Identity = 75/176 (42.61%), Postives = 114/176 (64.77%), Query Frame = 1
Query:   64 NKKVIFERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNP 591
            N++  F+ PP  PVFRPT +EF++PL YI KIR +A+K GI KI+ P  W+PPFAVD    +F PRVQRLNE+ A +R+K NF+  I  FWE Q + L+IP+V+   LDL+ LH  V++ GG  Q TK+++W  +   + Y   SK + + +++++E+I+ P+  +     +   P
Sbjct:  150 NEEFHFDTPPECPVFRPTTEEFKNPLAYISKIRSIAEKCGIAKILPPATWSPPFAVDVDKLRFVPRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQY-PSSKSVGATLKAHYERILHPFEVYTSGKVLGPTP 324          

HSP 3 Score: 57.7658 bits (138), Expect = 2.036e-7
Identity = 37/124 (29.84%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 3817 MWNLRELNEDKASKDSSGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCL---------GIQNKD----MSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINF 4149
            + ++REL     +K+    D +C C+    + +     C LC+DWFH  C+         GI N       ++ K+LCP C RSKRP  E IL    +   +   +++PE  AL  +++R +N+
Sbjct: 1275 LLDMRELRRQNMNKNPM-RDMFCLCKS---EFRNLMFNCQLCRDWFHEDCVPPPSATNQNGIVNGGSGPGTNRPKWLCPSCVRSKRPRLETILPLLVQ--LQQLPIRLPEDEALRCLAERAMNW 1392          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Fly
Match: lid (gene:FBgn0031759 transcript:FBtr0079232)

HSP 1 Score: 446.047 bits (1146), Expect = 4.918e-127
Identity = 224/478 (46.86%), Postives = 303/478 (63.39%), Query Frame = 1
Query:  679 ALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSL---KEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSR 2103
            ALIV   +  +C IC       +M+ C  CD  YH  C+ PPL+ +PK  W+C RC+     K       E FGF Q+  +Y+L  F   AD FK+ YF  RK V L   + VE E+WR+V++  + +DV V+YGAD+ +    SGFPT+++  +    DQ+Y +S WNLNNLP+L+ SI   ++ DISGM  PW YVGM F+ FCWH EDHWSYSINYLH G+ KTWYGVP S AE+FE+ M+Q A ELF   PDLLH + T +NP +L+ N + V+RTDQ AGEFV+TFPRAYHAGFNQG+NFAEAVNF PADWL  GR  V  Y +++R  VFSH+EL+CKMA     L   +  A Y +M  +   EK  RK +  +  GV R ER   + + +D+R C  C TT ++S V C   C DKL   + CL H + LC CA +++ ++ YRY+LDE+ +++  +  +   ++ W+SR
Sbjct:  440 ALIVDPLMKYICHICNRGDVEESMLLCDGCDDSYHTFCLLPPLTSIPKGEWLCPRCVVEEVSKP-----QEAFGFEQAEREYTLQQFGQMADQFKQEYF--RKPVHLVPTEMVEREFWRIVSS--IDEDVTVEYGADLHTMDHGSGFPTKSSLYLL-PGDQEYAESSWNLNNLPLLEDSILGHINADISGMNAPWMYVGMCFAAFCWHNEDHWSYSINYLHWGEPKTWYGVPGSCAEQFEETMKQAAPELFSSQPDLLHQLVTIMNPNILMNNRVPVFRTDQHAGEFVITFPRAYHAGFNQGYNFAEAVNFAPADWLKMGRECVNHYSMLRRFCVFSHDELVCKMALEPAKLTFGIATACYIDMAEMVDTEKKLRKSL--LEWGVTRAERRAFELVNDDERHCQECNTTCFLSAVACE--CNDKL---IVCLRHYTVLCGCAPEKHTLI-YRYTLDEMPLMLQKLKVKAHSFERWLSR 899          

HSP 2 Score: 167.933 bits (424), Expect = 5.959e-41
Identity = 75/176 (42.61%), Postives = 114/176 (64.77%), Query Frame = 1
Query:   64 NKKVIFERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNP 591
            N++  F+ PP  PVFRPT +EF++PL YI KIR +A+K GI KI+ P  W+PPFAVD    +F PRVQRLNE+ A +R+K NF+  I  FWE Q + L+IP+V+   LDL+ LH  V++ GG  Q TK+++W  +   + Y   SK + + +++++E+I+ P+  +     +   P
Sbjct:  150 NEEFHFDTPPECPVFRPTTEEFKNPLAYISKIRSIAEKCGIAKILPPATWSPPFAVDVDKLRFVPRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQY-PSSKSVGATLKAHYERILHPFEVYTSGKVLGPTP 324          

HSP 3 Score: 57.7658 bits (138), Expect = 2.036e-7
Identity = 37/124 (29.84%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 3817 MWNLRELNEDKASKDSSGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCL---------GIQNKD----MSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINF 4149
            + ++REL     +K+    D +C C+    + +     C LC+DWFH  C+         GI N       ++ K+LCP C RSKRP  E IL    +   +   +++PE  AL  +++R +N+
Sbjct: 1275 LLDMRELRRQNMNKNPM-RDMFCLCKS---EFRNLMFNCQLCRDWFHEDCVPPPSATNQNGIVNGGSGPGTNRPKWLCPSCVRSKRPRLETILPLLVQ--LQQLPIRLPEDEALRCLAERAMNW 1392          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Fly
Match: lid (gene:FBgn0031759 transcript:FBtr0307070)

HSP 1 Score: 446.047 bits (1146), Expect = 4.918e-127
Identity = 224/478 (46.86%), Postives = 303/478 (63.39%), Query Frame = 1
Query:  679 ALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSL---KEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSR 2103
            ALIV   +  +C IC       +M+ C  CD  YH  C+ PPL+ +PK  W+C RC+     K       E FGF Q+  +Y+L  F   AD FK+ YF  RK V L   + VE E+WR+V++  + +DV V+YGAD+ +    SGFPT+++  +    DQ+Y +S WNLNNLP+L+ SI   ++ DISGM  PW YVGM F+ FCWH EDHWSYSINYLH G+ KTWYGVP S AE+FE+ M+Q A ELF   PDLLH + T +NP +L+ N + V+RTDQ AGEFV+TFPRAYHAGFNQG+NFAEAVNF PADWL  GR  V  Y +++R  VFSH+EL+CKMA     L   +  A Y +M  +   EK  RK +  +  GV R ER   + + +D+R C  C TT ++S V C   C DKL   + CL H + LC CA +++ ++ YRY+LDE+ +++  +  +   ++ W+SR
Sbjct:  440 ALIVDPLMKYICHICNRGDVEESMLLCDGCDDSYHTFCLLPPLTSIPKGEWLCPRCVVEEVSKP-----QEAFGFEQAEREYTLQQFGQMADQFKQEYF--RKPVHLVPTEMVEREFWRIVSS--IDEDVTVEYGADLHTMDHGSGFPTKSSLYLL-PGDQEYAESSWNLNNLPLLEDSILGHINADISGMNAPWMYVGMCFAAFCWHNEDHWSYSINYLHWGEPKTWYGVPGSCAEQFEETMKQAAPELFSSQPDLLHQLVTIMNPNILMNNRVPVFRTDQHAGEFVITFPRAYHAGFNQGYNFAEAVNFAPADWLKMGRECVNHYSMLRRFCVFSHDELVCKMALEPAKLTFGIATACYIDMAEMVDTEKKLRKSL--LEWGVTRAERRAFELVNDDERHCQECNTTCFLSAVACE--CNDKL---IVCLRHYTVLCGCAPEKHTLI-YRYTLDEMPLMLQKLKVKAHSFERWLSR 899          

HSP 2 Score: 167.933 bits (424), Expect = 5.959e-41
Identity = 75/176 (42.61%), Postives = 114/176 (64.77%), Query Frame = 1
Query:   64 NKKVIFERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNP 591
            N++  F+ PP  PVFRPT +EF++PL YI KIR +A+K GI KI+ P  W+PPFAVD    +F PRVQRLNE+ A +R+K NF+  I  FWE Q + L+IP+V+   LDL+ LH  V++ GG  Q TK+++W  +   + Y   SK + + +++++E+I+ P+  +     +   P
Sbjct:  150 NEEFHFDTPPECPVFRPTTEEFKNPLAYISKIRSIAEKCGIAKILPPATWSPPFAVDVDKLRFVPRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQY-PSSKSVGATLKAHYERILHPFEVYTSGKVLGPTP 324          

HSP 3 Score: 57.7658 bits (138), Expect = 2.036e-7
Identity = 37/124 (29.84%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 3817 MWNLRELNEDKASKDSSGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCL---------GIQNKD----MSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINF 4149
            + ++REL     +K+    D +C C+    + +     C LC+DWFH  C+         GI N       ++ K+LCP C RSKRP  E IL    +   +   +++PE  AL  +++R +N+
Sbjct: 1275 LLDMRELRRQNMNKNPM-RDMFCLCKS---EFRNLMFNCQLCRDWFHEDCVPPPSATNQNGIVNGGSGPGTNRPKWLCPSCVRSKRPRLETILPLLVQ--LQQLPIRLPEDEALRCLAERAMNW 1392          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Fly
Match: lid (gene:FBgn0031759 transcript:FBtr0345336)

HSP 1 Score: 446.047 bits (1146), Expect = 4.918e-127
Identity = 224/478 (46.86%), Postives = 303/478 (63.39%), Query Frame = 1
Query:  679 ALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSL---KEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSR 2103
            ALIV   +  +C IC       +M+ C  CD  YH  C+ PPL+ +PK  W+C RC+     K       E FGF Q+  +Y+L  F   AD FK+ YF  RK V L   + VE E+WR+V++  + +DV V+YGAD+ +    SGFPT+++  +    DQ+Y +S WNLNNLP+L+ SI   ++ DISGM  PW YVGM F+ FCWH EDHWSYSINYLH G+ KTWYGVP S AE+FE+ M+Q A ELF   PDLLH + T +NP +L+ N + V+RTDQ AGEFV+TFPRAYHAGFNQG+NFAEAVNF PADWL  GR  V  Y +++R  VFSH+EL+CKMA     L   +  A Y +M  +   EK  RK +  +  GV R ER   + + +D+R C  C TT ++S V C   C DKL   + CL H + LC CA +++ ++ YRY+LDE+ +++  +  +   ++ W+SR
Sbjct:  440 ALIVDPLMKYICHICNRGDVEESMLLCDGCDDSYHTFCLLPPLTSIPKGEWLCPRCVVEEVSKP-----QEAFGFEQAEREYTLQQFGQMADQFKQEYF--RKPVHLVPTEMVEREFWRIVSS--IDEDVTVEYGADLHTMDHGSGFPTKSSLYLL-PGDQEYAESSWNLNNLPLLEDSILGHINADISGMNAPWMYVGMCFAAFCWHNEDHWSYSINYLHWGEPKTWYGVPGSCAEQFEETMKQAAPELFSSQPDLLHQLVTIMNPNILMNNRVPVFRTDQHAGEFVITFPRAYHAGFNQGYNFAEAVNFAPADWLKMGRECVNHYSMLRRFCVFSHDELVCKMALEPAKLTFGIATACYIDMAEMVDTEKKLRKSL--LEWGVTRAERRAFELVNDDERHCQECNTTCFLSAVACE--CNDKL---IVCLRHYTVLCGCAPEKHTLI-YRYTLDEMPLMLQKLKVKAHSFERWLSR 899          

HSP 2 Score: 167.933 bits (424), Expect = 5.959e-41
Identity = 75/176 (42.61%), Postives = 114/176 (64.77%), Query Frame = 1
Query:   64 NKKVIFERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNP 591
            N++  F+ PP  PVFRPT +EF++PL YI KIR +A+K GI KI+ P  W+PPFAVD    +F PRVQRLNE+ A +R+K NF+  I  FWE Q + L+IP+V+   LDL+ LH  V++ GG  Q TK+++W  +   + Y   SK + + +++++E+I+ P+  +     +   P
Sbjct:  150 NEEFHFDTPPECPVFRPTTEEFKNPLAYISKIRSIAEKCGIAKILPPATWSPPFAVDVDKLRFVPRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQY-PSSKSVGATLKAHYERILHPFEVYTSGKVLGPTP 324          

HSP 3 Score: 57.7658 bits (138), Expect = 2.036e-7
Identity = 37/124 (29.84%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 3817 MWNLRELNEDKASKDSSGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCL---------GIQNKD----MSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINF 4149
            + ++REL     +K+    D +C C+    + +     C LC+DWFH  C+         GI N       ++ K+LCP C RSKRP  E IL    +   +   +++PE  AL  +++R +N+
Sbjct: 1275 LLDMRELRRQNMNKNPM-RDMFCLCKS---EFRNLMFNCQLCRDWFHEDCVPPPSATNQNGIVNGGSGPGTNRPKWLCPSCVRSKRPRLETILPLLVQ--LQQLPIRLPEDEALRCLAERAMNW 1392          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Fly
Match: lid (gene:FBgn0031759 transcript:FBtr0307071)

HSP 1 Score: 446.047 bits (1146), Expect = 4.918e-127
Identity = 224/478 (46.86%), Postives = 303/478 (63.39%), Query Frame = 1
Query:  679 ALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSL---KEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSR 2103
            ALIV   +  +C IC       +M+ C  CD  YH  C+ PPL+ +PK  W+C RC+     K       E FGF Q+  +Y+L  F   AD FK+ YF  RK V L   + VE E+WR+V++  + +DV V+YGAD+ +    SGFPT+++  +    DQ+Y +S WNLNNLP+L+ SI   ++ DISGM  PW YVGM F+ FCWH EDHWSYSINYLH G+ KTWYGVP S AE+FE+ M+Q A ELF   PDLLH + T +NP +L+ N + V+RTDQ AGEFV+TFPRAYHAGFNQG+NFAEAVNF PADWL  GR  V  Y +++R  VFSH+EL+CKMA     L   +  A Y +M  +   EK  RK +  +  GV R ER   + + +D+R C  C TT ++S V C   C DKL   + CL H + LC CA +++ ++ YRY+LDE+ +++  +  +   ++ W+SR
Sbjct:  440 ALIVDPLMKYICHICNRGDVEESMLLCDGCDDSYHTFCLLPPLTSIPKGEWLCPRCVVEEVSKP-----QEAFGFEQAEREYTLQQFGQMADQFKQEYF--RKPVHLVPTEMVEREFWRIVSS--IDEDVTVEYGADLHTMDHGSGFPTKSSLYLL-PGDQEYAESSWNLNNLPLLEDSILGHINADISGMNAPWMYVGMCFAAFCWHNEDHWSYSINYLHWGEPKTWYGVPGSCAEQFEETMKQAAPELFSSQPDLLHQLVTIMNPNILMNNRVPVFRTDQHAGEFVITFPRAYHAGFNQGYNFAEAVNFAPADWLKMGRECVNHYSMLRRFCVFSHDELVCKMALEPAKLTFGIATACYIDMAEMVDTEKKLRKSL--LEWGVTRAERRAFELVNDDERHCQECNTTCFLSAVACE--CNDKL---IVCLRHYTVLCGCAPEKHTLI-YRYTLDEMPLMLQKLKVKAHSFERWLSR 899          

HSP 2 Score: 167.933 bits (424), Expect = 5.959e-41
Identity = 75/176 (42.61%), Postives = 114/176 (64.77%), Query Frame = 1
Query:   64 NKKVIFERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNP 591
            N++  F+ PP  PVFRPT +EF++PL YI KIR +A+K GI KI+ P  W+PPFAVD    +F PRVQRLNE+ A +R+K NF+  I  FWE Q + L+IP+V+   LDL+ LH  V++ GG  Q TK+++W  +   + Y   SK + + +++++E+I+ P+  +     +   P
Sbjct:  150 NEEFHFDTPPECPVFRPTTEEFKNPLAYISKIRSIAEKCGIAKILPPATWSPPFAVDVDKLRFVPRVQRLNELEAKTRVKLNFLDQIAKFWELQGSSLKIPMVERKALDLYTLHRIVQEEGGMEQTTKDRKWAKVANRMQY-PSSKSVGATLKAHYERILHPFEVYTSGKVLGPTP 324          

HSP 3 Score: 57.7658 bits (138), Expect = 2.036e-7
Identity = 37/124 (29.84%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 3817 MWNLRELNEDKASKDSSGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCL---------GIQNKD----MSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINF 4149
            + ++REL     +K+    D +C C+    + +     C LC+DWFH  C+         GI N       ++ K+LCP C RSKRP  E IL    +   +   +++PE  AL  +++R +N+
Sbjct: 1275 LLDMRELRRQNMNKNPM-RDMFCLCKS---EFRNLMFNCQLCRDWFHEDCVPPPSATNQNGIVNGGSGPGTNRPKWLCPSCVRSKRPRLETILPLLVQ--LQQLPIRLPEDEALRCLAERAMNW 1392          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Zebrafish
Match: kdm5ba (lysine (K)-specific demethylase 5Ba [Source:ZFIN;Acc:ZDB-GENE-030131-5379])

HSP 1 Score: 570.852 bits (1470), Expect = 3.890e-171
Identity = 346/994 (34.81%), Postives = 509/994 (51.21%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYD--NIFINKNPDL-------------FPE--NIQP---------------KTMKYKTALTLES-PKMTRSKALIVQKP---------VNE-----------------LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLL-QIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLSSHKAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIVSSHEEQAEKLTLGEMRLLVEKLRSLPAHVPQLEEAAQTLHSINEWRKKVRMTVSCVDVIEENVITNLVESGESNLVYLSEYQMLQKMRLYTVWIGKSRQLFKSSEHCPPPPLDEFRKVRDEG 2877
            F  PP  PVF P+ +EF DP  +I KIRP+A+  GICKI  P  W PPFA D     F PR+QRLNE+ A +R+K NF+  I  FWE Q   L+IP V+   LDLF L+  VK+ GG   V K ++WT I  ++G+    K + S +R+++E+I+ PY  F    N+  ++ P L              P+  ++QP               +  K +     E+ P + R     V KP         V E                 +C +C        ++ C  CD  YH  C+ PPL DVPK  W C +CL   C K         FGF Q+   Y+L +F   AD+FK  YFN   ++   E VE+E+WRLV+   + +DV V+YGADI+S    SGFP +      + +++ Y+ SGWNLNN+PVL+ S+   V+ DI GM +PW YVGM FS FCWHIEDHWSYS+NYLH G+ KTWYG P   AE+ ED+M+  A ELFE  PDLLH + T +NP LL+++ + +YRT+Q AGEFV+TFPRAYH+GFNQGFNFAEAVNFC ADWL  GR  VE YR + R  VFSH+E+ C +A+  +SL+L L  AV  +M  + QEEK+ R++   +  G+  ++++  D +P+++R+C  CRTT Y+S +TC         +++ CL H   LCSC ++ N  L Y+Y+L E+      +  + E Y  W S+V  + K+                                   + + K +LEEL+ LL +  + M     LL+ +  +++   R   M  QLL+  +                                      +  S   +   +LT+ E+R  V KL  LP  + Q       L+ + +++++    +   D+   + +  L++ G    V L +  +L++      W+   ++   +S+      LD  R++ D+G
Sbjct:    9 FIPPPECPVFEPSWEEFADPFGFINKIRPIAENTGICKIRPPPGWQPPFACDVDRLHFTPRIQRLNELEAQTRVKLNFLDQIAKFWELQGCTLKIPHVERKTLDLFVLYKLVKEDGGFDVVCKERRWTQIALKMGFA-PGKAIGSHLRAHYERILYPYYLFQTGANLMNSQKPTLTNDTKDKEYKPHDLPQRQSVQPVETCTIARRAKRTEGRCFKSEPGEVCENKPNLRRRMGSYVAKPEPVKMLPVQVKEEPIVQPVDGEKSKVEQYICLVCGGGGDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQECGKPQV-----AFGFEQAPRDYTLRTFGDMADSFKSDYFNMPVHMVPTELVEKEFWRLVS--TIEEDVTVEYGADIASKDFGSGFPVKNGTFKVSPEEEGYLTSGWNLNNMPVLEASVLTHVTADICGMKLPWLYVGMCFSSFCWHIEDHWSYSVNYLHWGEPKTWYGAPGYAAEQLEDVMKSLAPELFESQPDLLHQLVTIMNPNLLMEHGVPIYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTADWLPLGRQCVEHYRSLYRYCVFSHDEMACNIAAKADSLELELACAVQKDMNAMIQEEKILREKAYKL--GMWHSQQVDYDILPDEERQCAKCRTTCYLSAITCPCS-----PEQVVCLHHTQDLCSCPAR-NYTLNYKYTLAELKTFFQALTARAESYDDWASKVNKILKA-----------------------------------DQDNKSDLEELRCLLAEAEKKMYPETDLLNDMRQVIQNADRCTIMAQQLLNGKR------------------------------------QTRYRSGGGKSQNQLTVEELRAFVNKLYDLPCTIRQAPFLKALLNRVEQFQQQ-SFDMLAEDMAGSSALQGLLDEGAGLDVELPQLAVLRQRLEQARWVEAVQE---ASDQPADLSLDCMRRLIDQG 911          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Zebrafish
Match: kdm5ba (lysine (K)-specific demethylase 5Ba [Source:ZFIN;Acc:ZDB-GENE-030131-5379])

HSP 1 Score: 570.081 bits (1468), Expect = 6.830e-171
Identity = 343/996 (34.44%), Postives = 510/996 (51.20%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYD--NIFINKNPDL-------------FPE--NIQP-----------------------------KTMKYKTALTLESPKMTRSKALIVQ-------KPVNE--------LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLL-QIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLSSHKAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIVSSHEEQAEKLTLGEMRLLVEKLRSLPAHVPQLEEAAQTLHSINEWRKKVRMTVSCVDVIEENVITNLVESGESNLVYLSEYQMLQKMRLYTVWIGKSRQLFKSSEHCPPPPLDEFRKVRDEG 2877
            F  PP  PVF P+ +EF DP  +I KIRP+A+  GICKI  P  W PPFA D     F PR+QRLNE+ A +R+K NF+  I  FWE Q   L+IP V+   LDLF L+  VK+ GG   V K ++WT I  ++G+    K + S +R+++E+I+ PY  F    N+  ++ P L              P+  ++QP                               ++ +    +  P+    K L VQ       +PV+         +C +C        ++ C  CD  YH  C+ PPL DVPK  W C +CL   C K         FGF Q+   Y+L +F   AD+FK  YFN   ++   E VE+E+WRLV+   + +DV V+YGADI+S    SGFP +      + +++ Y+ SGWNLNN+PVL+ S+   V+ DI GM +PW YVGM FS FCWHIEDHWSYS+NYLH G+ KTWYG P   AE+ ED+M+  A ELFE  PDLLH + T +NP LL+++ + +YRT+Q AGEFV+TFPRAYH+GFNQGFNFAEAVNFC ADWL  GR  VE YR + R  VFSH+E+ C +A+  +SL+L L  AV  +M  + QEEK+ R++   +  G+  ++++  D +P+++R+C  CRTT Y+S +TC         +++ CL H   LCSC ++ N  L Y+Y+L E+      +  + E Y  W S+V  + K+                                   + + K +LEEL+ LL +  + M     LL+ +  +++   R   M  QLL+  +                                      +  S   +   +LT+ E+R  + KL  LP  + Q       L+ + +++++    +   D+   + +  L++ G    V L +  +L++      W+   ++   +S+      LD  R++ D+G
Sbjct:    9 FIPPPECPVFEPSWEEFADPFGFINKIRPIAENTGICKIRPPPGWQPPFACDVDRLHFTPRIQRLNELEAQTRVKLNFLDQIAKFWELQGCTLKIPHVERKTLDLFVLYKLVKEDGGFDVVCKERRWTQIALKMGFA-PGKAIGSHLRAHYERILYPYYLFQTGANLMNSQKPTLTNDTKDKEYKPHDLPQRQSVQPVETCTIARRAKRTEGRCFKSEPGEVCENKPNLRRRMGSYVAKPEPGTFKMLPVQVKEEPIVQPVDGEKSKVEQYICLVCGGGGDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQECGKPQV-----AFGFEQAPRDYTLRTFGDMADSFKSDYFNMPVHMVPTELVEKEFWRLVS--TIEEDVTVEYGADIASKDFGSGFPVKNGTFKVSPEEEGYLTSGWNLNNMPVLEASVLTHVTADICGMKLPWLYVGMCFSSFCWHIEDHWSYSVNYLHWGEPKTWYGAPGYAAEQLEDVMKGLAPELFESQPDLLHQLVTIMNPNLLMEHGVPIYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTADWLPLGRQCVEHYRSLYRYCVFSHDEMACNIAAKADSLELELACAVQKDMNAMIQEEKILREKAYKL--GMWHSQQVDYDILPDEERQCAKCRTTCYLSAITCPCS-----PEQVVCLHHTQDLCSCPAR-NYTLNYKYTLAELKTFFQALTARAESYDDWASKVNKILKA-----------------------------------DQDNKSDLEELRCLLAEAEKKMYPETDLLNDMRQVIQNADRCTIMAQQLLNGKR------------------------------------QTRYRSGGGKSQNQLTVEELRAFINKLYDLPCTIRQAPFLKALLNRVEQFQQQ-SFDMLAEDMAGSSALQGLLDEGAGLDVELPQLAVLRQRLEQARWVEAVQE---ASDQPADLSLDCMRRLIDQG 913          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Zebrafish
Match: kdm5ba (lysine (K)-specific demethylase 5Ba [Source:ZFIN;Acc:ZDB-GENE-030131-5379])

HSP 1 Score: 569.696 bits (1467), Expect = 9.870e-171
Identity = 342/997 (34.30%), Postives = 508/997 (50.95%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKN----------------PDLFPE--NIQP-----------------------------KTMKYKTALTLESPKMTRSKALIVQ-------KPVNE--------LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLL-QIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLSSHKAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIVSSHEEQAEKLTLGEMRLLVEKLRSLPAHVPQLEEAAQTLHSINEWRKKVRMTVSCVDVIEENVITNLVESGESNLVYLSEYQMLQKMRLYTVWIGKSRQLFKSSEHCPPPPLDEFRKVRDEG 2877
            F  PP  PVF P+ +EF DP  +I KIRP+A+  GICKI  P  W PPFA D     F PR+QRLNE+ A +R+K NF+  I  FWE Q   L+IP V+   LDLF L+  VK+ GG   V K ++WT I  ++G+    K + S +R+++E+I+ PY  F     + +N                P   P+  ++QP                               ++ +    +  P+    K L VQ       +PV+         +C +C        ++ C  CD  YH  C+ PPL DVPK  W C +CL   C K         FGF Q+   Y+L +F   AD+FK  YFN   ++   E VE+E+WRLV+   + +DV V+YGADI+S    SGFP +      + +++ Y+ SGWNLNN+PVL+ S+   V+ DI GM +PW YVGM FS FCWHIEDHWSYS+NYLH G+ KTWYG P   AE+ ED+M+  A ELFE  PDLLH + T +NP LL+++ + +YRT+Q AGEFV+TFPRAYH+GFNQGFNFAEAVNFC ADWL  GR  VE YR + R  VFSH+E+ C +A+  +SL+L L  AV  +M  + QEEK+ R++   +  G+  ++++  D +P+++R+C  CRTT Y+S +TC         +++ CL H   LCSC ++ N  L Y+Y+L E+      +  + E Y  W S+V  + K+                                   + + K +LEEL+ LL +  + M     LL+ +  +++   R   M  QLL+  +                                      +  S   +   +LT+ E+R  + KL  LP  + Q       L+ + +++++    +   D+   + +  L++ G    V L +  +L++      W+   ++   +S+      LD  R++ D+G
Sbjct:    9 FIPPPECPVFEPSWEEFADPFGFINKIRPIAENTGICKIRPPPGWQPPFACDVDRLHFTPRIQRLNELEAQTRVKLNFLDQIAKFWELQGCTLKIPHVERKTLDLFVLYKLVKEDGGFDVVCKERRWTQIALKMGFA-PGKAIGSHLRAHYERILYPYYLFQTGANLMQNSQKPTLTNDTKDKEYKPHDLPQRQSVQPVETCTIARRAKRTEGRCFKSEPGEVCENKPNLRRRMGSYVAKPEPGTFKMLPVQVKEEPIVQPVDGEKSKVEQYICLVCGGGGDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQECGKPQV-----AFGFEQAPRDYTLRTFGDMADSFKSDYFNMPVHMVPTELVEKEFWRLVS--TIEEDVTVEYGADIASKDFGSGFPVKNGTFKVSPEEEGYLTSGWNLNNMPVLEASVLTHVTADICGMKLPWLYVGMCFSSFCWHIEDHWSYSVNYLHWGEPKTWYGAPGYAAEQLEDVMKGLAPELFESQPDLLHQLVTIMNPNLLMEHGVPIYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTADWLPLGRQCVEHYRSLYRYCVFSHDEMACNIAAKADSLELELACAVQKDMNAMIQEEKILREKAYKL--GMWHSQQVDYDILPDEERQCAKCRTTCYLSAITCPCS-----PEQVVCLHHTQDLCSCPAR-NYTLNYKYTLAELKTFFQALTARAESYDDWASKVNKILKA-----------------------------------DQDNKSDLEELRCLLAEAEKKMYPETDLLNDMRQVIQNADRCTIMAQQLLNGKR------------------------------------QTRYRSGGGKSQNQLTVEELRAFINKLYDLPCTIRQAPFLKALLNRVEQFQQQ-SFDMLAEDMAGSSALQGLLDEGAGLDVELPQLAVLRQRLEQARWVEAVQE---ASDQPADLSLDCMRRLIDQG 914          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Zebrafish
Match: kdm5c (lysine (K)-specific demethylase 5C [Source:ZFIN;Acc:ZDB-GENE-060810-94])

HSP 1 Score: 459.529 bits (1181), Expect = 1.092e-132
Identity = 238/522 (45.59%), Postives = 331/522 (63.41%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKML 2271
            +C++C        ++ C  CD  YH  C+ PPL+D PK  W C +C+   C+K      +E FGF Q+  +Y+L SF   AD FK  YFN   ++   E VE+E+WRLV++  + +DV V+YGADI S    SGFP    +   +E++++Y  SGWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP S AEK E++M++   ELFE  PDLLH + T +NP +L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR+ +E YR ++R  VFS  EL CKMA+  E LDL L  A + EM II QEE+  RK +  + +G+   ER   + +P+D+R+C  C+TT ++S + CS C      +R+ CL H   LCSC S E + L+YRY+LDE+  ++  +  + E +  W +RV    +          +EG  +      I++L++L+E+  +K     PN E L+ L
Sbjct:  360 VCRMCGRGDEDEKLMLCDGCDDNYHTFCLIPPLTDPPKGNWRCPKCVAEECKKP-----SEAFGFEQATREYTLQSFGEMADTFKADYFNMPVHMVPTELVEKEFWRLVSS--IEEDVTVEYGADIHSKEFGSGFPVNNGKRQLSEEEEEYARSGWNLNVMPVLEQSLLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPCSAAEKLEEVMKKLTPELFEFQPDLLHQLVTIMNPNILMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPTGRSCIEHYRQLRRYCVFSQEELTCKMAACPEKLDLNLAAATHREMFIIVQEERKLRKSL--LERGIKEAEREAFELLPDDERQCDKCKTTCFLSALACSNC-----PERLVCLYHAQDLCSCPS-EKLYLRYRYTLDELLAMLHRLKVRAESFDSWANRVKEALEQ---------DEGNKID-----IKDLEVLKEEAADKKF---PNNELLQRL 849          

HSP 2 Score: 162.925 bits (411), Expect = 2.284e-39
Identity = 74/158 (46.84%), Postives = 104/158 (65.82%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY 552
            F  PP  PVF P+ +EF DPL YI KIRP+A+K GICKI  P  W PPFAV+   F F PR+QRLNE+ A +R+K N++  I  FWE Q + L+IP ++   LDLF L   V + GG   V+K ++W  + ++LGY    K + S++RS++E+I+ P+
Sbjct:    8 FVPPPECPVFEPSWEEFADPLGYIAKIRPIAEKSGICKIRPPPDWQPPFAVEVDNFHFTPRIQRLNELEAETRVKLNYLDRIAKFWEIQGSSLKIPNLERRILDLFSLAKIVTEEGGFESVSKERRWARVAQKLGY-PPGKNIGSLLRSHYERIVYPF 164          

HSP 3 Score: 56.225 bits (134), Expect = 6.438e-7
Identity = 31/88 (35.23%), Postives = 48/88 (54.55%), Query Frame = 1
Query: 3931 CDLCQDWFHLSC------LGIQNKDMSK--------KKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFH 4152
            C LC+DWFH  C      L   +  ++K         +FLCP+C+RS+RP  E ILA    L++    +++PE  AL  +++R IN+ 
Sbjct: 1268 CHLCKDWFHGGCVSFPPLLATSDTHLTKPLCWWDWNTRFLCPRCQRSRRPRLETILALLVALQRLP--VRLPEGEALQCLTERAINWQ 1353          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Zebrafish
Match: kdm5bb (lysine (K)-specific demethylase 5Bb [Source:NCBI gene;Acc:415256])

HSP 1 Score: 432.95 bits (1112), Expect = 1.088e-124
Identity = 225/524 (42.94%), Postives = 319/524 (60.88%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLLQ 2277
            +C +C        ++ C  CD  YH  C+ PPL+DVPK  W C +CL   C K       E FGF Q++  Y+L +F   AD+FK  YFN   ++   E VE+E+WRLV    + +DV V+YGADI+S    SGFP +  +      D+KY+  GWNLNN+ ++  S+   V+ DI GMT+PW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYG P   AE+ E +M++ A ELF+  PDLLH + T +NP  L+ + + +YRT+Q AGEFV+TFPR+YH+GFNQGFNFAEAVNFC  DW+  GR  V+ YR + R  VFSH+E++C MA   + LD++L  AV  +M ++ +EE+  R+++  M  GV + E    D + +D+R+C+ CRTT Y+S +TC   C+  +     CL H   LCSC    N  L YR++LD++  +++ V ++ E Y  W SRV  + +++              RNV+ F      L E+ N ++  E   L +L+++ Q
Sbjct:  248 VCLVCGKGNDEDRLLLCDGCDDSYHTFCLIPPLTDVPKGDWRCPKCLTQECCKP-----QEAFGFEQAHRDYTLKAFGEMADSFKSDYFNMPVHMVPTELVEKEFWRLVG--TIQEDVTVEYGADIASKEFGSGFPIKGGRFKIAPHDEKYLQCGWNLNNMAMMTPSVLTHVTADICGMTLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGAPGFAAEQLEAVMKKLAPELFDSQPDLLHQLVTIMNPNTLMAHGVPIYRTNQCAGEFVITFPRSYHSGFNQGFNFAEAVNFCTVDWMPLGRQCVDHYRQLHRYCVFSHDEMVCNMAMKADCLDVVLASAVQKDMQLMIKEERELREKVRKM--GVAQCELFQYDLLADDERQCVKCRTTCYLSALTCP--CRPGV---QVCLYHTHDLCSCPIS-NYTLNYRFTLDDLYPMMNAVRQRAEYYDDWASRVTEVMEAKLDKK----------RNVTVF----RTLLEESNEQSFPENDLLRQLRLVTQ 742          

HSP 2 Score: 99.7525 bits (247), Expect = 3.631e-20
Identity = 46/116 (39.66%), Postives = 70/116 (60.34%), Query Frame = 1
Query:  205 KQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY 552
            + W PPFA D     F PR+QRLNE+ A +R+K NF+  I  FW+ Q   L+IP V+   LDL++L+  V   GG   V + ++WT I   +G+    K + S +R+++E+I+ PY
Sbjct:    2 QDWQPPFACDVDRLHFTPRIQRLNELEAQTRVKLNFLDQIAKFWDLQGCTLKIPHVERKILDLYQLNKLVADEGGFDLVCRERRWTKIAMTMGFA-PGKAVGSHLRAHYERILYPY 116          

HSP 3 Score: 58.5362 bits (140), Expect = 1.209e-7
Identity = 37/126 (29.37%), Postives = 64/126 (50.79%), Query Frame = 1
Query: 3799 VNELEWMWNLRELNEDKASKDSSGHDF-YCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLF 4173
            + ELE + +LR  NE K    +       C C+K  M   GA + C+LC+D FH  C+   +  +  + +LCP C RS +PP + I +    L++    +++PE  AL  M +R +++ +    + 
Sbjct: 1093 LKELESLCSLRASNESKLLPTADCASLKVCVCQKPAM---GAMLQCELCRDAFHSVCVRGPSDPLDPEAWLCPLCLRSTKPPLDKIRSLLSSLQR--IRVRLPEGDALRYMIERSVSWQRRVREVI 1213          

HSP 4 Score: 55.8398 bits (133), Expect = 9.425e-7
Identity = 22/60 (36.67%), Postives = 36/60 (60.00%), Query Frame = 1
Query: 5578 CSADMCVQQSSEKVNWVACDSCDQWFHWLCVDIKSEIEFRIQIEQKFLCPRCKCSKRQKR 5757
            C A+ C+Q   E+V+WV CD C++WFH +CV + +E    +  E+ ++C  C  S   +R
Sbjct: 1398 CPAESCLQPEGEEVDWVQCDCCNRWFHMICVGVSAE----LAAEEDYMCVSCSTSHMDRR 1453          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Xenopus
Match: elp1 (elongator complex protein 1 [Source:Xenbase;Acc:XB-GENE-5813351])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 311/680 (45.74%), Postives = 420/680 (61.76%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQPKTMKYKTALTLESPKMTR---SKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            F  PP  PVF P+ +EF DPL +I +IRP+A+K GICKI  PK W PPFA D  +F F PRVQRLNE+ A +R+K +F+  +  FWE Q + L IP+V    LD++ L   V   GG   VTK K+W+ +   +GY +  K   S+++ ++++I+ PY             +LF   +       +    LE+  M R     AL V      +C  C        ++ C  CD  YH  C+ PPLS+VPK  W C +C+   C K       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV++  + +DV+V+YGADISS    SGFP    +      ++ Y   GWNLNN+PVL++S+   ++ DISGM VPW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ ED+MR  A ELFE  PDLLH + T +NP +L+++ + VYRT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL+ GR  V  YR ++R  VFSH ELI KMAS  E LD+ L  AV  EM I+ +EE   R+ I  +  GV + E    + +P+D+R+C  CRTT ++S +TCS C  D+L     CL+H  +LCSC   +N  L+YRYSL+++  L+  V  + + Y+ W++RV
Sbjct:    7 FVPPPECPVFEPSWEEFSDPLSFIGRIRPIAEKTGICKIRPPKDWQPPFACDVKSFCFTPRVQRLNELEAMTRVKLDFLDQLGKFWELQGSALRIPVVDRKLLDVYALSKVVSSEGGFEVVTKEKKWSQVGNRMGY-QPGKGTGSLLKLHYDRILYPY-------------ELFQSGVSLMVRNKRKTSKLEAFGMQRRHGKGALSVSFVDLYICLFCARGDCEDKLLLCDGCDDSYHTFCLIPPLSEVPKGDWRCPKCVAEECSKP-----REAFGFEQAVREYTLQSFGEMADSFKSDYFNMPVHMVPTELVEKEFWRLVSS--IEEDVIVEYGADISSRDFGSGFPVMDGRRKLTADEEDYAHCGWNLNNMPVLEQSVLAHINADISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEDVMRTLAPELFETQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLSMGRQCVSHYRRLRRHCVFSHEELIFKMASDPECLDVGLAAAVCKEMTIMIEEETKLRELIVQL--GVVQAEEEAFELVPDDERQCSSCRTTCFLSALTCS-CSLDQLV----CLNHAEELCSCP-MQNKCLRYRYSLEDLPSLLYGVKLRAQSYESWVNRV 657          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Xenopus
Match: elp1 (elongator complex protein 1 [Source:Xenbase;Acc:XB-GENE-5813351])

HSP 1 Score: 589.726 bits (1519), Expect = 1.806e-179
Identity = 306/678 (45.13%), Postives = 414/678 (61.06%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNI-FINKNPDLFPENIQPKTMKYKTALTLESPKMTRSKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            F  PP  PVF P+ +EF DPL +I +IRP+A+K GICKI  PK W PPFA D  +F F PRVQRLNE+ A +R+K +F+  +  FWE Q + L IP+V    LD++ L   V   GG   VTK K+W+ +   +GY +  K   S+++ ++++I+ PY  F   +  + +N DL+                                    +C  C        ++ C  CD  YH  C+ PPLS+VPK  W C +C+   C K       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV++  + +DV+V+YGADISS    SGFP    +      ++ Y   GWNLNN+PVL++S+   ++ DISGM VPW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ ED+MR  A ELFE  PDLLH + T +NP +L+++ + VYRT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL+ GR  V  YR ++R  VFSH ELI KMAS  E LD+ L  AV  EM I+ +EE   R+ I     GV + E    + +P+D+R+C  CRTT ++S +TCS C  D+L     CL+H  +LCSC   +N  L+YRYSL+++  L+  V  + + Y+ W++RV
Sbjct:    7 FVPPPECPVFEPSWEEFSDPLSFIGRIRPIAEKTGICKIRPPKDWQPPFACDVKSFCFTPRVQRLNELEAMTRVKLDFLDQLGKFWELQGSALRIPVVDRKLLDVYALSKVVSSEGGFEVVTKEKKWSQVGNRMGY-QPGKGTGSLLKLHYDRILYPYELFQSGVSLMVRNVDLY------------------------------------ICLFCARGDCEDKLLLCDGCDDSYHTFCLIPPLSEVPKGDWRCPKCVAEECSKP-----REAFGFEQAVREYTLQSFGEMADSFKSDYFNMPVHMVPTELVEKEFWRLVSS--IEEDVIVEYGADISSRDFGSGFPVMDGRRKLTADEEDYAHCGWNLNNMPVLEQSVLAHINADISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEDVMRTLAPELFETQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLSMGRQCVSHYRRLRRHCVFSHEELIFKMASDPECLDVGLAAAVCKEMTIMIEEETKLRELI-----GVVQAEEEAFELVPDDERQCSSCRTTCFLSALTCS-CSLDQLV----CLNHAEELCSCP-MQNKCLRYRYSLEDLPSLLYGVKLRAQSYESWVNRV 629          

HSP 2 Score: 63.5438 bits (153), Expect = 6.068e-9
Identity = 39/123 (31.71%), Postives = 61/123 (49.59%), Query Frame = 1
Query: 3880 YCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKK---------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQTELGAAFAEYKRL 4221
            +C CRK      G  + C+LC+DWFH +C+ +      KK         KFLC QC RS+RP  E IL+    L++    +++PE  AL  +++R +++        +   EL  A A+   L
Sbjct:  982 FCVCRKAA---SGFMLQCELCKDWFHSTCVPLPKTSSQKKGSNWQSKDVKFLCTQCMRSRRPRLETILSLLVSLQKLP--VRLPEGEALQCLTERAMSWQDQARQALA-TDELSCALAKLSVL 1098          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Xenopus
Match: elp1 (elongator complex protein 1 [Source:Xenbase;Acc:XB-GENE-5813351])

HSP 1 Score: 591.652 bits (1524), Expect = 1.807e-179
Identity = 311/680 (45.74%), Postives = 420/680 (61.76%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQ---PKTMKYKTALTLESPKMTRSKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            F  PP  PVF P+ +EF DPL +I +IRP+A+K GICKI  PK W PPFA D  +F F PRVQRLNE+ A +R+K +F+  +  FWE Q + L IP+V    LD++ L   V   GG   VTK K+W+ +   +GY +  K   S+++ ++++I+ PY  F   +       L   N+Q   P+T                 K +IV   +   C  C        ++ C  CD  YH  C+ PPLS+VPK  W C +C+   C K       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV++  + +DV+V+YGADISS    SGFP    +      ++ Y   GWNLNN+PVL++S+   ++ DISGM VPW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ ED+MR  A ELFE  PDLLH + T +NP +L+++ + VYRT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL+ GR  V  YR ++R  VFSH ELI KMAS  E LD+ L  AV  EM I+ +EE   R+ I  +  GV + E    + +P+D+R+C  CRTT ++S +TCS C  D+L     CL+H  +LCSC   +N  L+YRYSL+++  L+  V  + + Y+ W++RV
Sbjct:    7 FVPPPECPVFEPSWEEFSDPLSFIGRIRPIAEKTGICKIRPPKDWQPPFACDVKSFCFTPRVQRLNELEAMTRVKLDFLDQLGKFWELQGSALRIPVVDRKLLDVYALSKVVSSEGGFEVVTKEKKWSQVGNRMGY-QPGKGTGSLLKLHYDRILYPYELFQSGV------SLMVRNVQKDLPET----------------EKKMIVDLYI---CLFCARGDCEDKLLLCDGCDDSYHTFCLIPPLSEVPKGDWRCPKCVAEECSKP-----REAFGFEQAVREYTLQSFGEMADSFKSDYFNMPVHMVPTELVEKEFWRLVSS--IEEDVIVEYGADISSRDFGSGFPVMDGRRKLTADEEDYAHCGWNLNNMPVLEQSVLAHINADISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEDVMRTLAPELFETQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLSMGRQCVSHYRRLRRHCVFSHEELIFKMASDPECLDVGLAAAVCKEMTIMIEEETKLRELIVQL--GVVQAEEEAFELVPDDERQCSSCRTTCFLSALTCS-CSLDQLV----CLNHAEELCSCP-MQNKCLRYRYSLEDLPSLLYGVKLRAQSYESWVNRV 645          

HSP 2 Score: 63.929 bits (154), Expect = 4.895e-9
Identity = 39/123 (31.71%), Postives = 61/123 (49.59%), Query Frame = 1
Query: 3880 YCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKK---------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQTELGAAFAEYKRL 4221
            +C CRK      G  + C+LC+DWFH +C+ +      KK         KFLC QC RS+RP  E IL+    L++    +++PE  AL  +++R +++        +   EL  A A+   L
Sbjct: 1047 FCVCRKAA---SGFMLQCELCKDWFHSTCVPLPKTSSQKKGSNWQSKDVKFLCTQCMRSRRPRLETILSLLVSLQKLP--VRLPEGEALQCLTERAMSWQDQARQALA-TDELSCALAKLSVL 1163          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Xenopus
Match: elp1 (elongator complex protein 1 [Source:Xenbase;Acc:XB-GENE-5813351])

HSP 1 Score: 591.652 bits (1524), Expect = 1.861e-179
Identity = 311/680 (45.74%), Postives = 420/680 (61.76%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQ---PKTMKYKTALTLESPKMTRSKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            F  PP  PVF P+ +EF DPL +I +IRP+A+K GICKI  PK W PPFA D  +F F PRVQRLNE+ A +R+K +F+  +  FWE Q + L IP+V    LD++ L   V   GG   VTK K+W+ +   +GY +  K   S+++ ++++I+ PY  F   +       L   N+Q   P+T                 K +IV   +   C  C        ++ C  CD  YH  C+ PPLS+VPK  W C +C+   C K       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV++  + +DV+V+YGADISS    SGFP    +      ++ Y   GWNLNN+PVL++S+   ++ DISGM VPW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ ED+MR  A ELFE  PDLLH + T +NP +L+++ + VYRT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL+ GR  V  YR ++R  VFSH ELI KMAS  E LD+ L  AV  EM I+ +EE   R+ I  +  GV + E    + +P+D+R+C  CRTT ++S +TCS C  D+L     CL+H  +LCSC   +N  L+YRYSL+++  L+  V  + + Y+ W++RV
Sbjct:    7 FVPPPECPVFEPSWEEFSDPLSFIGRIRPIAEKTGICKIRPPKDWQPPFACDVKSFCFTPRVQRLNELEAMTRVKLDFLDQLGKFWELQGSALRIPVVDRKLLDVYALSKVVSSEGGFEVVTKEKKWSQVGNRMGY-QPGKGTGSLLKLHYDRILYPYELFQSGV------SLMVRNVQKDLPET----------------EKKMIVDLYI---CLFCARGDCEDKLLLCDGCDDSYHTFCLIPPLSEVPKGDWRCPKCVAEECSKP-----REAFGFEQAVREYTLQSFGEMADSFKSDYFNMPVHMVPTELVEKEFWRLVSS--IEEDVIVEYGADISSRDFGSGFPVMDGRRKLTADEEDYAHCGWNLNNMPVLEQSVLAHINADISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEDVMRTLAPELFETQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLSMGRQCVSHYRRLRRHCVFSHEELIFKMASDPECLDVGLAAAVCKEMTIMIEEETKLRELIVQL--GVVQAEEEAFELVPDDERQCSSCRTTCFLSALTCS-CSLDQLV----CLNHAEELCSCP-MQNKCLRYRYSLEDLPSLLYGVKLRAQSYESWVNRV 645          

HSP 2 Score: 63.929 bits (154), Expect = 3.966e-9
Identity = 39/123 (31.71%), Postives = 61/123 (49.59%), Query Frame = 1
Query: 3880 YCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKK---------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQTELGAAFAEYKRL 4221
            +C CRK      G  + C+LC+DWFH +C+ +      KK         KFLC QC RS+RP  E IL+    L++    +++PE  AL  +++R +++        +   EL  A A+   L
Sbjct: 1047 FCVCRKAA---SGFMLQCELCKDWFHSTCVPLPKTSSQKKGSNWQSKDVKFLCTQCMRSRRPRLETILSLLVSLQKLP--VRLPEGEALQCLTERAMSWQDQARQALA-TDELSCALAKLSVL 1163          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Xenopus
Match: elp1 (elongator complex protein 1 [Source:Xenbase;Acc:XB-GENE-5813351])

HSP 1 Score: 595.89 bits (1535), Expect = 1.420e-178
Identity = 311/680 (45.74%), Postives = 420/680 (61.76%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQPKTMKYKTALTLESPKMTR---SKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            F  PP  PVF P+ +EF DPL +I +IRP+A+K GICKI  PK W PPFA D  +F F PRVQRLNE+ A +R+K +F+  +  FWE Q + L IP+V    LD++ L   V   GG   VTK K+W+ +   +GY +  K   S+++ ++++I+ PY             +LF   +       +    LE+  M R     AL V      +C  C        ++ C  CD  YH  C+ PPLS+VPK  W C +C+   C K       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV++  + +DV+V+YGADISS    SGFP    +      ++ Y   GWNLNN+PVL++S+   ++ DISGM VPW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ ED+MR  A ELFE  PDLLH + T +NP +L+++ + VYRT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL+ GR  V  YR ++R  VFSH ELI KMAS  E LD+ L  AV  EM I+ +EE   R+ I  +  GV + E    + +P+D+R+C  CRTT ++S +TCS C  D+L     CL+H  +LCSC   +N  L+YRYSL+++  L+  V  + + Y+ W++RV
Sbjct:    7 FVPPPECPVFEPSWEEFSDPLSFIGRIRPIAEKTGICKIRPPKDWQPPFACDVKSFCFTPRVQRLNELEAMTRVKLDFLDQLGKFWELQGSALRIPVVDRKLLDVYALSKVVSSEGGFEVVTKEKKWSQVGNRMGY-QPGKGTGSLLKLHYDRILYPY-------------ELFQSGVSLMVRNKRKTSKLEAFGMQRRHGKGALSVSFVDLYICLFCARGDCEDKLLLCDGCDDSYHTFCLIPPLSEVPKGDWRCPKCVAEECSKP-----REAFGFEQAVREYTLQSFGEMADSFKSDYFNMPVHMVPTELVEKEFWRLVSS--IEEDVIVEYGADISSRDFGSGFPVMDGRRKLTADEEDYAHCGWNLNNMPVLEQSVLAHINADISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEDVMRTLAPELFETQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLSMGRQCVSHYRRLRRHCVFSHEELIFKMASDPECLDVGLAAAVCKEMTIMIEEETKLRELIVQL--GVVQAEEEAFELVPDDERQCSSCRTTCFLSALTCS-CSLDQLV----CLNHAEELCSCP-MQNKCLRYRYSLEDLPSLLYGVKLRAQSYESWVNRV 657          

HSP 2 Score: 64.3142 bits (155), Expect = 4.013e-9
Identity = 39/123 (31.71%), Postives = 61/123 (49.59%), Query Frame = 1
Query: 3880 YCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKK---------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQTELGAAFAEYKRL 4221
            +C CRK      G  + C+LC+DWFH +C+ +      KK         KFLC QC RS+RP  E IL+    L++    +++PE  AL  +++R +++        +   EL  A A+   L
Sbjct: 1072 FCVCRKAA---SGFMLQCELCKDWFHSTCVPLPKTSSQKKGSNWQSKDVKFLCTQCMRSRRPRLETILSLLVSLQKLP--VRLPEGEALQCLTERAMSWQDQARQALA-TDELSCALAKLSVL 1188          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Mouse
Match: Kdm5a (lysine (K)-specific demethylase 5A [Source:MGI Symbol;Acc:MGI:2136980])

HSP 1 Score: 450.284 bits (1157), Expect = 2.570e-136
Identity = 229/475 (48.21%), Postives = 309/475 (65.05%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEF 2130
            +C  C    +   ++ C  CD  YH  C+ PPL DVPK  W C +C+   C K       E FGF Q+  +Y+L SF   ADNFK  YFN   ++   E VE+E+WRLV++  + +DV+V+YGADISS    SGFP +  Q     ++++Y  SGWNLNN+PVL++S+   ++ DISGM VPW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ E++MR+ A ELFE  PDLLH + T +NP +L+++ + VYRT+Q AGEFVVTFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  V  YR ++R  VFSH ELI KMA+  E LD+ L   V  E+ ++ +EE   R+ +  M  GV  +E  + + +P+D+R+C  CRTT ++S +TCS  C     +R+ CL H + LCSC   +N  L+YRY L+++  L+  V  + + Y  W++RV     + F
Sbjct:  295 VCMFCGRGNNEDKLLLCDGCDDSYHTFCLLPPLPDVPKGDWRCPKCVAEECNKP-----REAFGFEQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSS--IEEDVIVEYGADISSKDFGSGFPKKDGQRKMLPEEEEYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLRESVVQM--GVVMSEEEVFELVPDDERQCSACRTTCFLSALTCS--CN---PERLVCLYHPTDLCSCP-MQNKCLRYRYPLEDLPSLLYGVKVRAQSYDTWVNRVTEALSASF 754          

HSP 2 Score: 159.458 bits (402), Expect = 7.697e-39
Identity = 78/175 (44.57%), Postives = 110/175 (62.86%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFIN--KNPDL 597
            F  PP  PVF P+ +EF DPL +I +IRP A+K GICKI  PK W PPFA +  TF+F PRVQRLNE+ A +R++ +F+  +  FWE Q + L+IP+V+   LDL+ L   V   GG   VTK K+W+ +   LGY    K   S+++S++E+I+ PY  F   + +   + PDL
Sbjct:   13 FVPPPECPVFEPSWEEFTDPLSFIGRIRPFAEKTGICKIRPPKDWQPPFACEVKTFRFTPRVQRLNELEAMTRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEIVTKEKKWSKVGSRLGY-LPGKGTGSLLKSHYERILYPYELFQSGVSLMGVQMPDL 186          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Mouse
Match: Kdm5c (lysine (K)-specific demethylase 5C [Source:MGI Symbol;Acc:MGI:99781])

HSP 1 Score: 453.366 bits (1165), Expect = 4.941e-131
Identity = 219/467 (46.90%), Postives = 305/467 (65.31%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            +C++C        ++ C  CD  YHI C+ PPL ++PK  W C +C+   C++       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV   ++ +DV V+YGADI S    SGFP   ++     ++++Y  SGWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE  E++M++   ELF+  PDLLH + T +NP  L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  +E YR ++R  VFSH ELICKMA+  E LDL L  AV+ EM I+ QEE+  RK +  + +G+   ER   + +P+D+R+C+ C+TT ++S + C  C      D + CL H++ LC C+S     L+YRY+LDE+  ++  +  + E +  W ++V
Sbjct:  285 VCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRP-----PEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLV--NSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKAL--LEKGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDC-----PDGLVCLSHINDLCKCSSSRQY-LRYRYTLDELPAMLHKLKVRAESFDTWANKV 736          

HSP 2 Score: 109.383 bits (272), Expect = 5.419e-23
Identity = 59/158 (37.34%), Postives = 79/158 (50.00%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY 552
            F  PP  PVF P+  EF DPL YI KIRP+A+K GICKI  P  W PPFAV+   F+F PR+QRLNE                         LEI                V + GG   + K+++W  + + L Y    K + S++RS++E+I+ PY
Sbjct:    8 FLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDNFRFTPRIQRLNE-------------------------LEI----------------VVEEGGYETICKDRRWARVAQRLNY-PPGKNIGSLLRSHYERIVYPY 123          

HSP 3 Score: 57.7658 bits (138), Expect = 2.329e-7
Identity = 48/162 (29.63%), Postives = 71/162 (43.83%), Query Frame = 1
Query: 3805 ELEWMWNLRELNEDKAS-----KDSSGHDFYCFCRKRGMDQKGAQVM-CDLCQDWFHLSCLGIQNKDMSKK----------------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQ--TELGAAFAEYKR 4218
            E E +  LR  N  K S       +S     C C   G    G   + CDLCQDWFH  C+ +     S++                KFLCP C RS+RP  E ILA    L++    +++PE  AL  +++R I++      + + +  T L    AE ++
Sbjct: 1116 EKEGILQLRRTNSAKPSPLALLTTASSTASICVC---GQVPAGVGALQCDLCQDWFHGRCVTVPRLLSSQRSSLPSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQRLP--VRLPEGEALQCLTERAISWQGRARQVLASEEVTALLGRLAELRQ 1272          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Mouse
Match: Kdm5c (lysine (K)-specific demethylase 5C [Source:MGI Symbol;Acc:MGI:99781])

HSP 1 Score: 453.366 bits (1165), Expect = 8.784e-131
Identity = 219/467 (46.90%), Postives = 305/467 (65.31%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            +C++C        ++ C  CD  YHI C+ PPL ++PK  W C +C+   C++       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV   ++ +DV V+YGADI S    SGFP   ++     ++++Y  SGWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE  E++M++   ELF+  PDLLH + T +NP  L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  +E YR ++R  VFSH ELICKMA+  E LDL L  AV+ EM I+ QEE+  RK +  + +G+   ER   + +P+D+R+C+ C+TT ++S + C  C      D + CL H++ LC C+S     L+YRY+LDE+  ++  +  + E +  W ++V
Sbjct:  326 VCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRP-----PEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLV--NSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKAL--LEKGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDC-----PDGLVCLSHINDLCKCSSSRQY-LRYRYTLDELPAMLHKLKVRAESFDTWANKV 777          

HSP 2 Score: 160.999 bits (406), Expect = 1.092e-38
Identity = 73/158 (46.20%), Postives = 102/158 (64.56%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY 552
            F  PP  PVF P+  EF DPL YI KIRP+A+K GICKI  P  W PPFAV+   F+F PR+QRLNE+ A +R+K N++  I  FWE Q + L+IP V+   LDL+ L   V + GG   + K+++W  + + L Y    K + S++RS++E+I+ PY
Sbjct:    8 FLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYETICKDRRWARVAQRLNY-PPGKNIGSLLRSHYERIVYPY 164          

HSP 3 Score: 58.151 bits (139), Expect = 1.994e-7
Identity = 48/162 (29.63%), Postives = 71/162 (43.83%), Query Frame = 1
Query: 3805 ELEWMWNLRELNEDKAS-----KDSSGHDFYCFCRKRGMDQKGAQVM-CDLCQDWFHLSCLGIQNKDMSKK----------------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQ--TELGAAFAEYKR 4218
            E E +  LR  N  K S       +S     C C   G    G   + CDLCQDWFH  C+ +     S++                KFLCP C RS+RP  E ILA    L++    +++PE  AL  +++R I++      + + +  T L    AE ++
Sbjct: 1157 EKEGILQLRRTNSAKPSPLALLTTASSTASICVC---GQVPAGVGALQCDLCQDWFHGRCVTVPRLLSSQRSSLPSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQRLP--VRLPEGEALQCLTERAISWQGRARQVLASEEVTALLGRLAELRQ 1313          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Mouse
Match: Kdm5c (lysine (K)-specific demethylase 5C [Source:MGI Symbol;Acc:MGI:99781])

HSP 1 Score: 453.366 bits (1165), Expect = 9.680e-131
Identity = 219/467 (46.90%), Postives = 305/467 (65.31%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            +C++C        ++ C  CD  YHI C+ PPL ++PK  W C +C+   C++       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV   ++ +DV V+YGADI S    SGFP   ++     ++++Y  SGWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE  E++M++   ELF+  PDLLH + T +NP  L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  +E YR ++R  VFSH ELICKMA+  E LDL L  AV+ EM I+ QEE+  RK +  + +G+   ER   + +P+D+R+C+ C+TT ++S + C  C      D + CL H++ LC C+S     L+YRY+LDE+  ++  +  + E +  W ++V
Sbjct:  326 VCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRP-----PEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLV--NSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKAL--LEKGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDC-----PDGLVCLSHINDLCKCSSSRQY-LRYRYTLDELPAMLHKLKVRAESFDTWANKV 777          

HSP 2 Score: 160.999 bits (406), Expect = 1.122e-38
Identity = 73/158 (46.20%), Postives = 102/158 (64.56%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY 552
            F  PP  PVF P+  EF DPL YI KIRP+A+K GICKI  P  W PPFAV+   F+F PR+QRLNE+ A +R+K N++  I  FWE Q + L+IP V+   LDL+ L   V + GG   + K+++W  + + L Y    K + S++RS++E+I+ PY
Sbjct:    8 FLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYETICKDRRWARVAQRLNY-PPGKNIGSLLRSHYERIVYPY 164          

HSP 3 Score: 58.5362 bits (140), Expect = 1.658e-7
Identity = 66/265 (24.91%), Postives = 109/265 (41.13%), Query Frame = 1
Query: 3805 ELEWMWNLRELNEDKAS-----KDSSGHDFYCFCRKRGMDQKGAQVM-CDLCQDWFHLSCLGIQNKDMSKK----------------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQ--TELGAAFAEYKRLFGVQA------ILPKFNQSGTPTQQELSPILDQVQDASLLHLSTSKQSRKTPHCMSKNAVSTTNPIIP----PQINL-KSSPVPNKETLMNINRLKSSLSED 4494
            E E +  LR  N  K S       +S     C C   G    G   + CDLCQDWFH  C+ +     S++                KFLCP C RS+RP  E ILA    L++    +++PE  AL  +++R I++      + + +  T L    AE ++    ++        P     GT    ++  +L+           TS +   T     K  +   + I+P    P + L +++  P +E +M  + L+ +L E+
Sbjct: 1157 EKEGILQLRRTNSAKPSPLALLTTASSTASICVC---GQVPAGVGALQCDLCQDWFHGRCVTVPRLLSSQRSSLPSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQRLP--VRLPEGEALQCLTERAISWQGRARQVLASEEVTALLGRLAELRQRLQAESKPEESLAYPSDGGEGTGNMPKVQGLLENGDSV------TSPEKVATEEGSGKRDLELLSSILPQLSGPVLELPEATRAPLEELMMEGDLLEVTLDEN 1410          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Mouse
Match: Kdm5a (lysine (K)-specific demethylase 5A [Source:MGI Symbol;Acc:MGI:2136980])

HSP 1 Score: 454.521 bits (1168), Expect = 2.695e-130
Identity = 229/475 (48.21%), Postives = 309/475 (65.05%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEF 2130
            +C  C    +   ++ C  CD  YH  C+ PPL DVPK  W C +C+   C K       E FGF Q+  +Y+L SF   ADNFK  YFN   ++   E VE+E+WRLV++  + +DV+V+YGADISS    SGFP +  Q     ++++Y  SGWNLNN+PVL++S+   ++ DISGM VPW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ E++MR+ A ELFE  PDLLH + T +NP +L+++ + VYRT+Q AGEFVVTFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  V  YR ++R  VFSH ELI KMA+  E LD+ L   V  E+ ++ +EE   R+ +  M  GV  +E  + + +P+D+R+C  CRTT ++S +TCS  C     +R+ CL H + LCSC   +N  L+YRY L+++  L+  V  + + Y  W++RV     + F
Sbjct:  295 VCMFCGRGNNEDKLLLCDGCDDSYHTFCLLPPLPDVPKGDWRCPKCVAEECNKP-----REAFGFEQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSS--IEEDVIVEYGADISSKDFGSGFPKKDGQRKMLPEEEEYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLRESVVQM--GVVMSEEEVFELVPDDERQCSACRTTCFLSALTCS--CN---PERLVCLYHPTDLCSCP-MQNKCLRYRYPLEDLPSLLYGVKVRAQSYDTWVNRVTEALSASF 754          

HSP 2 Score: 161.384 bits (407), Expect = 9.183e-39
Identity = 78/175 (44.57%), Postives = 110/175 (62.86%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFIN--KNPDL 597
            F  PP  PVF P+ +EF DPL +I +IRP A+K GICKI  PK W PPFA +  TF+F PRVQRLNE+ A +R++ +F+  +  FWE Q + L+IP+V+   LDL+ L   V   GG   VTK K+W+ +   LGY    K   S+++S++E+I+ PY  F   + +   + PDL
Sbjct:   13 FVPPPECPVFEPSWEEFTDPLSFIGRIRPFAEKTGICKIRPPKDWQPPFACEVKTFRFTPRVQRLNELEAMTRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEIVTKEKKWSKVGSRLGY-LPGKGTGSLLKSHYERILYPYELFQSGVSLMGVQMPDL 186          

HSP 3 Score: 65.855 bits (159), Expect = 9.455e-10
Identity = 48/152 (31.58%), Postives = 75/152 (49.34%), Query Frame = 1
Query: 3805 ELEWMWNLRELNEDKASKDSSGHDF-YCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGI------------QNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQTELGAAFAEYKRL 4221
            E+E M +LR  N  K +      +  +C CRK      G  + C+LC+DWFH SC+ +            Q KD+   KFLCP C RS+RP  E IL+    L++    +++PE  AL  +++R +++        +   EL +A A+   L
Sbjct: 1137 EIEAMHSLRAANLAKMTIVERIEEVKFCICRKTA---SGFMLQCELCKDWFHNSCVPLPKSSSQKKGSSWQAKDV---KFLCPLCMRSRRPRLETILSLLVSLQKLP--VRLPEGEALQCLTERAMSWQDKARQALA-TDELSSALAKLSVL 1279          
BLAST of Lysine-specific demethylase 5A vs. UniProt/SwissProt
Match: sp|Q38JA7|KDM5C_CANLF (Lysine-specific demethylase 5C OS=Canis lupus familiaris OX=9615 GN=KDM5C PE=2 SV=1)

HSP 1 Score: 456.062 bits (1172), Expect = 1.030e-130
Identity = 220/467 (47.11%), Postives = 305/467 (65.31%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            +C++C        ++ C  CD  YHI C+ PPL ++PK  W C +C+   C++       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV   ++ +DV V+YGADI S    SGFP   N+     ++++Y  SGWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE  E++M++   ELF+  PDLLH + T +NP  L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  +E YR ++R  VFSH ELICKMA+  E LDL L  AV+ EM I+ QEE+  RK +  + +G+   ER   + +P+D+R+C+ C+TT ++S + C  C      D + CL H++ LC C+S     L+YRY+LDE+  ++  +  + E +  W ++V
Sbjct:  326 VCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRP-----PEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLV--NSIEEDVTVEYGADIHSKEFGSGFPVSDNKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKAL--LEKGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDC-----PDGLVCLSHINDLCKCSSSRQY-LRYRYTLDELPAMLHKLKVRAESFDTWANKV 777          

HSP 2 Score: 160.614 bits (405), Expect = 9.870e-38
Identity = 73/158 (46.20%), Postives = 102/158 (64.56%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY 552
            F  PP  PVF P+  EF DPL YI KIRP+A+K GICKI  P  W PPFAV+   F+F PR+QRLNE+ A +R+K N++  I  FWE Q + L+IP V+   LDL+ L   V + GG   + K+++W  + + L Y    K + S++RS++E+I+ PY
Sbjct:    8 FLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYEAICKDRRWARVAQRLNY-PPGKNIGSLLRSHYERIVYPY 164          
BLAST of Lysine-specific demethylase 5A vs. UniProt/SwissProt
Match: sp|Q30DN6|KDM5D_CANLF (Lysine-specific demethylase 5D OS=Canis lupus familiaris OX=9615 GN=KDM5D PE=2 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 1.191e-130
Identity = 219/467 (46.90%), Postives = 309/467 (66.17%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            +C+IC        ++ C  CD  YHI C+ PPL ++P+  W C +C+   C++       E FGF Q+  +Y+L SF   AD+FK  YF+   ++   E VE+E+WRLV++  + +DV V+YGADI S    SGFP  ++Q + + ++++Y  SGWNLN +PVL +S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ E++M++   ELF+  PDLLH + T +NP  L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  +E YR ++R  VFSH ELICKMA+  E LDL L  AV+ EM I+ QEE+  RK +  + +G+   ER   + +P+D+R+C+ C+TT ++S + C  C      D + CL H++ LC C+S     L+YRY+LDE+  ++  +  + E +  W ++V
Sbjct:  319 VCRICSRGDEDDKLLLCDGCDDTYHIFCLIPPLPEIPRGVWRCPKCIMAECKRP-----PEAFGFEQATQEYTLQSFGEMADSFKADYFSMPVHMVPTELVEKEFWRLVSS--IEEDVTVEYGADIHSKEFGSGFPVSSSQRILSPEEEEYATSGWNLNVMPVLDQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEQLEEVMKRLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAAFPEKLDLNLAVAVHKEMFIMVQEERRLRKAL--LEKGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDC-----PDGLVCLSHINDLCKCSSSRQ-YLRYRYTLDELPAMLHKLKIRAESFDTWANKV 770          

HSP 2 Score: 165.622 bits (418), Expect = 2.548e-39
Identity = 77/161 (47.83%), Postives = 104/161 (64.60%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDF 561
            F  PP  PVF PT  EF DPLDYI KIRP+A+K GICKI  P  W PPFAV+   F+F PR+QRLNE+ A +R+K N++  I  FWE Q + L+IP V+   LDL+ L   V + GG   + K+++W  + + L Y    K + S++RS++E+II PY  F
Sbjct:    8 FLPPPECPVFEPTWAEFRDPLDYITKIRPIAEKSGICKIRPPADWQPPFAVEVDNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVMEEGGYEAICKDRRWARVAQRLNY-PAGKNIGSLLRSHYERIIYPYEMF 167          
BLAST of Lysine-specific demethylase 5A vs. UniProt/SwissProt
Match: sp|P41229|KDM5C_HUMAN (Lysine-specific demethylase 5C OS=Homo sapiens OX=9606 GN=KDM5C PE=1 SV=2)

HSP 1 Score: 453.751 bits (1166), Expect = 5.754e-130
Identity = 219/467 (46.90%), Postives = 305/467 (65.31%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            +C++C        ++ C  CD  YHI C+ PPL ++PK  W C +C+   C++       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV   ++ +DV V+YGADI S    SGFP   ++     ++++Y  SGWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE  E++M++   ELF+  PDLLH + T +NP  L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  +E YR ++R  VFSH ELICKMA+  E LDL L  AV+ EM I+ QEE+  RK +  + +G+   ER   + +P+D+R+C+ C+TT ++S + C  C      D + CL H++ LC C+S     L+YRY+LDE+  ++  +  + E +  W ++V
Sbjct:  326 VCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRP-----PEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLV--NSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKAL--LEKGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDC-----PDGLVCLSHINDLCKCSSSRQY-LRYRYTLDELPAMLHKLKVRAESFDTWANKV 777          

HSP 2 Score: 160.229 bits (404), Expect = 1.123e-37
Identity = 73/158 (46.20%), Postives = 102/158 (64.56%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY 552
            F  PP  PVF P+  EF DPL YI KIRP+A+K GICKI  P  W PPFAV+   F+F PR+QRLNE+ A +R+K N++  I  FWE Q + L+IP V+   LDL+ L   V + GG   + K+++W  + + L Y    K + S++RS++E+I+ PY
Sbjct:    8 FLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYEAICKDRRWARVAQRLNY-PPGKNIGSLLRSHYERIVYPY 164          

HSP 3 Score: 58.5362 bits (140), Expect = 1.113e-6
Identity = 41/131 (31.30%), Postives = 60/131 (45.80%), Query Frame = 1
Query: 3883 CFCRKRGMDQKGAQVM-CDLCQDWFHLSCLGIQNKDMSKK----------------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQ--TELGAAFAEYKR 4218
            C C   G    GA  + CDLCQDWFH  C+ +     S +                KFLCP C RS+RP  E ILA    L++    +++PE  AL  +++R I++        + +  T L    AE ++
Sbjct: 1188 CVC---GQVLAGAGALQCDLCQDWFHGRCVSVPRLLSSPRPNPTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQRLP--VRLPEGEALQCLTERAISWQGRARQALASEDVTALLGRLAELRQ 1313          
BLAST of Lysine-specific demethylase 5A vs. UniProt/SwissProt
Match: sp|P41230|KDM5C_MOUSE (Lysine-specific demethylase 5C OS=Mus musculus OX=10090 GN=Kdm5c PE=1 SV=4)

HSP 1 Score: 453.366 bits (1165), Expect = 6.771e-130
Identity = 219/467 (46.90%), Postives = 305/467 (65.31%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            +C++C        ++ C  CD  YHI C+ PPL ++PK  W C +C+   C++       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV   ++ +DV V+YGADI S    SGFP   ++     ++++Y  SGWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE  E++M++   ELF+  PDLLH + T +NP  L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  +E YR ++R  VFSH ELICKMA+  E LDL L  AV+ EM I+ QEE+  RK +  + +G+   ER   + +P+D+R+C+ C+TT ++S + C  C      D + CL H++ LC C+S     L+YRY+LDE+  ++  +  + E +  W ++V
Sbjct:  326 VCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCVMAECKRP-----PEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTELVEKEFWRLV--NSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDLNLAAAVHKEMFIMVQEERRLRKAL--LEKGITEAEREAFELLPDDERQCIKCKTTCFLSALACYDC-----PDGLVCLSHINDLCKCSSSRQY-LRYRYTLDELPAMLHKLKVRAESFDTWANKV 777          

HSP 2 Score: 160.999 bits (406), Expect = 7.848e-38
Identity = 73/158 (46.20%), Postives = 102/158 (64.56%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY 552
            F  PP  PVF P+  EF DPL YI KIRP+A+K GICKI  P  W PPFAV+   F+F PR+QRLNE+ A +R+K N++  I  FWE Q + L+IP V+   LDL+ L   V + GG   + K+++W  + + L Y    K + S++RS++E+I+ PY
Sbjct:    8 FLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVVEEGGYETICKDRRWARVAQRLNY-PPGKNIGSLLRSHYERIVYPY 164          

HSP 3 Score: 58.5362 bits (140), Expect = 1.160e-6
Identity = 66/265 (24.91%), Postives = 109/265 (41.13%), Query Frame = 1
Query: 3805 ELEWMWNLRELNEDKAS-----KDSSGHDFYCFCRKRGMDQKGAQVM-CDLCQDWFHLSCLGIQNKDMSKK----------------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQ--TELGAAFAEYKRLFGVQA------ILPKFNQSGTPTQQELSPILDQVQDASLLHLSTSKQSRKTPHCMSKNAVSTTNPIIP----PQINL-KSSPVPNKETLMNINRLKSSLSED 4494
            E E +  LR  N  K S       +S     C C   G    G   + CDLCQDWFH  C+ +     S++                KFLCP C RS+RP  E ILA    L++    +++PE  AL  +++R I++      + + +  T L    AE ++    ++        P     GT    ++  +L+           TS +   T     K  +   + I+P    P + L +++  P +E +M  + L+ +L E+
Sbjct: 1157 EKEGILQLRRTNSAKPSPLALLTTASSTASICVC---GQVPAGVGALQCDLCQDWFHGRCVTVPRLLSSQRSSLPSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQRLP--VRLPEGEALQCLTERAISWQGRARQVLASEEVTALLGRLAELRQRLQAESKPEESLAYPSDGGEGTGNMPKVQGLLENGDSV------TSPEKVATEEGSGKRDLELLSSILPQLSGPVLELPEATRAPLEELMMEGDLLEVTLDEN 1410          
BLAST of Lysine-specific demethylase 5A vs. UniProt/SwissProt
Match: sp|Q3UXZ9|KDM5A_MOUSE (Lysine-specific demethylase 5A OS=Mus musculus OX=10090 GN=Kdm5a PE=1 SV=2)

HSP 1 Score: 454.521 bits (1168), Expect = 1.885e-129
Identity = 229/475 (48.21%), Postives = 309/475 (65.05%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEF 2130
            +C  C    +   ++ C  CD  YH  C+ PPL DVPK  W C +C+   C K       E FGF Q+  +Y+L SF   ADNFK  YFN   ++   E VE+E+WRLV++  + +DV+V+YGADISS    SGFP +  Q     ++++Y  SGWNLNN+PVL++S+   ++ DISGM VPW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ E++MR+ A ELFE  PDLLH + T +NP +L+++ + VYRT+Q AGEFVVTFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  V  YR ++R  VFSH ELI KMA+  E LD+ L   V  E+ ++ +EE   R+ +  M  GV  +E  + + +P+D+R+C  CRTT ++S +TCS  C     +R+ CL H + LCSC   +N  L+YRY L+++  L+  V  + + Y  W++RV     + F
Sbjct:  295 VCMFCGRGNNEDKLLLCDGCDDSYHTFCLLPPLPDVPKGDWRCPKCVAEECNKP-----REAFGFEQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSS--IEEDVIVEYGADISSKDFGSGFPKKDGQRKMLPEEEEYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLRESVVQM--GVVMSEEEVFELVPDDERQCSACRTTCFLSALTCS--CN---PERLVCLYHPTDLCSCP-MQNKCLRYRYPLEDLPSLLYGVKVRAQSYDTWVNRVTEALSASF 754          

HSP 2 Score: 161.384 bits (407), Expect = 6.423e-38
Identity = 78/175 (44.57%), Postives = 110/175 (62.86%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFIN--KNPDL 597
            F  PP  PVF P+ +EF DPL +I +IRP A+K GICKI  PK W PPFA +  TF+F PRVQRLNE+ A +R++ +F+  +  FWE Q + L+IP+V+   LDL+ L   V   GG   VTK K+W+ +   LGY    K   S+++S++E+I+ PY  F   + +   + PDL
Sbjct:   13 FVPPPECPVFEPSWEEFTDPLSFIGRIRPFAEKTGICKIRPPKDWQPPFACEVKTFRFTPRVQRLNELEAMTRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEIVTKEKKWSKVGSRLGY-LPGKGTGSLLKSHYERILYPYELFQSGVSLMGVQMPDL 186          

HSP 3 Score: 65.855 bits (159), Expect = 6.614e-9
Identity = 48/152 (31.58%), Postives = 75/152 (49.34%), Query Frame = 1
Query: 3805 ELEWMWNLRELNEDKASKDSSGHDF-YCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGI------------QNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQTELGAAFAEYKRL 4221
            E+E M +LR  N  K +      +  +C CRK      G  + C+LC+DWFH SC+ +            Q KD+   KFLCP C RS+RP  E IL+    L++    +++PE  AL  +++R +++        +   EL +A A+   L
Sbjct: 1137 EIEAMHSLRAANLAKMTIVERIEEVKFCICRKTA---SGFMLQCELCKDWFHNSCVPLPKSSSQKKGSSWQAKDV---KFLCPLCMRSRRPRLETILSLLVSLQKLP--VRLPEGEALQCLTERAMSWQDKARQALA-TDELSSALAKLSVL 1279          
BLAST of Lysine-specific demethylase 5A vs. TrEMBL
Match: A0A3Q3RSB5 (Lysine (K)-specific demethylase 5Ba OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 436/1411 (30.90%), Postives = 673/1411 (47.70%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINK------------NPDLFPE--NIQPKTMKYKTALTLESPKMTRSKALIVQKPVNELCK----------------------------ICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEM-MIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLLQIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLSSHKAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIVSSHEEQAEKLTLGEMRLLVEKLRSLPAHVPQLEEAAQTLHSINEWRKKVRMTVSCVDVIEENVITNLVESGESNLVYLSEYQMLQKMRLYTVWIGKSRQL-FKSSEHCPPPPLDEFRKVRDEGIGLINTIEIDRIXXXXXXXXXXXXXXXXXXXXXXXXFRMSGWRILVDNLQKNEKQLSKIIIDGDAMQKKAEDILKSTPGVFALFSLNSLLKSADAELKCTVPGIDRLKEVVNEA---VIVNEGINEMWQKLQQCRRLVHVEEMQTLIKQADSLCVAFDRLSDLKSLFRTIDAWKKNLHGLF-IKNSHNSYLTTPTLLEVLFPRPQRQFKLMIAREAVSSKLVDDCKTESTMKESSVKDEPESCDEEKQTDDQKSIKTNRSCRKSRGRQKRSSLAPDDPQIARLDNVVVFESHLRSGYVGESEFNGNYKKMCVNELEWMWNLRELNEDKASKDSSGHDFY----CFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFH 4152
            F  PP  PVF P+ +EF DP  YI KIRP+A+K GICKI  P +W PPFA D    KF PR+QRLNE+ A +R+K NF+  I  FWE Q   L+IP V+   LDL++L+  V + GG   V K+++WT I  ++G+    K + S +R+++E+I+ PY  F     + K             P   P+  ++QP+    +T       K  +S+  +V+    E CK                            +C S +S   ++ C  CD  YHI C+ PPL DVPK  W C +CL   C K         FGF Q+   Y+L +F   AD+FK  YFN   ++   E VE+E+WRLV+   + +DV V+YGADI+S    SGFP R +    + +D+ Y+ SGWNLNN+PVL  S+   V+ DI GM +PW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYG P   AE  E +M++ A ELFE  PDLLH + T +NP  L+ N + +YRT+Q AGEFV+TFPRAYH+GFNQGFNFAEAVNFC  DWL  GR  V+ YR + R  VFSH+E+IC MA   +++D+ L  A++ +M  +IQ+EE+L +K   T   GV ++ ++  + +P+++R+C  C TT Y+SG+TC+   Q     +  CL H   LCSC  + N+ L Y+++LDE+  ++ ++  + E YK W                        +R+V   +EN         NK  E + NL  L  + Q    +     LLD L  +     +   +  QLL+  +                                  ++  +      +   +LT+ E+R  V +L SLP ++ Q       L  +++++++    +S  +      + +L++      V L +  +L++      W+    Q   +    C    LD  R++ D+G+GL     ++R                                           +L +++   +  +++   ++++ P   +L +L++ L+  +  +   +P   +LK+VV +A   +   E +   +       R+  +E +  L+ +AD + V  D LS L++L   +  WK++    F +KNS  S      LLEVL P+                     C   +  ++S  K       E  Q   + S K    C   R   +    A          + +V  + +R                   E+E +  LR  NE   SK   G + Y    C C+K      GA V C+LC+D FH  C+         + +LCP C++S++PP + +L     L++    +++PE  AL  + +R + + 
Sbjct:    9 FIPPPECPVFEPSWEEFADPFAYINKIRPIAEKTGICKIRPPPEWQPPFACDVDRLKFTPRIQRLNELEAQTRVKLNFLDQIAKFWELQGCTLKIPHVERKILDLYQLNKLVNEEGGFDAVCKDRRWTKISVKMGFA-PGKAIGSHLRAHYERILYPYNLFQTGSNLPKATLTNDTKDKEYTPHDLPQRQSVQPQ----ETCSIARRAKRMKSEVSLVKAEPGEFCKTRPNLRRRMGTYSYQKNCFTQVDHYMCLVCGSGSSEDRLLLCDGCDDSYHIFCLIPPLHDVPKGDWRCPKCLAQECGKPPV-----AFGFEQAGRSYTLQAFGDMADSFKSDYFNMPVHMVPTELVEKEFWRLVS--TIEEDVTVEYGADIASKEFGSGFPVRNSHFQVSPEDEHYLTSGWNLNNMPVLDASVLTHVTADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGAPGYAAEHLEAVMKKLAPELFESQPDLLHQLVTIMNPNTLMNNGVPIYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTMDWLPIGRNCVKHYRQLSRYCVFSHDEMICNMACKADTMDVDLASAIHKDMTTMIQEEEELRQK---TKKMGVVQSRQVDYEVLPDEERQCCKCWTTCYLSGITCACSPQ-----KTVCLYHTQNLCSCP-QSNLTLHYKFTLDELYSMMVSIKLRAESYKDW------------------------VRSVEEILENK-------GNKKRENEKNLHSL--VEQAETKVFSHTSLLDQLRTVTSEADKVAVVAQQLLNGKR----------------------------------QTRYRSGGGKSQNQNELTVEELRGFVRQLDSLPCNIRQAPLLKDLLTRVDDFQQRSERLLS-DESPSPLELQDLLDVSLGLDVELPQLPLLRERLEQARWLEAVHQASGRPDSLC----LDTMRRLIDQGVGLAPHSSVERAMA----------------------------------------RLQELLTVSEQWEERVLSLMEARP-YHSLDTLDAALQEVE-NIPAYLPNCLQLKDVVTKAKKWLHEAEALQVKYTCTYLGGRIPVLESLSELVLRADGIPVKLDPLSRLEALINDVQMWKESAAKTFLLKNSPFS------LLEVLCPK---------------------CDIGAGYQKSRSK----KIKEAPQISKKSSTKLESVCDVERALSESKDSA----------SAMVTLAEVRQ-----------------REMEILLALRASNE---SKFLPGENCYALSVCVCQKA---PSGAMVQCELCRDIFHCGCVETTVDLEYGQAWLCPLCQQSRKPPLDKVLPLLASLQR--IRVRLPEGDALRFLIERTVRWQ 1218          
BLAST of Lysine-specific demethylase 5A vs. TrEMBL
Match: A0A5G3J7Q8 (Elongator complex protein 1 OS=Xenopus tropicalis OX=8364 GN=elp1 PE=4 SV=1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 311/680 (45.74%), Postives = 420/680 (61.76%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQPKTMKYKTALTLESPKMTR---SKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            F  PP  PVF P+ +EF DPL +I +IRP+A+K GICKI  PK W PPFA D  +F F PRVQRLNE+ A +R+K +F+  +  FWE Q + L IP+V    LD++ L   V   GG   VTK K+W+ +   +GY +  K   S+++ ++++I+ PY             +LF   +       +    LE+  M R     AL V      +C  C        ++ C  CD  YH  C+ PPLS+VPK  W C +C+   C K       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV++  + +DV+V+YGADISS    SGFP    +      ++ Y   GWNLNN+PVL++S+   ++ DISGM VPW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ ED+MR  A ELFE  PDLLH + T +NP +L+++ + VYRT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL+ GR  V  YR ++R  VFSH ELI KMAS  E LD+ L  AV  EM I+ +EE   R+ I  +  GV + E    + +P+D+R+C  CRTT ++S +TCS C  D+L     CL+H  +LCSC   +N  L+YRYSL+++  L+  V  + + Y+ W++RV
Sbjct:    7 FVPPPECPVFEPSWEEFSDPLSFIGRIRPIAEKTGICKIRPPKDWQPPFACDVKSFCFTPRVQRLNELEAMTRVKLDFLDQLGKFWELQGSALRIPVVDRKLLDVYALSKVVSSEGGFEVVTKEKKWSQVGNRMGY-QPGKGTGSLLKLHYDRILYPY-------------ELFQSGVSLMVRNKRKTSKLEAFGMQRRHGKGALSVSFVDLYICLFCARGDCEDKLLLCDGCDDSYHTFCLIPPLSEVPKGDWRCPKCVAEECSKP-----REAFGFEQAVREYTLQSFGEMADSFKSDYFNMPVHMVPTELVEKEFWRLVSS--IEEDVIVEYGADISSRDFGSGFPVMDGRRKLTADEEDYAHCGWNLNNMPVLEQSVLAHINADISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEDVMRTLAPELFETQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLSMGRQCVSHYRRLRRHCVFSHEELIFKMASDPECLDVGLAAAVCKEMTIMIEEETKLRELIVQL--GVVQAEEEAFELVPDDERQCSSCRTTCFLSALTCS-CSLDQLV----CLNHAEELCSCP-MQNKCLRYRYSLEDLPSLLYGVKLRAQSYESWVNRV 657          
BLAST of Lysine-specific demethylase 5A vs. TrEMBL
Match: A0A4W5MGS8 (Lysine (K)-specific demethylase 5C OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 305/708 (43.08%), Postives = 434/708 (61.30%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDN-----------IFINKNPDLFPENIQPKTMKYKTALTLESPKMT------RSKALIVQKPVNE-------------LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMV-QGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            F  PP  PVF P+ +EF+DPL YI KIRP+A+K GICKI  P  W PPFAV+  +F+F PR+QRLNE+ A +R+K N++  I  FWE Q + L+IP ++   LDLF L   V + GG   V+K ++W  + ++LGY    K + S++RS++E+I+ P+  F+             + +   PD   E+++      K  +    PKM       R+K++  +                  +C++C        ++ C  CD  YH  C+ PPL++ PK  W C +C+   C+K       E FGF Q+  +Y+L SF   AD +K  YFN   ++   E VE+E+WRLV++  + +DV V+YGADI S    SGFP    +   ++++  Y  SGWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ E++M++   ELFE  PDLLH + T +NP +L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR+ +E YR ++R  VFSH EL CKMA+  E LDL L  A + EM II QEE+  +  +C +V QG+   ER   + +P+D+R+C  C+TT ++S + CS C      +R+ CL H   LCSC + + + L+YRY+LDE+  ++  +  + E +  W +RV
Sbjct:   12 FVPPPECPVFEPSWEEFQDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDSFRFTPRIQRLNELEAETRVKLNYLDRIAKFWEIQGSSLKIPNIERRILDLFSLSKVVIEEGGFDIVSKERRWARVAQKLGY-PTGKNIGSLLRSHYERIVYPFEVFHAGASLPVTLHSPTLLLPFCPDPTEEDMEKNPELKKLQIYGAGPKMMGLGLVPRNKSIPKKGNTTHPPPCLTTGCVDSFVCRMCGRGDEDEKLLLCDGCDDNYHTFCLLPPLTEAPKGNWRCPKCVAEECKKP-----AEAFGFEQATREYTLQSFGEMADTYKADYFNMPVHMVPTELVEKEFWRLVSS--IEEDVTVEYGADIHSKEFGSGFPMNNGKKNLSQEEADYARSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSVAAERLEEVMKKLTPELFESQPDLLHQLVTIMNPNILMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRSCIEHYRRLRRYCVFSHEELTCKMAACPEKLDLNLAAATHREMFIIVQEER--KLPLCVVVSQGITEAEREAFELLPDDERQCDNCKTTCFLSALACSNC-----PERLVCLYHTQDLCSCPT-DKLYLRYRYTLDELFAMLHRLKVRAEVFDSWANRV 703          
BLAST of Lysine-specific demethylase 5A vs. TrEMBL
Match: A0A4W5NQB8 (Lysine (K)-specific demethylase 5C OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 306/698 (43.84%), Postives = 425/698 (60.89%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIF------------------INKNPDLFPENI---QPKTMKYKTALTLESPKMTRSKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            F  PP  PVF P+ +EF+DPL YI KIRP+A+K GICKI  P  W PPFAV+  +F+F PR+QRLNE+ A +R+K N++  I  FWE Q + L+IP ++   LDLF L   V + GG   V+K ++W  + ++LGY    K + S++RS++E+I+ P+  F+                      I KNP+L    I    PK M     L L +  +     L   K  + +C++C        ++ C  CD  YH  C+ PPL++ PK  W C +C+   C++       E FGF Q+  +Y+L SF   AD FK  YFN   ++   E VE E+WRLV++  + +DV V+YGADI S    SGFP        ++++  Y  SGWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ E++M++   ELFE  PDLLH + T +NP +L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR+ +E YR ++R  VFSH EL CKMA+  E LDL L  A + EM  I QEE+  RK +        R ER   + +P+D+R+C  C+TT ++S + CS C      +R+ CL H   LC+C + + + L+YRY+LDE+  ++  +  + E +  W +RV
Sbjct:   10 FVPPPECPVFEPSWEEFKDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDSFRFTPRIQRLNELEAETRVKLNYLDRIAKFWEIQGSSLKIPNIERRILDLFSLSKVVIEEGGFDIVSKERRWARVAQKLGY-PPGKNIGSLLRSHYERIVYPFEVFHTGASLPVMLLTHFALPDPTEEDIEKNPELKKLQIYGAGPKMM----GLGLVTLILFHLSVLCSAKVDSFVCRMCGRGDEDEKLLLCDGCDDNYHTFCLLPPLTEAPKGNWRCPKCVAEECKRP-----AEAFGFEQATREYTLQSFGEMADTFKADYFNMPVHMVPTELVEREFWRLVSS--IEEDVTVEYGADIHSKDFGSGFPMNNGMKNLSQEETDYAQSGWNLNVMPVLEQSLLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSVAAEQLEEVMKKLTPELFEFQPDLLHQLVTIMNPNILMAHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRSCIEHYRRLRRYCVFSHEELTCKMAACPEKLDLNLAAATHREMFSIVQEERELRKGLLE------RAEREAFELLPDDERQCDNCKTTCFLSALACSNC-----TERLVCLYHTQDLCNCPT-DKLYLRYRYTLDELLAMLHRLKVRAESFDSWANRV 683          
BLAST of Lysine-specific demethylase 5A vs. TrEMBL
Match: A0A4W5MGQ7 (Lysine (K)-specific demethylase 5C OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 597.43 bits (1539), Expect = 1.235e-179
Identity = 305/702 (43.45%), Postives = 433/702 (61.68%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDF-------------YDNIFINK--NPDLFP--ENIQPKTMK-YKTALTLESPKMTRSKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSE 2127
            F  PP  PVF P+ +EF+DPL YI KIRP+A+K GICKI  P  W PPFAV+  +F+F PR+QRLNE+ A +R+K N++  I  FWE Q + L+IP ++   LDLF L   V + GG   V+K ++W  + ++LGY    K + S++RS++E+I+ P+  F             YD   +++   P   P  +++QP  M  Y        P ++   + +        C++C        ++ C  CD  YH  C+ PPL++ PK  W C +C+   C+K       E FGF Q+  +Y+L SF   AD +K  YFN   ++   E VE+E+WRLV++  + +DV V+YGADI S    SGFP    +   ++++  Y  SGWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ E++M++   ELFE  PDLLH + T +NP +L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR+ +E YR ++R  VFSH EL CKMA+  E LDL L  A + EM II QEE+  RK +  + +G+   ER   + +P+D+R+C  C+TT ++S + CS C      +R+ CL H   LCSC + + + L+YRY+LDE+  ++  +  + E +  W +RV    + E
Sbjct:    6 FVPPPECPVFEPSWEEFQDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDSFRFTPRIQRLNELEAETRVKLNYLDRIAKFWEIQGSSLKIPNIERRILDLFSLSKVVIEEGGFDIVSKERRWARVAQKLGY-PTGKNIGSLLRSHYERIVYPFEVFHAGASLPQTKAKLYDGEEVDREYKPHSIPLRQSVQPSKMSSYGRRANRLQPDVSYVDSFV--------CRMCGRGDEDEKLLLCDGCDDNYHTFCLLPPLTEAPKGNWRCPKCVAEECKKP-----AEAFGFEQATREYTLQSFGEMADTYKADYFNMPVHMVPTELVEKEFWRLVSS--IEEDVTVEYGADIHSKEFGSGFPMNNGKKNLSQEEADYARSGWNLNVMPVLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSVAAERLEEVMKKLTPELFESQPDLLHQLVTIMNPNILMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRSCIEHYRRLRRYCVFSHEELTCKMAACPEKLDLNLAAATHREMFIIVQEERKLRKGL--LERGITEAEREAFELLPDDERQCDNCKTTCFLSALACSNC-----PERLVCLYHTQDLCSCPT-DKLYLRYRYTLDELFAMLHRLKVRAEVFDSWANRVKEALEQE 683          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Cavefish
Match: kdm5bb (lysine-specific demethylase 5B-B-like [Source:NCBI gene;Acc:103026437])

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 450/1458 (30.86%), Postives = 679/1458 (46.57%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKN-------------------------PDLFPENIQPKTMKYKTALT--------------------LESPKMTRSKALIVQKPVNELCKICE-------------SPTSPSTMVTCFEC---------------DCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLLQIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLSSHKAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIVSSHEEQAEKLTLGEMRLLVEKLRSLP---AHVPQLEEAAQTLHSINEWRKKVRMTVSCVDVIEENVITNLVESGESNLVYLSEYQMLQKMRLYTVWIGKSRQLFKSSEHCPPPPLDEFRKVRDEGIGLINTIEIDRIXXXXXXXXXXXXXXXXXXXXXXXXFRMSGWRILVDNLQKNEKQLSKIIIDGDAMQKKAEDILKSTPGVFALFSLNSLLKSADAELKCTVPGIDRLKEVVNEAVIVNEGINEMWQKLQQCRRLVHVEEMQTLIKQADSLCVAFDRLSDLKSLFRTIDAWKKNLHGLFIKNSHNSYLTTPTLLEVLFPRPQRQFKLMIAREAVSSKLVDDCKTESTMKESSVKDEPESCDEEKQTDDQKSIKTNRSCRKSRG-----RQKRSSLAPDDPQIARLDNVVVFESHLRSGYVGESEFNGNYKKMCVNELEWMWNLRELNEDKASKDS-SGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHL-----FSPQTE 4188
            F+ PP  PVF P+ +EF DP  +I KIRP+A+K GICK+  P  W PPFA D     F PR+QRLNE+ A +R+K NF+  I  FWE Q   L+IP V+   LDL++L+  V   GG   V K ++WT I   +G+    K + S +RS++E+++ PY     N+F + N                         PD    + + K MK +  L                     L   K+      I Q+PV    K+ +             +P  P  +  C  C               D  YH  C+ PPL+D+PK  W C +CL   C K       E FGF Q+   YSL +F   AD+FK  YFN   ++   E VE+E+WRLV    + +DV V+YGADI+S    SGFP R  +      D+KY+  GWNLNN+ ++  S+   V+ DI GMT+PW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYG P   AE+ E +M++ A ELFE  PDLLH + T +NP  L+   + +YRT+Q AGEFV+TFPRAYH+GFNQGFNFAEAVNFC  DW+  GR  V+ YRL+ R  VFSH+E+IC MA+    LD++L  +V+ +M+++  EE+  R QI  +  GV + E    D + +D+R+C+ CRTT Y+S +TC     +++     CL H   LCSC    N  LKYR++LD++  +++ V ++ E Y +W S V  + +++        ++ R +    S IE  D  +  F + +                         LL  L+ + +  +R  ++  QLL+  +                                  ++  +I     +   +L++ EMR  V +L +LP      P L+E    +    +  +KV       D++ E  I  L++      V L E   L++      W+G  ++   SS       LD  R++ D G+GL      +R                                           +L +++   +  +++A+ +LK+ P   +L SL+  LK  D+ +   +P    L++ V  A    E + E  + LQ   R+  ++ +  ++ +  ++ V  + L  L++L   +  W+++    F+  S +SY    TLLEVL PR                     C+  +++K                          R  +K++G      +KRS          RLD++   E  L       S       ++ V ELE + +LR  NE K    + SG    C C+K  M   GA   C+LC++ FH  C G      S K +LCP C RS +PP E IL     L++    +++PE  AL  M +R +++ +    +      SPQ++
Sbjct:    9 FQPPPECPVFEPSWEEFADPFAFINKIRPIAEKTGICKVRPPPDWQPPFACDVDRLHFTPRIQRLNELEAQTRVKLNFLDQIAKFWELQGCTLKIPHVERKILDLYQLNKLVADEGGFELVCKERRWTKIAMTMGFA-PGKAVGSHLRSHYERVLYPY-----NLFQSGNHSLPESDEKEYKPHDLVQRQNTQVPPDASTPSRRAKRMKAEVKLNSVQFNFISIALFTTEVVTKQLYREKLKEIPIQIKQEPVES--KVVQPEPEKTKPRQKKNTPPPPVDLYVCLVCGNGNDEDRLLLCDGCDDSYHTFCLIPPLTDIPKGDWRCPKCLAQECSKP-----QEAFGFEQARRDYSLKAFGEMADSFKSDYFNMPVHMVPTELVEKEFWRLV--RTIEEDVTVEYGADIASKEFGSGFPIRGGRFKVAPHDEKYLSCGWNLNNMAMMDPSVLTHVTADICGMTLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGAPGFAAEQLEAVMKKLAPELFESQPDLLHQLVTIMNPNTLMSYGVPIYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWMPLGRQCVDHYRLLHRYCVFSHDEMICNMAAKANKLDVVLASSVHKDMVLMINEERDLRDQIRKL--GVVQCELFEYDLLQDDERQCVKCRTTCYLSALTCPCRPGEQV-----CLHHARHLCSCPIS-NYTLKYRFTLDDLYPMMNAVKQRAESYDVWASHVSEVLEAKL-------DKKRNLTVFRSLIEESD--KGSFPDND-------------------------LLRHLKLVTQDAERCSSVAQQLLTGKR----------------------------------QTRYRIAGGKTQN--QLSVEEMRSFVRQLYNLPCSLTQAPLLKELLNRIEDFQQHSEKVLSDDVSPDLVGE--IQALLDESSEFDVSLPEVSQLRERLELAHWLGAVQRAEDSSSSPRGLSLDGMRRLIDRGVGLTPHPSTERAMA----------------------------------------RLQELLTLSEQWEERAQTLLKTRPPE-SLTSLSGTLKEVDS-VPTYLPNCLLLRDSVQRA---TEWLKEA-EALQVGGRVPVLDTLSDMVLRGRAIPVQLEPLERLEALVSEVQTWRESAAKTFLMKS-SSY----TLLEVLCPR---------------------CEVGNSVK--------------------------RKVKKTKGDVMPCGKKRS---------GRLDSLSDVEKALSDSKDSASAM-ATLAEVRVKELESLASLRAANESKLLPSADSGALRVCVCQKAPM---GAMHQCELCRETFHTVCTGGPADPRSAKPWLCPSCHRSSKPPLEKILPLLASLQR--IRVRLPEGDALRYMIERTVSWQRRAREVMASYELSPQSQ 1258          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Cavefish
Match: kdm5a (lysine (K)-specific demethylase 5A [Source:ZFIN;Acc:ZDB-GENE-150114-1])

HSP 1 Score: 583.948 bits (1504), Expect = 9.021e-175
Identity = 312/731 (42.68%), Postives = 424/731 (58.00%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY---------------LDFYDN--------IFINKNPDLF-----------------------PENIQPKTMKYKTALTLESPKMTRSKALIVQKPVNE--------LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            F  PP  PVF P+ ++F DPL YI KIRP+A+K GICKI  P+ W PPFA D   F+F PRVQRLNE+ A +RIK NF+  I  FWE Q + L  P V+   LDL+ L   V   GG   V K K+W+ I   +G+    K   +++RS+F++I+ PY               LDF  +        +    NP L+                        EN +PKT++    +   SPK+   + +   K ++         +C  C        ++ C  CD  YH  C+ PPL DVPK  W C +C+   C K       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV++  + +DV+V+YGADI S    SGFP R  +      +++Y +SGWNLNN+PVL++S+   ++ DISGM VPW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ E +M++ A ELF+  PDLLH + T +NP +L+++ + VYRT+Q AGEFVVTFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  V  YR ++R  VFSH EL+CKMA+  ESLD+ L  AVY E+  +  EE   R+ +  M  GV   E+ + + +P+D+R+C  C+TT ++S +TC         DR+ CL H + LC C       L+YRY  +E   ++  V  + + Y+ W  RV
Sbjct:    7 FVPPPECPVFEPSWEDFSDPLGYISKIRPIAEKSGICKIRPPQDWQPPFACDVRNFRFTPRVQRLNELEALTRIKLNFLDQIAKFWELQGSKLRFPHVEKKILDLYLLSKLVSAEGGFELVCKEKRWSKIASRMGF-PSGKGSGTLLRSHFQRILYPYELFQSGASFTVSLPALDFQLSPVWLGAACLPFQHNPPLYLTFAQDTTGMFILLFLLFLFPLQRENKEPKTLQ----IFGSSPKVVGLEIVPAGKVLSHYLRPIDLYMCMACGRGDEEDRLLLCDGCDDSYHTFCLIPPLQDVPKGDWRCPKCVAEECSKP-----REAFGFEQAVREYTLQSFGEMADHFKSDYFNMPVHMVPTELVEKEFWRLVSS--IEEDVIVEYGADIGSKDVGSGFPVRDGKRRLVGDEEEYANSGWNLNNMPVLEQSVLTHINADISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPAHAAEQLEAVMKKLAPELFDSQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPMGRQCVAHYRRLQRQCVFSHEELLCKMAADPESLDVELAAAVYKELGDMMDEESRLRQAVSDM--GVLSFEQEVFELVPDDERQCYKCKTTCFLSALTCPCS-----PDRLVCLHHTADLCDCPLTSK-CLRYRYDQEEFPAMLYGVKSRAQSYETWAKRV 717          

HSP 2 Score: 67.3958 bits (163), Expect = 2.319e-10
Identity = 47/153 (30.72%), Postives = 75/153 (49.02%), Query Frame = 1
Query: 3802 NELEWMWNLRELNEDK-ASKDSSGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKK------------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQTELGAAFAEYKRL 4221
             E+E + +LR  N  K A  D      +C CRK  +   G  + C+LC+DWFH +C+ +      KK            KFLCP C+RS+RP  E IL+    L++    +++PE  AL  +++R +++        +   EL +A A+   L
Sbjct: 1098 QEVEAIHSLRAANLAKMAMADRIEEVKFCLCRKTAV---GFMLQCELCKDWFHGACVPLPKTGSQKKLVAGWQGSNKESKFLCPLCQRSRRPRLETILSLLVSLQKLP--VRLPEGEALQCLTERAMSWQDRARQALA-TDELSSALAKLSVL 1244          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Cavefish
Match: kdm5ba (lysine (K)-specific demethylase 5Ba [Source:ZFIN;Acc:ZDB-GENE-030131-5379])

HSP 1 Score: 530.791 bits (1366), Expect = 5.460e-158
Identity = 300/800 (37.50%), Postives = 436/800 (54.50%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDL--------FPENIQPKTMKYKTALTLE-SPKMTRSKALIVQKPVNE--------------------LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLLQIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLSSHK 2388
            F  PP  PVF P+ +EF DP  +I KIR +A+  GICKI  P  W PPFA D     F PR+QRLNE+ A +R++ NF+  I  FWE Q   L+IP V+   LDL++L+  V + GG  QV K ++WT I   LG+    K + S +RS++E+++ PY  F   I  ++ P L        +  +  P+    + A T   + +  R++   V+    E                    +C +C        ++ C  CD  YH  C+ PPL DVPK  W C +CL   C K         FGF Q++  Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV+   + +DV V+YGADI+S    SGFP +         ++ YV SGWNLNN+PVL  S+   ++ DI GM +PW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYG P   AE+ E +M++ A ELFE  PDLLH + T +NP LL+++ + +YRT+Q           +YH+GFNQGFNFAEAVNFC  DW++ GR  V  YR + R  VFSH+E++C +A+  ++LDL+L  A+  +M  + +EEK  R++   +  GV  ++++  +++P+++R+C+ CRTT ++S +TC  C   +L     CL H+  LCSCA   N  L Y+Y+L  +  +  +V  +   Y  W S+V  + K E                                     EK +L  L  +++  + M   + LL  L  I++  +++ AM  QLL+  +
Sbjct:   14 FIPPPECPVFEPSWEEFSDPFGFINKIRSIAENTGICKIRPPPGWQPPFACDVDRLHFTPRIQRLNELEAQTRVRLNFLDQIAKFWELQGCTLKIPHVERKSLDLYQLYKVVSEEGGFEQVCKERKWTQISTRLGFA-PGKAVGSHLRSHYERVLYPYYLF--QIGTSQKPTLTNDTKDKEYKSHDLPQRQSVQPAETTTIARRAKRTEGRCVKTEQGEPCENRPNLRRRMGSCVVEQYICLVCGGGGDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQECGKPQV-----AFGFEQASRDYTLRSFGDMADSFKSDYFNMPVHMVPTELVEKEFWRLVS--TIEEDVTVEYGADIASKDFGSGFPVKNGSFKVTPDEEHYVTSGWNLNNMPVLDSSVLTHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGAPGYAAEQLEMVMKKLAPELFESQPDLLHQLVTIMNPNLLMEHGVPIYRTNQ-----------SYHSGFNQGFNFAEAVNFCTVDWMSLGRQCVAHYRSLNRYCVFSHDEMVCNIAAKADNLDLVLACAIQKDMSAMMEEEKELRERAYKL--GVWHSQQVDYEELPDEERQCIKCRTTCFLSAITCP-CSPTQLV----CLHHLQDLCSCACS-NYTLNYKYTLGLLNQMFKSVAGRAVSYDDWASKVNKMLKPE------------------------------------REKNDLRAL--MVEAEKKMYPEMDLLRHLRQIIQEAEKSAAMAQQLLNGKR 746          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Cavefish
Match: kdm5bb (lysine-specific demethylase 5B-B-like [Source:NCBI gene;Acc:103026437])

HSP 1 Score: 510.76 bits (1314), Expect = 1.214e-150
Identity = 363/1175 (30.89%), Postives = 558/1175 (47.49%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLLQIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLSSHKAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIVSSHEEQAEKLTLGEMRLLVEKLRSLP---AHVPQLEEAAQTLHSINEWRKKVRMTVSCVDVIEENVITNLVESGESNLVYLSEYQMLQKMRLYTVWIGKSRQLFKSSEHCPPPPLDEFRKVRDEGIGLINTIEIDRIXXXXXXXXXXXXXXXXXXXXXXXXFRMSGWRILVDNLQKNEKQLSKIIIDGDAMQKKAEDILKSTPGVFALFSLNSLLKSADAELKCTVPGIDRLKEVVNEAVIVNEGINEMWQKLQQCRRLVHVEEMQTLIKQADSLCVAFDRLSDLKSLFRTIDAWKKNLHGLFIKNSHNSYLTTPTLLEVLFPRPQRQFKLMIAREAVSSKLVDDCKTESTMKESSVKDEPESCDEEKQTDDQKSIKTNRSCRKSRG-----RQKRSSLAPDDPQIARLDNVVVFESHLRSGYVGESEFNGNYKKMCVNELEWMWNLRELNEDKASKDS-SGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHL-----FSPQTE 4188
            +C +C +      ++ C  CD  YH  C+ PPL+D+PK  W C +CL   C K       E FGF Q+   YSL +F   AD+FK  YFN   ++   E VE+E+WRLV    + +DV V+YGADI+S    SGFP R  +      D+KY+  GWNLNN+ ++  S+   V+ DI GMT+PW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYG P   AE+ E +M++ A ELFE  PDLLH + T +NP  L+   + +YRT+Q AGEFV+TFPRAYH+GFNQGFNFAEAVNFC  DW+  GR  V+ YRL+ R  VFSH+E+IC MA+    LD++L  +V+ +M+++  EE+  R QI  +  GV + E    D + +D+R+C+ CRTT Y+S +TC     +++     CL H   LCSC    N  LKYR++LD++  +++ V ++ E Y +W S V  + +++        ++ R +    S IE  D  +  F + +                         LL  L+ + +  +R  ++  QLL+  +                                  ++  +I     +   +L++ EMR  V +L +LP      P L+E    +    +  +KV       D++ E  I  L++      V L E   L++      W+G  ++   SS       LD  R++ D G+GL      +R                                           +L +++   +  +++A+ +LK+ P   +L SL+  LK  D+ +   +P    L++ V  A    E + E  + LQ   R+  ++ +  ++ +  ++ V  + L  L++L   +  W+++    F+  S +SY    TLLEVL PR                     C+  +++K                          R  +K++G      +KRS          RLD++   E  L       S       ++ V ELE + +LR  NE K    + SG    C C+K  M   GA   C+LC++ FH  C G      S K +LCP C RS +PP E IL     L++    +++PE  AL  M +R +++ +    +      SPQ++
Sbjct:  253 VCLVCGNGNDEDRLLLCDGCDDSYHTFCLIPPLTDIPKGDWRCPKCLAQECSKP-----QEAFGFEQARRDYSLKAFGEMADSFKSDYFNMPVHMVPTELVEKEFWRLV--RTIEEDVTVEYGADIASKEFGSGFPIRGGRFKVAPHDEKYLSCGWNLNNMAMMDPSVLTHVTADICGMTLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGAPGFAAEQLEAVMKKLAPELFESQPDLLHQLVTIMNPNTLMSYGVPIYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWMPLGRQCVDHYRLLHRYCVFSHDEMICNMAAKANKLDVVLASSVHKDMVLMINEERDLRDQIRKL--GVVQCELFEYDLLQDDERQCVKCRTTCYLSALTCPCRPGEQV-----CLHHARHLCSCPIS-NYTLKYRFTLDDLYPMMNAVKQRAESYDVWASHVSEVLEAKL-------DKKRNLTVFRSLIEESD--KGSFPDND-------------------------LLRHLKLVTQDAERCSSVAQQLLTGKR----------------------------------QTRYRIAGGKTQN--QLSVEEMRSFVRQLYNLPCSLTQAPLLKELLNRIEDFQQHSEKVLSDDVSPDLVGE--IQALLDESSEFDVSLPEVSQLRERLELAHWLGAVQRAEDSSSSPRGLSLDGMRRLIDRGVGLTPHPSTERAMA----------------------------------------RLQELLTLSEQWEERAQTLLKTRPPE-SLTSLSGTLKEVDS-VPTYLPNCLLLRDSVQRA---TEWLKEA-EALQVGGRVPVLDTLSDMVLRGRAIPVQLEPLERLEALVSEVQTWRESAAKTFLMKS-SSY----TLLEVLCPR---------------------CEVGNSVK--------------------------RKVKKTKGDVMPCGKKRS---------GRLDSLSDVEKALSDSKDSASAM-ATLAEVRVKELESLASLRAANESKLLPSADSGALRVCVCQKAPM---GAMHQCELCRETFHTVCTGGPADPRSAKPWLCPSCHRSSKPPLEKILPLLASLQR--IRVRLPEGDALRYMIERTVSWQRRAREVMASYELSPQSQ 1227          

HSP 2 Score: 73.1738 bits (178), Expect = 4.065e-12
Identity = 40/119 (33.61%), Postives = 64/119 (53.78%), Query Frame = 1
Query:  286 AHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQPKTMKYKTA 642
            A +R+K NF+  I  FWE Q   L+IP V+   LDL++L+  V   GG   V K ++WT I   +G+    K + S +RS++E+++ PY     N+F     +L  + +  K M +  A
Sbjct:   12 AQTRVKLNFLDQIAKFWELQGCTLKIPHVERKILDLYQLNKLVADEGGFELVCKERRWTKIAMTMGFA-PGKAVGSHLRSHYERVLYPY-----NLF-QSGANLLEQELAAKLMSFGAA 123          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Cavefish
Match: kdm5bb (lysine-specific demethylase 5B-B-like [Source:NCBI gene;Acc:103026437])

HSP 1 Score: 510.76 bits (1314), Expect = 3.374e-150
Identity = 363/1175 (30.89%), Postives = 558/1175 (47.49%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLLQIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLSSHKAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIVSSHEEQAEKLTLGEMRLLVEKLRSLP---AHVPQLEEAAQTLHSINEWRKKVRMTVSCVDVIEENVITNLVESGESNLVYLSEYQMLQKMRLYTVWIGKSRQLFKSSEHCPPPPLDEFRKVRDEGIGLINTIEIDRIXXXXXXXXXXXXXXXXXXXXXXXXFRMSGWRILVDNLQKNEKQLSKIIIDGDAMQKKAEDILKSTPGVFALFSLNSLLKSADAELKCTVPGIDRLKEVVNEAVIVNEGINEMWQKLQQCRRLVHVEEMQTLIKQADSLCVAFDRLSDLKSLFRTIDAWKKNLHGLFIKNSHNSYLTTPTLLEVLFPRPQRQFKLMIAREAVSSKLVDDCKTESTMKESSVKDEPESCDEEKQTDDQKSIKTNRSCRKSRG-----RQKRSSLAPDDPQIARLDNVVVFESHLRSGYVGESEFNGNYKKMCVNELEWMWNLRELNEDKASKDS-SGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHL-----FSPQTE 4188
            +C +C +      ++ C  CD  YH  C+ PPL+D+PK  W C +CL   C K       E FGF Q+   YSL +F   AD+FK  YFN   ++   E VE+E+WRLV    + +DV V+YGADI+S    SGFP R  +      D+KY+  GWNLNN+ ++  S+   V+ DI GMT+PW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYG P   AE+ E +M++ A ELFE  PDLLH + T +NP  L+   + +YRT+Q AGEFV+TFPRAYH+GFNQGFNFAEAVNFC  DW+  GR  V+ YRL+ R  VFSH+E+IC MA+    LD++L  +V+ +M+++  EE+  R QI  +  GV + E    D + +D+R+C+ CRTT Y+S +TC     +++     CL H   LCSC    N  LKYR++LD++  +++ V ++ E Y +W S V  + +++        ++ R +    S IE  D  +  F + +                         LL  L+ + +  +R  ++  QLL+  +                                  ++  +I     +   +L++ EMR  V +L +LP      P L+E    +    +  +KV       D++ E  I  L++      V L E   L++      W+G  ++   SS       LD  R++ D G+GL      +R                                           +L +++   +  +++A+ +LK+ P   +L SL+  LK  D+ +   +P    L++ V  A    E + E  + LQ   R+  ++ +  ++ +  ++ V  + L  L++L   +  W+++    F+  S +SY    TLLEVL PR                     C+  +++K                          R  +K++G      +KRS          RLD++   E  L       S       ++ V ELE + +LR  NE K    + SG    C C+K  M   GA   C+LC++ FH  C G      S K +LCP C RS +PP E IL     L++    +++PE  AL  M +R +++ +    +      SPQ++
Sbjct:  300 VCLVCGNGNDEDRLLLCDGCDDSYHTFCLIPPLTDIPKGDWRCPKCLAQECSKP-----QEAFGFEQARRDYSLKAFGEMADSFKSDYFNMPVHMVPTELVEKEFWRLV--RTIEEDVTVEYGADIASKEFGSGFPIRGGRFKVAPHDEKYLSCGWNLNNMAMMDPSVLTHVTADICGMTLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGAPGFAAEQLEAVMKKLAPELFESQPDLLHQLVTIMNPNTLMSYGVPIYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWMPLGRQCVDHYRLLHRYCVFSHDEMICNMAAKANKLDVVLASSVHKDMVLMINEERDLRDQIRKL--GVVQCELFEYDLLQDDERQCVKCRTTCYLSALTCPCRPGEQV-----CLHHARHLCSCPIS-NYTLKYRFTLDDLYPMMNAVKQRAESYDVWASHVSEVLEAKL-------DKKRNLTVFRSLIEESD--KGSFPDND-------------------------LLRHLKLVTQDAERCSSVAQQLLTGKR----------------------------------QTRYRIAGGKTQN--QLSVEEMRSFVRQLYNLPCSLTQAPLLKELLNRIEDFQQHSEKVLSDDVSPDLVGE--IQALLDESSEFDVSLPEVSQLRERLELAHWLGAVQRAEDSSSSPRGLSLDGMRRLIDRGVGLTPHPSTERAMA----------------------------------------RLQELLTLSEQWEERAQTLLKTRPPE-SLTSLSGTLKEVDS-VPTYLPNCLLLRDSVQRA---TEWLKEA-EALQVGGRVPVLDTLSDMVLRGRAIPVQLEPLERLEALVSEVQTWRESAAKTFLMKS-SSY----TLLEVLCPR---------------------CEVGNSVK--------------------------RKVKKTKGDVMPCGKKRS---------GRLDSLSDVEKALSDSKDSASAM-ATLAEVRVKELESLASLRAANESKLLPSADSGALRVCVCQKAPM---GAMHQCELCRETFHTVCTGGPADPRSAKPWLCPSCHRSSKPPLEKILPLLASLQR--IRVRLPEGDALRYMIERTVSWQRRAREVMASYELSPQSQ 1274          

HSP 2 Score: 156.377 bits (394), Expect = 1.866e-37
Identity = 76/177 (42.94%), Postives = 107/177 (60.45%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPEN 609
            F+ PP  PVF P+ +EF DP  +I KIRP+A+K GICK+  P  W PPFA D     F PR+QRLNE+ A +R+K NF+  I  FWE Q   L+IP V+   LDL++L+  V   GG   V K ++WT I   +G+    K + S +RS++E+++ PY     N+F +    LF +N
Sbjct:    9 FQPPPECPVFEPSWEEFADPFAFINKIRPIAEKTGICKVRPPPDWQPPFACDVDRLHFTPRIQRLNELEAQTRVKLNFLDQIAKFWELQGCTLKIPHVERKILDLYQLNKLVADEGGFELVCKERRWTKIAMTMGFA-PGKAVGSHLRSHYERVLYPY-----NLFQSGANLLFIQN 179          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Sea Lamprey
Match: kdm5c (lysine (K)-specific demethylase 5C [Source:ZFIN;Acc:ZDB-GENE-060810-94])

HSP 1 Score: 446.432 bits (1147), Expect = 3.064e-136
Identity = 223/481 (46.36%), Postives = 308/481 (64.03%), Query Frame = 1
Query:  670 RSKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLH-TGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            R+ AL  Q     +C +C        ++ C  CD  YH  C+ PPL DVPK  W C +C+   C K       E FGF Q+  +Y+L SF   AD FK  YF+   ++   E VE+E+WRLV+   + +DV V+YGADI SG   SGFP R  +     ++++Y  +GWNLNN+PVL +S+   ++ DISGM VPW YVGM FS FCWHIEDHWSYSINYLH +G+ KTWYGVP   AE  E++M++ A ELFE  PDLLH + T +NP LL+ + + V RT+Q AGEFV+TFPR+YH+GFNQG+NFAEAVNFC ADWL  GR  VE YR + R  VFSH+ELICKMA+  + LDL +  +V+ +M ++ +EE+  RK +    +G C +ER   + IP+D+R+C  C+TT ++S +TCS         R+ CL H   LC C  +    L+YRY+++E+  +++ +  + + +  W+SRV
Sbjct:  302 RTGALSAQFIEMYVCLVCGRGDEEDKLLLCDGCDDSYHTFCLIPPLQDVPKGDWRCPKCVAEECSKP-----QEAFGFEQATKEYTLQSFGEMADTFKSDYFSMPVHMVPPELVEKEFWRLVS--TIEEDVTVEYGADIHSGEFGSGFPVRGTRRKLTPEEEEYARAGWNLNNMPVLAESVLAQINADISGMKVPWLYVGMCFSAFCWHIEDHWSYSINYLHWSGEPKTWYGVPAHAAESLEEVMKKLAPELFEAQPDLLHQLVTIMNPNLLMAHGVPVVRTNQCAGEFVITFPRSYHSGFNQGYNFAEAVNFCTADWLPTGRQCVEHYRRLHRYCVFSHDELICKMAAEPDGLDLPMAASVHRDMTVMMEEERRLRKSV--EQRGTCDSEREAFELIPDDERQCDFCKTTCFLSALTCSCS-----PTRLVCLHHADDLCRCPPQRQ-CLRYRYTMEELPDMLAKLKARADCFDDWVSRV 767          

HSP 2 Score: 163.31 bits (412), Expect = 6.095e-41
Identity = 77/168 (45.83%), Postives = 106/168 (63.10%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFIN 582
            F  PP  PVF PT +EF DP+ YI KIRP A+K GICKI  P  W PPFAVD   F+F PR+QRLNE+ A +R+K NF+  I  FWE Q + L+IPIV+   LDL+ L   V + GG     K ++W+ +  ++GY    K   S++RS++E+I+ PY  F   + ++
Sbjct:    8 FVAPPECPVFVPTWEEFSDPMGYIAKIRPSAEKTGICKIRPPPDWQPPFAVDVDKFRFTPRIQRLNELEAQTRVKLNFLDQIAKFWELQGSTLKIPIVERKILDLYMLSKVVSEEGGFETSCKERKWSRVAAKMGY-PAGKGAGSLLRSHYERILYPYDLFQSGVSLS 174          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Sea Lamprey
Match: kdm5c (lysine (K)-specific demethylase 5C [Source:ZFIN;Acc:ZDB-GENE-060810-94])

HSP 1 Score: 437.958 bits (1125), Expect = 2.375e-127
Identity = 218/473 (46.09%), Postives = 295/473 (62.37%), Query Frame = 1
Query:  712 CKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSE 2127
            C +C      + ++ C  CD  YH  C+ PPL DVPK  W C +C+   C K       E FGF Q+   Y+L SF   AD FK  YFN   ++   E VE+E+WRLV+   + +DV V+YGAD+ +    SGFP +  +   ++++++Y  SGWNLNN+PVL +S+   +  DISGM VPW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE  E++MR  A ELF   PDLLH + T +NP +L+ +D+ V RT+Q  GEFVVTFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  VE YRL++R  VFSH EL+C+MA   E L L +  A+  E+ I   EE+  R++   M  GV ++E    + + +D+R+C  C+TT Y+S + C  C       R+ CL H+  LC C ++  I L+YRY+LDE+  ++  +  + E +  W  +V    + E
Sbjct:  323 CLVCGRGDDEAKLLLCDGCDDSYHTFCLIPPLQDVPKGDWRCPKCVAQECSKP-----QEAFGFEQAKRVYTLRSFGEMADVFKSDYFNMPVHMVPTELVEKEFWRLVSC--IEEDVSVEYGADVQAKEYGSGFPVKNGKKKLSKEEEEYTSSGWNLNNMPVLPQSLLGHIDGDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPAYAAESLENVMRTLAPELFLAQPDLLHQLVTIMNPNILMAHDVPVVRTNQCPGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPMGRRCVEHYRLMRRYCVFSHEELLCRMACETEGLALPMASAIGRELEIAIDEERKLRREAWEM--GVSKSEPFEFELLADDERQCHFCKTTCYLSAIACPCC-----PGRLVCLYHIRDLCRCPTQHKI-LRYRYTLDELPPMLHKLKSRAEIFDAWAEKVRRALEEE 780          

HSP 2 Score: 164.851 bits (416), Expect = 9.000e-41
Identity = 79/195 (40.51%), Postives = 120/195 (61.54%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFIN------KNPDLFPENIQPKTMKYKTAL 645
            F  PP  PVF+PT +EF DPL YI KIRP+ +K GICKI  P +W PPFAVD   F+F PR+QRLNE+ A +R+K NF+  I  FWE Q + L+IPI++   LDL+ L   V + GG   V K+++W+ +  ++GY    K + S++R ++E+I+ P+  F   + ++        PD   +  +P ++  + +L
Sbjct:    9 FVPPPECPVFQPTWEEFGDPLAYIAKIRPIGEKTGICKIRPPPEWQPPFAVDVDNFRFTPRIQRLNELEAQTRVKLNFLDQIAKFWELQGSTLKIPILERKLLDLYMLSKVVAEEGGFEIVCKDRKWSRVAAKMGY-MTGKAVGSLLRVHYERILYPHNLFQSGVSLSCIAKPEYEPDEKDQEYKPHSIPLRQSL 202          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Sea Lamprey
Match: jarid2a (jumonji, AT rich interactive domain 2a [Source:ZFIN;Acc:ZDB-GENE-061218-1])

HSP 1 Score: 180.259 bits (456), Expect = 8.353e-47
Identity = 160/693 (23.09%), Postives = 286/693 (41.27%), Query Frame = 1
Query:   91 PAAPVFRPTLKEFEDPLDYIEKIRPVA--QKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLE-IPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQPKTMKYKTALTLESPKMTRSKALIVQ---KPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMI------IQQEEKLHRKQICTMVQ---------GVCRTERLLLDQIP--EDDRECMICRTTLYISGVT--------CSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQL 2076
            P  PV  PT +EF DPL Y+E +R  A  ++ G C++  P  W P   + S   +F  RVQ ++++G         +  I      Q   LE +P++    LDL  L   ++  GG  Q+   + W  +   L     ++   + ++  + + +  +    D        ++  E  + +      AL  +  +    + L +    KP N L     +  S + M +    D     +  +PP      +G +                  +V  +       SL +F   A N   T+ +   + SL  +E++YW +V  +++   V   +   + +   SSGFP          + + +    WNL  LP    S+ R +   +SG+TVPW  VGMVFS + W  + H+  SI+YLHTG  K WY +P S  +K + ++        +   ++L +  + ++P +L    + VYRT Q +G+FVVTFP ++ +  + G++ +E + F PADWL  G  + E  +    P++F  ++L+   A            A    ++       +    +LH + + +  +         GV    +     +P    +R C+ CR   Y+S V         C  C   +  ++ SC               + L YRY  +++  LV  V+  +
Sbjct:    3 PEVPVLYPTAREFLDPLAYVEGVRSRAGVEEAGACRVAPPTCWRPECRL-SDDMRFVTRVQHVHKLGRRWGPNEMRLACIRKHLLRQGIALEELPLIGGCELDLASLSVLMESLGGMQQLRDARAWQRLADALRVPRAAQDRLARLQEAYCRYLLAFEGLPDGERRGLEREVLAE--RERIEARGGALEGQQGQGDIPEGLGLGASFKPWNRLTSRVRNGVSSNGM-SPLPSDGEDGEAVTNPPKETHRDSGVL-----------------KDVHKWCFKGKSVSLTAFYRAARNLLSTHCSKEPSASL--IEQKYWEIVQNQDMHVSV---HCGKVDTNFVSSGFPI--------GRSEPFSRHSWNLTMLPSNPGSVLRHL-GALSGVTVPWLNVGMVFSTWVWARDPHYLPSIDYLHTGADKIWYCIPASQKDKLDKVVHSLLQANGKSGLEMLQN--SMVSPEVLSHAGVSVYRTVQRSGQFVVTFPGSFTSSVSCGYSVSETITFAPADWLPLGCRAAEEVKRRCIPNMFPVDKLLYLTAVGELEKGNAAALAHVGPLLGQLRDRELNLRRRLHVRGLRSWARYGCQDAHHPGVAEVRKRPRKWLPIESAERRCLTCRQLCYLSMVVEESENVVFCLHCALARTEEQGSC-------------RRLKLMYRYDQEQMDSLVDRVNAAI 645          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005764.1 (pep scaffold:Pmarinus_7.0:GL480846:34625:43736:-1 gene:ENSPMAG00000005226.1 transcript:ENSPMAT00000005764.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 2.047e-14
Identity = 49/165 (29.70%), Postives = 82/165 (49.70%), Query Frame = 1
Query: 3757 VGESEFNGNYKKMCVNELEWMWNLRELNEDKASKDSSGHDF-YCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGI---------QNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQTELGAAFAEYKRL 4221
            V  +    ++K+    ELE M  LR +N+ K S   S  +  YC CR+     +G+ + C LC+DWFH +C+ +         Q+    + +FLCP C+RS+RP  E ILA    L++    +++PE  AL  +++  + +        +   EL +A A+   L
Sbjct:   50 VHPAAIVASFKESQRRELESMRKLRAINQAKPSVLPSTEECRYCVCRR---GAQGSMLQCQLCRDWFHSTCVALPRPVGLKKGQSAGAKEPRFLCPLCQRSRRPRLETILALLVALQKLP--VRLPEGEALQCLTEHAMAWQDRARQALA-TPELASALAKLSVL 208          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005177.1 (pep scaffold:Pmarinus_7.0:GL477523:31773:39538:1 gene:ENSPMAG00000004708.1 transcript:ENSPMAT00000005177.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 1.883e-11
Identity = 46/187 (24.60%), Postives = 81/187 (43.32%), Query Frame = 1
Query:  874 ARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDR----KNVSLKEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELF 1422
            A +   V G S    +Y++    +   ++++   +D+    ++    ++E +YW+ +        V   YGADI   L                 D+   D  WN+ +L  +   + +     I G+  P+ Y GM  + F WH ED   YSINYLH G+ K+WY +P    ++ E L + +   + 
Sbjct:   70 APIQQVVTGQSGLFTQYNIQKKPMTVADYRRLANSDKHCTPRHQDYDDLERKYWKNLTF------VAPIYGADICGSLY----------------DEDVED--WNIGHLNTVLDVVEQDSGITIDGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAKGKWGSIL 232          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Yeast
Match: JHD2 (JmjC domain family histone demethylase; promotes global demethylation of H3K4 and repression of noncoding intergenic transcription during sporulation; removes methyl groups added by Set1p methyltransferase; negatively regulated by H3K14 acetylation; protein levels regulated by Not4p polyubiquitin-mediated degradation; regulates sporulation timing by extending period of active transcription in opposition to programmed global transcriptional quiescence; regulates rDNA silencing [Source:SGD;Acc:S000003880])

HSP 1 Score: 296.59 bits (758), Expect = 1.059e-85
Identity = 203/656 (30.95%), Postives = 306/656 (46.65%), Query Frame = 1
Query:  100 PVFRPTLKEFEDPLDYIEK--IRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFE----------LHTKVKQYGGCHQVTK-NKQWTHIC----RELGYGEKSKQLCSI----------------VRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQPKTMKYKTALTLESPKMTRSKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKEVEEEYWRLVAAENVSDDVVVKYGADISSGLTS--SGFPTRTNQTMFNEKDQ-----KYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINP--TLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAV----YDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRE-----CMICRTTLYISGV 1914
            P   PT +EF++P+DY+    I+ +  +YG+ K++ P  + PP ++D   F F+PR+Q L  +   +R +  F++ +  F     +P ++  +   P  + E          L  KV  Y    ++ K N+  T       R+L + + S+    I                ++  FEK I  Y  F  ++  N +  L  +   PK++        +    + S +   ++  ++ C +C     P   + C  CD  +HI C+ PPL  VP   WIC  C+          +    +GF+Q    YSL  F  Y           RK +S+ E+EE +W LV     S    VKYGADI + L    +GFPTR         D+     KY D   NL NLP+   S+      +ISGMT+PW Y+G +FS FCWH+ED ++ S NY H GD K WY +PES   KF DL+   + +LF K PDLLH + T I+P      K+ I VY+  Q   E+++TFP+ YHAGFN G+NF EAVNF    WL  G  ++  Y+L ++  VF   +L+  +        LL   A     Y  +++    E    K+I  +   V RT  L +   P D+ E     C  C+T   I+ V
Sbjct:    5 PALYPTEQEFKNPIDYLSNPHIKRLGVRYGMVKVVPPNGFCPPLSIDMENFTFQPRIQNLENLDLKNRCRLFFMKQLNNFKRSVKDPSKL--ILREPYTIVEYSDSTHASEILKKKVYFYDVFSELIKDNRTLTDTTQSFRRKLKFRDISQLRGDISLWRTISKKFNVPIGLLKEIFEKYIASYYIFLHSLNENVHTALHADQY-PKSLLSDDEDDFDLGPDSNSGS-DFEEDDDDACIVCRKTNDPKRTILCDSCDKPFHIYCLSPPLERVPSGDWICNTCI----------VGNGYYGFTQDTHDYSLPEFQEYCKRQNSRLLPARK-LSIDELEEMFWSLVTKNRRSSLTTVKYGADIHNELPGQITGFPTREFIPKNINGDELIDYLKYCDHPMNLTNLPMAHNSLLPLFKRNISGMTIPWIYIGSLFSTFCWHMEDQYTLSANYQHEGDPKVWYSIPESGCTKFNDLLNDMSPDLFIKQPDLLHQLVTLISPYDPNFKKSGIPVYKAVQKPNEYIITFPKCYHAGFNTGYNFNEAVNFTIDFWLPYGFGAITDYKLTQKACVFDMFDLMINVLDKYNKDTLLFNDAFVRQCYSSLIVFYNTE---LKRIRKIQAIVPRTTLLEVHTDPNDEDEEYDIFCSQCKTICSIAFV 642          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Yeast
Match: RPH1 (JmjC domain-containing histone demethylase; targets tri- and dimethylated H3K36; associates with actively transcribed regions and promotes elongation; repressor of autophagy-related genes in nutrient-replete conditions; damage-responsive repressor of PHR1; phosphorylated by the Rad53p-dependent DNA damage checkpoint pathway and by a Rim1p-mediated event during starvation; target of stress-induced hormesis; RPH1 has a paralog, GIS1, that arose from the whole genome duplication [Source:SGD;Acc:S000000971])

HSP 1 Score: 128.257 bits (321), Expect = 3.822e-30
Identity = 73/239 (30.54%), Postives = 113/239 (47.28%), Query Frame = 1
Query:  922 YSLDSFSVYADNFKKTYFNDRKNVSLKEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRAS 1638
            +++D F  +   +     + +    LK +EE YW+ +      +     YGAD    +    FP   N               WN+  LP    +I   +   + G+   + Y G+  + F WH+ED   YSINY+H G  K WY +P+ D  KF   M+++  E  +  P+ L H     +P LL +N I+        GEF++T+P  YHAGFN G+N AE+VNF   +WL  G+ +
Sbjct:  140 FNIDDFEQFRTEYTIDLSDFQNTERLKFLEEYYWKTL------NFTTPMYGADTPGSI----FPEGLNV--------------WNVAKLP----NILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQDLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLLQENGIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKA 350          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Yeast
Match: ECM5 (Subunit of the Snt2C complex; physically associates with Snt2p and Rpd3p; along with Snt2p, recruits Rpd3p to a small number of promoters; also colocalizes with Snt2p, independently of Rpd3p, to promoters of stress response genes in response to oxidative stress; contains ATP/GTP-binding site motif A; null mutant exhibits increased cellular volume, large drooping buds with elongated necks; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000004788])

HSP 1 Score: 105.916 bits (263), Expect = 5.324e-23
Identity = 119/484 (24.59%), Postives = 197/484 (40.70%), Query Frame = 1
Query:   88 PPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICK--IISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRT--IEAFWECQN--NPLE------IPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGY-GEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQPKTMKYKTALTLESP--KMTRSKALIVQKPVNELCKICESPTSPSTM----------------VTCFECDCRYHISCVDPPLSDVPK---TGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTY---FNDRKNVSLKEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKY----VDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASE 1416
            P + P F    KE  DP+ + E +  +   YG  K  II          VD     F+ R Q  N         N F RT  ++ + +  N  N ++      IP +    LDL+ L + VK  GG + V + K W  I RELGY G     L + +RS + KI+   LDF          D++ E  Q      K    +ES   + + S++   ++P+++  KI        ++                 T F     + +       + +P    T W  +  +++  + +     + V+   Q   K SL  F+     F  +Y   F     +  KE E  Y+ L++   +          +I +GL   G P        N  ++K+    +   WNL+N+P+ + S+ + +  D++  T     +GM+FSC  W + DH+  SI++ H G  K  Y +   D EKFE L+ +  SE
Sbjct:  115 PHSIPTFILAKKELPDPIKFYELVEDLGSVYGCVKLKIIPDADKFTQLNVDVDRLWFKARKQFFNS--------NEFQRTKIVDFYAKLYNFHNKIKKSTLTRIPSIDKRTLDLYRLRSCVKLRGGFNAVCEKKLWAQIGRELGYSGRIMSSLSTSLRSAYAKIL---LDF----------DIYEEEEQAARNNEKNEDMVESEIFRHSNSRSRDEEEPLHKKAKIHRDVFRAGSINHEFKRMRDIKHIKGFPTYFNSLTEFKLGYTQSTETTLPGYDFTFW--ENGMEIYDKSKYETKTSPVYNLRQYYEK-SLAVFTAIVAKFGSSYPDLFAKHTTLPQKEFERLYFHLLSEHFID--------FEIDTGL---GLPCSMRSPGNNSSNEKFAIKNILDQWNLDNIPLNELSLLQHLDLDMANFTRTTYDIGMLFSCQGWSVSDHFLPSIDFNHLGSTKLVYSIAPKDMEKFEALIARGKSE 563          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Yeast
Match: GIS1 (Histone demethylase and transcription factor; regulates genes during nutrient limitation; activity modulated by proteasome-mediated proteolysis; has JmjC and JmjN domain in N-terminus that interact, promoting stability and proper transcriptional activity; contains two transactivating domains downstream of Jmj domains and a C-terminal DNA binding domain; relocalizes to the cytosol in response to hypoxia; GIS1 has a paralog, RPH1, that arose from the whole genome duplication [Source:SGD;Acc:S000002503])

HSP 1 Score: 97.4413 bits (241), Expect = 1.484e-20
Identity = 51/144 (35.42%), Postives = 73/144 (50.69%), Query Frame = 1
Query: 1171 WNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNF 1602
            WNLNNLP    S  R +              G     F WH+++    SINYLH G  K WY +P ++ ++F  ++ +E S   E  P  + H     +P  L KN+IK  R  Q   EF++TFP   ++GFN G+NF E++ F
Sbjct:  176 WNLNNLPDSINSSNRRL------------LTGQSKCIFPWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFIRHQNIITSPDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEF 307          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Nematostella
Match: EDO34883 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN37])

HSP 1 Score: 297.745 bits (761), Expect = 1.253e-82
Identity = 146/290 (50.34%), Postives = 192/290 (66.21%), Query Frame = 1
Query: 1240 MTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERL-LLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            M VPW YVGM FS FCWH EDHWSYSINY+H G+ KTWYG+P   AE+FE  M++ A ELFE  PDLLH + T I+P  L    + V RT+Q AGEFV+TFPRAYHAGFNQG+N AEAVNF  +DWL  GR  +  YR + R  VFSH EL+CKMA+  + LDL L KAVYDEM+ I + E   R  +  +  G    ER    + +P+D+R+C IC+TT ++S VTC   C +   +R++CLD  S+LC+C   +   L+YRY+L E+  ++  + ++ E +  W S V
Sbjct:    1 MKVPWVYVGMCFSSFCWHNEDHWSYSINYMHWGEPKTWYGIPGDAAEEFEMAMKEAAPELFEAQPDLLHQLVTIISPNALTAKGVPVVRTNQHAGEFVITFPRAYHAGFNQGYNLAEAVNFATSDWLPIGRHCINHYREMTRNPVFSHEELVCKMAADPDGLDLDLAKAVYDEMLAIVETETKRRNTL--LENGAQEFERAEAFELLPDDERQCQICKTTCFLSAVTCK--CSE---ERLTCLDCASELCACRPSDK-TLRYRYTLKELPSMLYRLKQRAESFDNWASGV 282          

HSP 2 Score: 63.5438 bits (153), Expect = 1.170e-9
Identity = 41/129 (31.78%), Postives = 63/129 (48.84%), Query Frame = 1
Query: 3838 NEDKASKDSSGH--DFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKK--------------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFS 4176
            NE+ ASK    H    YC CR RG +  G  +MC+LC++WFH SC+ +      K               K+ C  C RS+RP  E IL+    L++    +++PE  AL  +++R +N+      L +
Sbjct:  688 NEEDASKRPIEHTDGQYCVCR-RGPE--GFMLMCELCKEWFHSSCVPLPRTQSGKTVGKGSAGIEAAKELKYTCVLCHRSRRPRLETILSLLVSLQKLP--VRLPEGEALQFLTERAMNWQDRARQLLA 811          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Nematostella
Match: EDO46479 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ11])

HSP 1 Score: 141.739 bits (356), Expect = 2.135e-33
Identity = 81/238 (34.03%), Postives = 122/238 (51.26%), Query Frame = 1
Query:  922 YSLDSFSVYADNFKKTYFNDRKNVSLKEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPT-LLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGR 1632
            +S  SF   A N ++ +F  +   S  +VE EYWR++ +    D  V      + +G   S FP          K+  Y  SGWNLN  P LK SI R  +N + G+++PW  +GMVFS   W +     Y+++YLHT   K WYGVPE+D  KF   +R   +++ +    +       ++P+ LL +  + V R  Q  G+FVV  P+AYH   + G++ +E+V F   DWL   R
Sbjct: 1091 HSAVSFQRVARNTQEHFF--KTQPSAADVEREYWRIIQSR---DRYVSVEQCRVDTGEQGSCFPV--------GKNNPYSKSGWNLNVFPRLKGSILRHAAN-VEGLSLPWLSIGMVFSTDRWKVHPLQMYTLSYLHTSADKVWYGVPEADVAKFPGSLRPSQADIHDGKDSM-------VSPSNLLRETGLTVTRLVQKQGQFVVVSPKAYHCSISSGYSISESVAFAFPDWLLGMR 1307          

HSP 2 Score: 72.4034 bits (176), Expect = 2.651e-12
Identity = 43/135 (31.85%), Postives = 70/135 (51.85%), Query Frame = 1
Query:   94 AAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKF---RPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNP---LEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICREL 480
            A+PV RPT +EF+DP+ +++ ++P  +KYGIC I  P+ W P   +  +  +F   R  V RL E      IK   +  IE   + Q NP    ++P +    +DL E+   + ++GG  +V   K+W  +   L
Sbjct:  896 ASPVLRPTEEEFKDPIKFLQSVQPSLKKYGICLIEPPESWKPESQLPPN-LRFNSQRQLVHRLKERWGPVEIK---LACIEKHLKQQGNPEPLKQMPQIGGMDVDLLEVSRIMAEFGGMQKVIDAKKWGKVADTL 1026          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Nematostella
Match: EDO39057 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB54])

HSP 1 Score: 62.003 bits (149), Expect = 3.032e-10
Identity = 50/196 (25.51%), Postives = 83/196 (42.35%), Query Frame = 1
Query:  814 VPKTGWICKRC---LQVSCQKELARLNTEVFGFSQS-NCKYSLDSFSVYADNFKKTYFNDRKNVSLKEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFE 1389
            +P  GWI +R    + V     + ++ T   G  Q  N +    S+  +        +   K     E+E +YW+     N++ +  + Y ADIS              ++F++  ++     WN++ L  +   I       + G+  P+ Y GM  + F WH ED   YSINY+H G  KTWY VP     + +
Sbjct:   40 IPPKGWIARRNYDNVNVDIPAPIQQVVTGTQGLYQLFNVQKKPMSYGEFKTIANSERYQPPKG-DFDELERKYWK-----NLTFNAPI-YAADISG-------------SIFDKTVKE-----WNVSRLQTILDLINTEYKVKVEGVNTPYLYFGMWKATFAWHTEDMDLYSINYIHYGAPKTWYVVPPEHGPRLK 210          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Nematostella
Match: EDO35083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMJ1])

HSP 1 Score: 54.299 bits (129), Expect = 5.316e-7
Identity = 21/42 (50.00%), Postives = 27/42 (64.29%), Query Frame = 1
Query: 1513 QAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRAS 1638
            Q  GEF++TFP  YH GFN GFN AE+ NF    W+  G+ +
Sbjct:  144 QEEGEFMITFPYGYHCGFNHGFNCAESTNFASERWIDYGKKA 185          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Nematostella
Match: EDO37587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFA5])

HSP 1 Score: 49.6766 bits (117), Expect = 6.465e-6
Identity = 21/49 (42.86%), Postives = 30/49 (61.22%), Query Frame = 1
Query:  691 QKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWIC 837
            Q P  ++C+ C  P   + M+ C  CD  YH  C+DPP++ +PKTGW C
Sbjct:  217 QCPDCKVCQGCRQPGDDNKMLVCDVCDRGYHTFCLDPPMTTIPKTGWKC 265          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Medaka
Match: kdm5a (lysine demethylase 5A [Source:NCBI gene;Acc:101161451])

HSP 1 Score: 596.66 bits (1537), Expect = 3.031e-179
Identity = 344/937 (36.71%), Postives = 507/937 (54.11%), Query Frame = 1
Query:   55 IMPNKKVI-FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQPKTMKYKTALTLESPKMTRSKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLLQIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLSSHKAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIVSSHEEQAEKLTLGEMRLLVEKLRSLPAHVPQLEEAAQTLHSINEWRKKVRMTVSCVDVIEENVITNLVESGESNLVYLSEYQMLQKMRLYTVWIGKSRQLFKSSEHCPPPPLDEFR 2859
            ++P + ++ F  PP  PVF P+ +EF DPL +I KIRP+A+K GICKI  P+ W PPFA D   F+F PRVQRLNE+ A +R+K NF+  I  FWE Q + +  P V+   LDL++L   V   GG   V K K+W+ +   +G+    +   S++RS++E+I+ PY  F     +  +   F +        +   +   +P +++ +A  +       C +C        ++ C  CD  YH  C+ PPL +VPK  W C +C+   C K       E FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE+E+WRLV++  + +DV+V+YGADISS    SGFP R  +      +++Y +SGWNLNN+PVL++S+   ++ DISGM VPW YVGM FS FCWHIEDHWSYSIN+LH G+ KTWYGVP + AEK E +M++ A ELF+  PDLLH + T +NP +L+++ + VYRT+Q AGEFVVTFPRAYH+GFNQG+NFAEAVNFC ADWL  GR  V  YR + R  VFSH EL+CKMA+  ESLD+ L  AVY EM  + +EE   R+ +  M  GV  +E+   + +P+D+R+C  C+TT ++S +TCS         R+ CL H   LC C    N  L+YRY L+E   ++  V  + + Y  W  RV     ++              +N    IE L +L E   ++   E  +   LK +++                   ETC    +   QLL S K                                     ++ V+S   +  KLT+ E++  V++L  LP  + Q  +  + L ++ ++ ++ ++ +S  ++ + + +  L++ G    V L E   +++      W+ + R          PPP D  R
Sbjct:    2 MVPGQGIVEFVPPPECPVFEPSWEEFSDPLGFINKIRPIAEKTGICKIRPPQDWQPPFACDVRNFRFTPRVQRLNELEAITRVKLNFLDQIAKFWELQGSRIRFPHVERKILDLYQLSKIVSSEGGFEMVCKEKRWSTVAARMGF-PPGRGTGSLLRSHYERILYPYELFQSGATLTVSVGAFSQR------SFHENVHAVNPLVSQIRACSIDL---YFCMVCGRGDKEDRLLLCDGCDDSYHTFCLIPPLQEVPKGDWRCPKCVAEECSKP-----REAFGFEQAVREYTLQSFGEMADHFKSDYFNMPVHMVPTELVEKEFWRLVSS--IEEDVIVEYGADISSKDVGSGFPVRDGKRRLLGDEEEYANSGWNLNNMPVLEQSVLTHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINFLHWGEPKTWYGVPAAAAEKLEAVMKKVAPELFDSQPDLLHQLVTTMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPMGRQCVAHYRRLHRYCVFSHEELLCKMAADPESLDVELAAAVYKEMSDMMEEESKLRQAMQEM--GVLSSEQEFFELVPDDERQCHKCKTTCFLSALTCSCS-----PTRLVCLHHAGDLCDCPLG-NACLRYRYDLEEFPSMLYGVKARAQSYDTWAKRVAEALSAD-------------QKNKKDLIE-LKVLLEDAEDRKYPENASFRRLKEIVKEA-----------------ETC----SSVAQLLLSRK-----------------------------------QRHRSVTSSRNRT-KLTVDELKAFVDQLFKLPCVISQARQVKELLENVEDFHERAQVALS-EEMPDSSKLQALLDLGSGLDVELPELPRIKQQLQQARWLDQVR----------PPPSDPQR 831          

HSP 2 Score: 67.0106 bits (162), Expect = 2.885e-10
Identity = 47/152 (30.92%), Postives = 75/152 (49.34%), Query Frame = 1
Query: 3805 ELEWMWNLRELNEDK-ASKDSSGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKK------------KFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQTELGAAFAEYKRL 4221
            E+E + +LR  N  K A  D      +C CRK      G  + C+LC+DWFH +C+ +      KK            KFLCP C+RS+RP  E IL+    L++    +++PE  AL  +++R +++        + + EL +A A+   L
Sbjct: 1051 EVEAIHSLRAANLAKMAMADRIEEVKFCLCRKTA---SGFMLQCELCKDWFHGACVPLPKTGTPKKVGVSWQSNTKESKFLCPLCQRSRRPRLETILSLLVSLQKLP--VRLPEGEALQCLTERAMSWQDRARQSLATE-ELSSALAKLSVL 1196          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Medaka
Match: kdm5c (lysine demethylase 5C [Source:NCBI gene;Acc:101167366])

HSP 1 Score: 462.996 bits (1190), Expect = 8.018e-134
Identity = 241/577 (41.77%), Postives = 352/577 (61.01%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVM--------------RNVSSFIENLDILREQFNN-----KNIEEKPNLEELKMLLQIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLS 2379
            +C++C        ++ C+ CD  +H  C+ PPL+D PK+ W C +C+   C+K      TE FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE E+WRLV++  + +DV V+YGADI S    SGFP    + +  E++++Y   GWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ E++M++   ELFE  PDLLH + T +NP +L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR+ +E YR ++R  VFSH EL CKMA+S E LDL L  A + EM II QEE+  RK +  M +G+   ER   + +P+D+R+C  C+TT ++S + CS C      +++ CL H   LC+C + E + L+YRY+LDE+  ++  +  + E +  W +RV    + E  S     +  ++M              R +++  +++   R++        K  E K    ELK L++  +N+   +   + ++A+++T +        LLS
Sbjct:  372 VCRMCGRGDDDDKLLMCYGCDDNFHTYCLLPPLADPPKSNWRCPKCVAEECKKP-----TEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPPELVEREFWRLVSS--IEEDVTVEYGADIHSKEFGSGFPMNNGKKILTEEEEEYARCGWNLNVMPVLEQSLLCHINGDISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSVAAERLEEVMKKLTPELFEFQPDLLHQLVTIMNPNILMAHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRSCIEHYRRLRRYCVFSHEELTCKMAASPEKLDLNLAAATHREMFIIVQEERKLRKNL--MERGITEAEREAFELLPDDERQCDKCKTTCFLSALACSNC-----PEQLVCLYHTQDLCNCPT-EKLYLRYRYTLDELLAMLHRLKVRSESFDSWANRVKEALEQEDGSKIDIEDLDKLMLEAAEKKFPDNELLRKLNTVFKDIGSCRQKSAELICGLKTSERKVTFAELKSLVETMQNLPCVMDQFEEVQAVLQTVEEYQKRAQVLLS 933          

HSP 2 Score: 164.466 bits (415), Expect = 8.314e-40
Identity = 77/161 (47.83%), Postives = 106/161 (65.84%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDF 561
            F  PP  PVF P+ +EF+DPL YI KIRP+A+K GICKI  P  W PPF+V+  +F+F PRVQRLNE+ A +R+K N++  I  FWE Q + L+IP ++   LDLF L   V   GG   V K+++W  I + LGY    K + S++RS++E+I+ PY  F
Sbjct:    6 FIPPPECPVFEPSWEEFKDPLGYIAKIRPIAEKSGICKIRPPPDWQPPFSVELDSFRFTPRVQRLNELEAETRVKLNYLDRIARFWEIQGSSLKIPHIERRILDLFSLSKIVTDEGGFEMVCKDRRWARIAQRLGY-PPGKNIGSLLRSHYERIVYPYEMF 165          

HSP 3 Score: 56.9954 bits (136), Expect = 3.812e-7
Identity = 32/105 (30.48%), Postives = 57/105 (54.29%), Query Frame = 1
Query: 3913 KGAQVMCDLCQDWFHLSCLGIQNKDMSK------------KKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFH-KHTNHLFSPQTE 4188
            +  Q+ C LC++WFH  C+ + +   S+             +FLCPQC+RS+RP  E ILA    L++    +++PE  AL  +++R I +  +  + L +P+ +
Sbjct: 1273 RAPQLRCHLCKEWFHGGCVPVPSPLPSEPTANPLCWWDWDTRFLCPQCQRSRRPRLETILALLVALQRLP--VRLPEGEALQCLTERAITWQGRAKDALETPEVQ 1375          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Medaka
Match: kdm5c (lysine demethylase 5C [Source:NCBI gene;Acc:101167366])

HSP 1 Score: 462.611 bits (1189), Expect = 8.364e-134
Identity = 241/577 (41.77%), Postives = 352/577 (61.01%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVM--------------RNVSSFIENLDILREQFNN-----KNIEEKPNLEELKMLLQIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLS 2379
            +C++C        ++ C+ CD  +H  C+ PPL+D PK+ W C +C+   C+K      TE FGF Q+  +Y+L SF   AD+FK  YFN   ++   E VE E+WRLV++  + +DV V+YGADI S    SGFP    + +  E++++Y   GWNLN +PVL++S+   ++ DISGM VPW YVGMVFS FCWHIEDHWSYSINYLH G+ KTWYGVP   AE+ E++M++   ELFE  PDLLH + T +NP +L+ + + V RT+Q AGEFV+TFPRAYH+GFNQG+NFAEAVNFC ADWL  GR+ +E YR ++R  VFSH EL CKMA+S E LDL L  A + EM II QEE+  RK +  M +G+   ER   + +P+D+R+C  C+TT ++S + CS C      +++ CL H   LC+C + E + L+YRY+LDE+  ++  +  + E +  W +RV    + E  S     +  ++M              R +++  +++   R++        K  E K    ELK L++  +N+   +   + ++A+++T +        LLS
Sbjct:  353 VCRMCGRGDDDDKLLMCYGCDDNFHTYCLLPPLADPPKSNWRCPKCVAEECKKP-----TEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPPELVEREFWRLVSS--IEEDVTVEYGADIHSKEFGSGFPMNNGKKILTEEEEEYARCGWNLNVMPVLEQSLLCHINGDISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSVAAERLEEVMKKLTPELFEFQPDLLHQLVTIMNPNILMAHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPAGRSCIEHYRRLRRYCVFSHEELTCKMAASPEKLDLNLAAATHREMFIIVQEERKLRKNL--MERGITEAEREAFELLPDDERQCDKCKTTCFLSALACSNC-----PEQLVCLYHTQDLCNCPT-EKLYLRYRYTLDELLAMLHRLKVRSESFDSWANRVKEALEQEDGSKIDIEDLDKLMLEAAEKKFPDNELLRKLNTVFKDIGSCRQKSAELICGLKTSERKVTFAELKSLVETMQNLPCVMDQFEEVQAVLQTVEEYQKRAQVLLS 914          

HSP 2 Score: 164.081 bits (414), Expect = 8.435e-40
Identity = 77/161 (47.83%), Postives = 106/161 (65.84%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDF 561
            F  PP  PVF P+ +EF+DPL YI KIRP+A+K GICKI  P  W PPF+V+  +F+F PRVQRLNE+ A +R+K N++  I  FWE Q + L+IP ++   LDLF L   V   GG   V K+++W  I + LGY    K + S++RS++E+I+ PY  F
Sbjct:    6 FIPPPECPVFEPSWEEFKDPLGYIAKIRPIAEKSGICKIRPPPDWQPPFSVELDSFRFTPRVQRLNELEAETRVKLNYLDRIARFWEIQGSSLKIPHIERRILDLFSLSKIVTDEGGFEMVCKDRRWARIAQRLGY-PPGKNIGSLLRSHYERIVYPYEMF 165          

HSP 3 Score: 56.9954 bits (136), Expect = 3.902e-7
Identity = 32/105 (30.48%), Postives = 57/105 (54.29%), Query Frame = 1
Query: 3913 KGAQVMCDLCQDWFHLSCLGIQNKDMSK------------KKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFH-KHTNHLFSPQTE 4188
            +  Q+ C LC++WFH  C+ + +   S+             +FLCPQC+RS+RP  E ILA    L++    +++PE  AL  +++R I +  +  + L +P+ +
Sbjct: 1254 RAPQLRCHLCKEWFHGGCVPVPSPLPSEPTANPLCWWDWDTRFLCPQCQRSRRPRLETILALLVALQRLP--VRLPEGEALQCLTERAITWQGRAKDALETPEVQ 1356          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Medaka
Match: kdm5ba (lysine-specific demethylase 5B [Source:NCBI gene;Acc:101160898])

HSP 1 Score: 457.988 bits (1177), Expect = 6.858e-133
Identity = 238/562 (42.35%), Postives = 333/562 (59.25%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLLQIGRNMNIP-IYLLDFLEAIVETCQRAMAMTDQLLSSHK 2388
            +C +C S ++   ++ C  CD  YHI C+ PPL +VPK  W C +CL   C K         FGF Q++  Y+L +F   AD+FK  YFN   ++   E VE+E+WRLV+   + +DV V+YGADI+S    SGFP R +    +  D+ Y+ SGWNLNN+PVL  S+   ++ DI GM VPW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYG P   AE  E +M++ A ELFE  PDLLH + T +NP  L+ N I +YRT+Q AGEFV+TFPRAYH+GFNQGFNFAEAVNFC  DW+  GR+ V+ YR + R  VFSH+E++C MA   +++D+ L  AV+++M ++ Q+EK  R+ +  +  GV  + ++  D++P+++R+C  CRTT Y+SGVTC        +D+M+CL H   LCSC    N+ L Y+++LD++  L+ +V  + E YK W+S                        +    +EN              +K  LEEL  L++       P   L+D L +I     +   M  QLL+  +
Sbjct:  289 ICLVCGSGSAEDRLLLCDGCDDSYHIFCLIPPLHEVPKGDWRCPKCLAQECGKPPV-----AFGFEQASRSYTLQTFGDMADSFKSDYFNMPVHMVPTELVEKEFWRLVS--TIEEDVTVEYGADIASKEFGSGFPVRNSHFEVSADDEHYLSSGWNLNNMPVLDASVLTHITADICGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGAPGYAAEHLESVMKKLAPELFESQPDLLHQLVTIMNPNTLMNNGIPIYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTMDWMPIGRSCVDHYRQLSRYCVFSHDEMVCNMALKAKTMDVELASAVHEDMKVMIQDEKKLREWVSKL--GVVLSRQVDYDELPDEERQCFKCRTTCYLSGVTCGCS-----SDKMACLYHAQSLCSCPFS-NLTLNYKFTLDKLCPLMDSVKLRSESYKDWLS------------------------SAQDIVEN-----------KGSKKKGLEELHSLVEQAETKAFPKSSLVDQLRSITTEADKVAVMAQQLLNGKR 800          

HSP 2 Score: 157.532 bits (397), Expect = 8.765e-38
Identity = 73/158 (46.20%), Postives = 103/158 (65.19%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY 552
            F  PP  PVF P+ +EF DP  YI KIRP+A+K GICKI  P++W PPFA D    KF PR+QRLNE+ A +R+K NF+  I  FWE Q   L+IP V+   LDL++L+  V + GG   V + ++WT I  ++G+    K + S +R+++E+I+ PY
Sbjct:    9 FIPPPECPVFEPSWEEFADPFAYINKIRPIAEKTGICKIRPPQEWQPPFACDVDRLKFTPRIQRLNELEAQTRVKLNFLDQIAKFWELQGCTLKIPHVERKILDLYQLNKLVNEEGGFDAVCRERRWTKISVKMGFA-PGKAIGSHLRAHYERILFPY 165          

HSP 3 Score: 57.3806 bits (137), Expect = 2.311e-7
Identity = 36/118 (30.51%), Postives = 64/118 (54.24%), Query Frame = 1
Query: 3805 ELEWMWNLRELNEDK--ASKDSSGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFH 4152
            E+  +  LR+ NE K   +++ S  +  C C+K  +   G  V C+LC+D FH SC+ +       + +LCP C+RSK+PP + +L     L++    +++PE  AL  + +R + + 
Sbjct: 1132 EMAILLALRDSNEAKLLPAENCSALNV-CVCQKAPL---GEMVQCELCRDLFHCSCVAMAADLEFGQAWLCPLCKRSKKPPLDKVLPLLASLQR--IRVRLPEGDALRFLIERTVRWQ 1243          
BLAST of Lysine-specific demethylase 5A vs. Ensembl Medaka
Match: kdm5ba (lysine-specific demethylase 5B [Source:NCBI gene;Acc:101160898])

HSP 1 Score: 457.218 bits (1175), Expect = 9.076e-133
Identity = 238/562 (42.35%), Postives = 333/562 (59.25%), Query Frame = 1
Query:  709 LCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKE-VEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLLQIGRNMNIP-IYLLDFLEAIVETCQRAMAMTDQLLSSHK 2388
            +C +C S ++   ++ C  CD  YHI C+ PPL +VPK  W C +CL   C K         FGF Q++  Y+L +F   AD+FK  YFN   ++   E VE+E+WRLV+   + +DV V+YGADI+S    SGFP R +    +  D+ Y+ SGWNLNN+PVL  S+   ++ DI GM VPW YVGM FS FCWHIEDHWSYSINYLH G+ KTWYG P   AE  E +M++ A ELFE  PDLLH + T +NP  L+ N I +YRT+Q AGEFV+TFPRAYH+GFNQGFNFAEAVNFC  DW+  GR+ V+ YR + R  VFSH+E++C MA   +++D+ L  AV+++M ++ Q+EK  R+ +  +  GV  + ++  D++P+++R+C  CRTT Y+SGVTC        +D+M+CL H   LCSC    N+ L Y+++LD++  L+ +V  + E YK W+S                        +    +EN              +K  LEEL  L++       P   L+D L +I     +   M  QLL+  +
Sbjct:  288 ICLVCGSGSAEDRLLLCDGCDDSYHIFCLIPPLHEVPKGDWRCPKCLAQECGKPPV-----AFGFEQASRSYTLQTFGDMADSFKSDYFNMPVHMVPTELVEKEFWRLVS--TIEEDVTVEYGADIASKEFGSGFPVRNSHFEVSADDEHYLSSGWNLNNMPVLDASVLTHITADICGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGAPGYAAEHLESVMKKLAPELFESQPDLLHQLVTIMNPNTLMNNGIPIYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTMDWMPIGRSCVDHYRQLSRYCVFSHDEMVCNMALKAKTMDVELASAVHEDMKVMIQDEKKLREWVSKL--GVVLSRQVDYDELPDEERQCFKCRTTCYLSGVTCGCS-----SDKMACLYHAQSLCSCPFS-NLTLNYKFTLDKLCPLMDSVKLRSESYKDWLS------------------------SAQDIVEN-----------KGSKKKGLEELHSLVEQAETKAFPKSSLVDQLRSITTEADKVAVMAQQLLNGKR 799          

HSP 2 Score: 157.532 bits (397), Expect = 8.711e-38
Identity = 73/158 (46.20%), Postives = 103/158 (65.19%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY 552
            F  PP  PVF P+ +EF DP  YI KIRP+A+K GICKI  P++W PPFA D    KF PR+QRLNE+ A +R+K NF+  I  FWE Q   L+IP V+   LDL++L+  V + GG   V + ++WT I  ++G+    K + S +R+++E+I+ PY
Sbjct:    9 FIPPPECPVFEPSWEEFADPFAYINKIRPIAEKTGICKIRPPQEWQPPFACDVDRLKFTPRIQRLNELEAQTRVKLNFLDQIAKFWELQGCTLKIPHVERKILDLYQLNKLVNEEGGFDAVCRERRWTKISVKMGFA-PGKAIGSHLRAHYERILFPY 165          

HSP 3 Score: 57.3806 bits (137), Expect = 2.722e-7
Identity = 36/118 (30.51%), Postives = 64/118 (54.24%), Query Frame = 1
Query: 3805 ELEWMWNLRELNEDK--ASKDSSGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFH 4152
            E+  +  LR+ NE K   +++ S  +  C C+K  +   G  V C+LC+D FH SC+ +       + +LCP C+RSK+PP + +L     L++    +++PE  AL  + +R + + 
Sbjct: 1131 EMAILLALRDSNEAKLLPAENCSALNV-CVCQKAPL---GEMVQCELCRDLFHCSCVAMAADLEFGQAWLCPLCKRSKKPPLDKVLPLLASLQR--IRVRLPEGDALRFLIERTVRWQ 1242          
BLAST of Lysine-specific demethylase 5A vs. Planmine SMEST
Match: SMESG000015058.1 (SMESG000015058.1)

HSP 1 Score: 3717.16 bits (9638), Expect = 0.000e+0
Identity = 2003/2011 (99.60%), Postives = 2004/2011 (99.65%), Query Frame = 1
Query:   58 MPNKKVIFERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQPKTMKYKTALTLESPKMTRSKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXXXXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLLQIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLSSHKAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIVSSHEEQAEKLTLGEMRLLVEKLRSLPAHVPQLEEAAQTLHSINEWRKKVRMTVSCVDVIEENVITNLVESGESNLVYLSEYQMLQKMRLYTVWIGKSRQLFKSSEHCPPPPLDEFRKVRDEGIGLINTIEIDRIXXXXXXXXXXXXXXXXXXXXXXXXFRMSGWRILVDNLQKNEKQLSKIIIDGDAMQKKAEDILKSTPGVFALFSLNSLLKSADAELKCTVPGIDRLKEVVNEAVIVNEGINEMWQKLQQCRRLVHVEEMQTLIKQADSLCVAFDRLSDLKSLFRTIDAWKKNLHGLFIKNSHNSYLTTPTLLEVLFPRPQRQFKLMIAREAVSSKLVDDCKTESTMKESSVKDEPESCDEEKQTDDQKSIKTNRSCRKSRGRQKRSSLAPDDPQIARLDNVVVFESHLRSGYVGESEFNGNYKKMCVNELEWMWNLRELNEDKASKDSSGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQTELGAAFAEYKRLFGVQAILPKFNQSGTPTQQELSPILDQVQDASLLHLSTSKQSRKTPHCMSKNAVSTTNPIIPPQINLKSSPVPNKETLMNINRLKSSLSEDARRXXXXXXXXXXXXXVSQPTVTWIWKLYHSLIDNDDEELQNQIGSDTETCKRELRVDKSGENSDNSDTEDETYDIPNMEYMRNVLSQKRGGRKDYKMMIPLGDGGGDIRHDNKHVKREPSAFSILGTSDDKREPLCKFSFKRKLAAKDLVQXXXXXXXXXXXXXXXXKKQPVEXXXXXXXXXXXXXXXXXASRDRDMWDCSKNPTISSEYYDMENDMILLDKVVKSQENXXXXXXXXXXXXXNSGVAELSRAVAAPTDEVKLSGTRQPRVTASNKYAKLSMSDKSDYSDEVAPSHKSLEIKPVITQSKRGRKPGSTVNKEPSTGGAMKRRRKCGVGTGPGHASTXXXXXXXXTKRICNDDCSADMCVQQSSEKVNWVACDSCDQWFHWLCVDIKSEIEFRIQIEQKFLCPRCKCSKRQKRIPVLISDHKPQTRDHRIPTVVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNVTLDEEXXXXXXXXXXXXVLNRLKSVDLLSPLCPQDGNVNFSMNLSPPSLFMQP 6090
            MPNKKVIFERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQPKTMKYKTALTLESPKMTRSKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYR+VKRPSVFSHNELICKMASSLESLDLLLLKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSC SKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLLQIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLSSHKAIIKEENKENENSVKSESKLKKSNNNNTNNNIELKSTNKIVSSHEEQAEKLTLGEMRLLVEKLRSLPAHVPQLEEAAQTLHSINEWRKKVRMTVSCVDVIEENVITNLVESGESNLVYLSEYQMLQKMRLYTVWI KSRQLFKSSEHCPPPPLDEFRKVRDEGIGLINTIEIDRIATLTETLELEDEDEPADDYDESADFRMSGWRILVDNLQKNEKQLSKIIIDGDAMQKKAEDILKSTPGVFALFSLNSLLKSADAELKCTVPGIDRLKEVVNEAVIVNEGINEMWQKLQQCRRLVHVEEMQTLIKQADSLCVAFDRLSDLKSLFRTIDAWKKNLHGLFIKNSHNSYLTTPTLLEVLFPRPQRQFKLMIAREAVSSKLVDDCKTESTMKESSVKDEPESCDEEKQTDDQKSIKTNRSCRKSRGRQKRSSLAPDDPQIARLDNVVVFESHLRSGYVGESEFNGNYKKMCVNELEWMWNLRELNEDKASKDSSGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQTELGAAFAEYKRLFGVQAILPKFNQSGTPTQQELSPILDQVQDASLLHLSTSKQSRKTPHCMSKNAVSTTNPIIPPQINLKSSPVPNKETLMNINRLKSSLSEDARRELEEIYIELCLLEVSQPTVTWIWKLYHSLIDNDDEELQNQIGSDTETCKRELRVDKSGENSDNSDTEDETYDIPNMEYMRNVLSQKRGGRKDYKMMIP GDGGGDIRHDNKHVKREPSAFSILGTSDDKREPLCKFSFKRKLAAKDLVQSSVTNTTTSGSTGISVKKQPVEKVVKGGPTRKRGRGGKVASRDRDMWDCSKNPTISSEYYDMENDMILLDKVVKSQENKAKSKKSKASASSNSGVAELSRAVAAPTDEVKLSGTRQPRVTASNKYAKLSMSDKSDYSDEVAPSHKSLEIKPVITQSKRGRKPGSTVNKEPSTGGAMKRRRKCGVGTGPGHASTGRGVGGGGTKRICNDDCSADMCVQQSSEKVNWVACDSCDQWFHWLCVDIKSEIE    IEQKFLCPRCKCSKRQKRIPVLISDHKPQTRDHRIPTVVTDRGDGDGDDNIDNDDDDDDDDDGIAEDEMDGDDLNVTLDEEIIPLSKPISLPPVLNRLKSVDLLSPLCPQDGNVNFSMNLSPPSLFMQP
Sbjct:    1 MPNKKVIFERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQPKTMKYKTALTLESPKMTRSKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPLSDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKNVSLKEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRIVKRPSVFSHNELICKMASSLESLDLLLLKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCPSKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEEGRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLLQIGRNMNIPIYLLDFLEAIVETCQRAMAMTDQLLSSHKAIIKEENKENENSVKSESKLKKSNNNNTNNNIELKSTNKIVSSHEEQAEKLTLGEMRLLVEKLRSLPAHVPQLEEAAQTLHSINEWRKKVRMTVSCVDVIEENVITNLVESGESNLVYLSEYQMLQKMRLYTVWISKSRQLFKSSEHCPPPPLDEFRKVRDEGIGLINTIEIDRIATLTETLELEDEDEPADDYDESADFRMSGWRILVDNLQKNEKQLSKIIIDGDAMQKKAEDILKSTPGVFALFSLNSLLKSADAELKCTVPGIDRLKEVVNEAVIVNEGINEMWQKLQQCRRLVHVEEMQTLIKQADSLCVAFDRLSDLKSLFRTIDAWKKNLHGLFIKNSHNSYLTTPTLLEVLFPRPQRQFKLMIAREAVSSKLVDDCKTESTMKESSVKDEPESCDEEKQTDDQKSIKTNRSCRKSRGRQKRSSLAPDDPQIARLDNVVVFESHLRSGYVGESEFNGNYKKMCVNELEWMWNLRELNEDKASKDSSGHDFYCFCRKRGMDQKGAQVMCDLCQDWFHLSCLGIQNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPEHIALCLMSQRVINFHKHTNHLFSPQTELGAAFAEYKRLFGVQAILPKFNQSGTPTQQELSPILDQVQDASLLHLSTSKQSRKTPHCMSKNAVSTTNPIIPPQINLKSSPVPNKETLMNINRLKSSLSEDARRELEEIYIELCLLEVSQPTVTWIWKLYHSLIDNDDEELQNQIGSDTETCKRELRVDKSGENSDNSDTEDETYDIPNMEYMRNVLSQKRGGRKDYKMMIPPGDGGGDIRHDNKHVKREPSAFSILGTSDDKREPLCKFSFKRKLAAKDLVQSSVTNTTTSGSTGISVKKQPVEKVVKGGPTRKRGRGGKVASRDRDMWDCSKNPTISSEYYDMENDMILLDKVVKSQENKAKSKKSKASASSNSGVAELSRAVAAPTDEVKLSGTRQPRVTASNKYAKLSMSDKSDYSDEVAPSHKSLEIKPVITQSKRGRKPGSTVNKEPSTGGAMKRRRKCGVGTGPGHASTGRGVGGGGTKRICNDDCSADMCVQQSSEKVNWVACDSCDQWFHWLCVDIKSEIE----IEQKFLCPRCKCSKRQKRIPVLISDHKPQTRDHRIPTVVTDRGDGDGDDNIDNDDDDDDDDDGIAEDEMDGDDLNVTLDEEIIPLSKPISLPPVLNRLKSVDLLSPLCPQDGNVNFSMNLSPPSLFMQP 2007          
BLAST of Lysine-specific demethylase 5A vs. Planmine SMEST
Match: SMESG000063374.1 (SMESG000063374.1)

HSP 1 Score: 530.02 bits (1364), Expect = 1.545e-157
Identity = 303/769 (39.40%), Postives = 428/769 (55.66%), Query Frame = 1
Query:   79 FERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPKQWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQ-NNPLEIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQLCSIVRSYFEKIIQPY-----LDFYDNIFINKNPDLFPENIQPKTMKYKTALT---LESPKMTRSKAL-------------------------IVQKPVNE------LCKICESPTSPSTMVTCFECDCR--YHISCVDPPLSDVPKTGWICKRC-LQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADNFKKTYFNDRKN--VSLKEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPT----------RTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMAXXXXXXX----------------------------XXXXKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQIPEDDRECMICRTTLYISGVTCSVCCQD-KLAD---------RMSCLDHVSQLCSCASKENIVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRV 2106
            F  PP  PVFRPT +EF+DPL+YIE+IRP+A K GIC+II P  W PPF+V+ +TF+F PRVQ+L E+ A SRIK NF+  +  F   Q ++ L+IP +    +DL++LH  V + GG   +  NK W  I  ++GY  KS      +R+++EKII PY      D   NI+I+++       + P T K + +L    ++   M  S  L                         +V  P+        +CK C S      ++ C   +C+  YH  C+ PPLS VPK  W C  C L+V  +K L       +GF  S+  Y+L  F   AD FK  YF    +  V    VE+E+WR++ + N  DD++V+YGADI S    SGFPT          R N     +   +Y +  WNLN LP+ KKS+ RF+  +I GM VPWCYVGMVFS FCWHIEDHWS+SINYLH G+ KTWYGV   +AE+FE  MR++A ELF+   DLLHHITT +NP +L+K  + VYRTDQ AG+FVVTFPRAYHAGFNQGFNFAEAVNFCPA+WL+ GR  VE Y  + R  VFSH+EL+C +A +                                   + + V+ E+ ++ +EE+  R +I  M   + + E+ L + + +D+R C IC+TT ++S   C    ++ K+A+         R+ CL H++ +C+          YR++L+E+  L+S +  +L+ +  W + +
Sbjct:    7 FVSPPECPVFRPTKEEFKDPLEYIEQIRPIAVKSGICRIIPPDDWTPPFSVNVNTFQFTPRVQKLYELEAQSRIKLNFMTKLSQFVRLQGSDKLKIPNINGRHVDLYKLHKLVHENGGYDHIIANKLWLKIATKMGY--KSTSQAYSLRTHYEKIILPYDIMLSADHDSNIYISQSTVKPKPVLHPSTTKKRKSLQSDPIDESLMETSNELKRLQFSGAGPRIYASTKDEVKLEDDLVSGPLKRKCLSDYVCKTCGSGDKEDKLLICDNEECQDCYHCDCLAPPLSQVPKQSWKCHNCVLEVLSKKPLE------YGFPSSSITYTLYEFGKSADKFKANYFGKELHELVPCSSVEKEFWRILQSFN--DDIIVEYGADIHSSHQGSGFPTLENIKNGKCARNNGEPNMDLAIQYSNELWNLNILPITKKSVLRFIRGNIDGMKVPWCYVGMVFSSFCWHIEDHWSFSINYLHWGEPKTWYGVSSENAEQFEVAMRKQAPELFDNHEDLLHHITTIMNPNILMKEGVPVYRTDQQAGQFVVTFPRAYHAGFNQGFNFAEAVNFCPANWLSMGRLCVEHYAQLHRHCVFSHDELLCTIAEAALLEQDNIPDEEIPVKYPLMSGLNMSSTDICLDTNIRRTVHAELELVVEEERQFRMKIEKM--NLTKIEQTLFENLKDDERACCICQTTCFLSAFRCQCINEELKMAEDMKTEKKLKRIVCLRHINNVCNSCPISEWTFLYRFTLEEMDRLLSGLEVRLQDFHSWEADI 763          
BLAST of Lysine-specific demethylase 5A vs. Planmine SMEST
Match: SMESG000042544.1 (SMESG000042544.1)

HSP 1 Score: 125.561 bits (314), Expect = 8.371e-30
Identity = 71/213 (33.33%), Postives = 109/213 (51.17%), Query Frame = 1
Query: 1003 EVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRASV 1641
            ++E +YW   +  ++S  +   YGA++S  +T +               Q+Y    WN+  LP +   + +     I G+  P+ Y G   S F WH+ED   YSINYLH G  K WY +P   + +FE+L+++  S  +EK P  L H    I+P  L  N I   +  Q   EF++TFP  YH+GFN G N AE+ NF  + W+  G+ ++
Sbjct:  128 DLESQYW---STFHLSRPI---YGANVSGTITDAS--------------QEY----WNIAALPSILSDVLK---EPIGGVNTPYLYFGSWRSTFGWHVEDVDLYSINYLHFGMAKFWYVIPPPFSRRFENLVKKLFSVEYEKCPAFLRHKVVIISPEFLRLNGIPTRKILQEENEFMITFPYGYHSGFNTGLNIAESTNFASSRWIEYGKQAL 313          
BLAST of Lysine-specific demethylase 5A vs. Planmine SMEST
Match: SMESG000036910.1 (SMESG000036910.1)

HSP 1 Score: 123.25 bits (308), Expect = 1.124e-27
Identity = 72/212 (33.96%), Postives = 101/212 (47.64%), Query Frame = 1
Query: 1003 EVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSGFPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWCYVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQEASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYHAGFNQGFNFAEAVNFCPADWLTKGRAS 1638
            ++E +YW  +           +YGA++S  LT              +K QK     WN+ +LP L  S+       + G+  P+ Y G   + F WH+ED   YSINYLH G  K WY +P + A+KFE + R      F K    L H T  ++P  L +  I   +  Q   EF+ TFP  YHAGFN G N AE+ NF    W+  G+ +
Sbjct:  128 DLERKYWSNLTYSKP------QYGANVSGTLT--------------DKSQKV----WNIAHLPTLLSSVLEEQKLKLDGVNTPYLYFGSWQTTFGWHVEDVDLYSINYLHHGMPKHWYVIPPAYAKKFEMIARDLYKADFLKCNLFLRHKTVVLSPHFLRRQGIPTRKIVQEENEFMYTFPYGYHAGFNMGLNIAESTNFAGPRWIEFGKQA 315          
The following BLAST results are available for this feature:
BLAST of Lysine-specific demethylase 5A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KDM5B8.383e-17642.78lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC... [more]
KDM5C1.745e-13146.90lysine demethylase 5C [Source:HGNC Symbol;Acc:HGNC... [more]
KDM5B2.736e-13147.32lysine demethylase 5B [Source:HGNC Symbol;Acc:HGNC... [more]
KDM5C8.541e-13146.90lysine demethylase 5C [Source:HGNC Symbol;Acc:HGNC... [more]
KDM5C9.927e-13146.90lysine demethylase 5C [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Lysine-specific demethylase 5A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rbr-21.988e-10038.59Lysine-specific demethylase rbr-2 [Source:UniProt... [more]
rbr-22.588e-10038.59Lysine-specific demethylase rbr-2 [Source:UniProt... [more]
jmjd-21.099e-2531.58Lysine-specific demethylase 4 [Source:UniProtKB/S... [more]
phf-141.413e-640.00PHd Finger family [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
back to top
BLAST of Lysine-specific demethylase 5A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lid4.918e-12746.86gene:FBgn0031759 transcript:FBtr0079231[more]
lid4.918e-12746.86gene:FBgn0031759 transcript:FBtr0079232[more]
lid4.918e-12746.86gene:FBgn0031759 transcript:FBtr0307070[more]
lid4.918e-12746.86gene:FBgn0031759 transcript:FBtr0345336[more]
lid4.918e-12746.86gene:FBgn0031759 transcript:FBtr0307071[more]
back to top
BLAST of Lysine-specific demethylase 5A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdm5ba3.890e-17134.81lysine (K)-specific demethylase 5Ba [Source:ZFIN;A... [more]
kdm5ba6.830e-17134.44lysine (K)-specific demethylase 5Ba [Source:ZFIN;A... [more]
kdm5ba9.870e-17134.30lysine (K)-specific demethylase 5Ba [Source:ZFIN;A... [more]
kdm5c1.092e-13245.59lysine (K)-specific demethylase 5C [Source:ZFIN;Ac... [more]
kdm5bb1.088e-12442.94lysine (K)-specific demethylase 5Bb [Source:NCBI g... [more]
back to top
BLAST of Lysine-specific demethylase 5A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elp10.000e+045.74elongator complex protein 1 [Source:Xenbase;Acc:XB... [more]
elp11.806e-17945.13elongator complex protein 1 [Source:Xenbase;Acc:XB... [more]
elp11.807e-17945.74elongator complex protein 1 [Source:Xenbase;Acc:XB... [more]
elp11.861e-17945.74elongator complex protein 1 [Source:Xenbase;Acc:XB... [more]
elp11.420e-17845.74elongator complex protein 1 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Lysine-specific demethylase 5A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kdm5a2.570e-13648.21lysine (K)-specific demethylase 5A [Source:MGI Sym... [more]
Kdm5c4.941e-13146.90lysine (K)-specific demethylase 5C [Source:MGI Sym... [more]
Kdm5c8.784e-13146.90lysine (K)-specific demethylase 5C [Source:MGI Sym... [more]
Kdm5c9.680e-13146.90lysine (K)-specific demethylase 5C [Source:MGI Sym... [more]
Kdm5a2.695e-13048.21lysine (K)-specific demethylase 5A [Source:MGI Sym... [more]
back to top
BLAST of Lysine-specific demethylase 5A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q38JA7|KDM5C_CANLF1.030e-13047.11Lysine-specific demethylase 5C OS=Canis lupus fami... [more]
sp|Q30DN6|KDM5D_CANLF1.191e-13046.90Lysine-specific demethylase 5D OS=Canis lupus fami... [more]
sp|P41229|KDM5C_HUMAN5.754e-13046.90Lysine-specific demethylase 5C OS=Homo sapiens OX=... [more]
sp|P41230|KDM5C_MOUSE6.771e-13046.90Lysine-specific demethylase 5C OS=Mus musculus OX=... [more]
sp|Q3UXZ9|KDM5A_MOUSE1.885e-12948.21Lysine-specific demethylase 5A OS=Mus musculus OX=... [more]
back to top
BLAST of Lysine-specific demethylase 5A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q3RSB50.000e+030.90Lysine (K)-specific demethylase 5Ba OS=Mastacembel... [more]
A0A5G3J7Q80.000e+045.74Elongator complex protein 1 OS=Xenopus tropicalis ... [more]
A0A4W5MGS80.000e+043.08Lysine (K)-specific demethylase 5C OS=Hucho hucho ... [more]
A0A4W5NQB80.000e+043.84Lysine (K)-specific demethylase 5C OS=Hucho hucho ... [more]
A0A4W5MGQ71.235e-17943.45Lysine (K)-specific demethylase 5C OS=Hucho hucho ... [more]
back to top
BLAST of Lysine-specific demethylase 5A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdm5bb0.000e+030.86lysine-specific demethylase 5B-B-like [Source:NCBI... [more]
kdm5a9.021e-17542.68lysine (K)-specific demethylase 5A [Source:ZFIN;Ac... [more]
kdm5ba5.460e-15837.50lysine (K)-specific demethylase 5Ba [Source:ZFIN;A... [more]
kdm5bb1.214e-15030.89lysine-specific demethylase 5B-B-like [Source:NCBI... [more]
kdm5bb3.374e-15030.89lysine-specific demethylase 5B-B-like [Source:NCBI... [more]
back to top
BLAST of Lysine-specific demethylase 5A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdm5c3.064e-13646.36lysine (K)-specific demethylase 5C [Source:ZFIN;Ac... [more]
kdm5c2.375e-12746.09lysine (K)-specific demethylase 5C [Source:ZFIN;Ac... [more]
jarid2a8.353e-4723.09jumonji, AT rich interactive domain 2a [Source:ZFI... [more]
ENSPMAT00000005764.12.047e-1429.70pep scaffold:Pmarinus_7.0:GL480846:34625:43736:-1 ... [more]
ENSPMAT00000005177.11.883e-1124.60pep scaffold:Pmarinus_7.0:GL477523:31773:39538:1 g... [more]
back to top
BLAST of Lysine-specific demethylase 5A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
JHD21.059e-8530.95JmjC domain family histone demethylase; promotes g... [more]
RPH13.822e-3030.54JmjC domain-containing histone demethylase; target... [more]
ECM55.324e-2324.59Subunit of the Snt2C complex; physically associate... [more]
GIS11.484e-2035.42Histone demethylase and transcription factor; regu... [more]
back to top
BLAST of Lysine-specific demethylase 5A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348831.253e-8250.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464792.135e-3334.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390573.032e-1025.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350835.316e-750.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375876.465e-642.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lysine-specific demethylase 5A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdm5a3.031e-17936.71lysine demethylase 5A [Source:NCBI gene;Acc:101161... [more]
kdm5c8.018e-13441.77lysine demethylase 5C [Source:NCBI gene;Acc:101167... [more]
kdm5c8.364e-13441.77lysine demethylase 5C [Source:NCBI gene;Acc:101167... [more]
kdm5ba6.858e-13342.35lysine-specific demethylase 5B [Source:NCBI gene;A... [more]
kdm5ba9.076e-13342.35lysine-specific demethylase 5B [Source:NCBI gene;A... [more]
back to top
BLAST of Lysine-specific demethylase 5A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000015058.10.000e+099.60SMESG000015058.1[more]
SMESG000063374.11.545e-15739.40SMESG000063374.1[more]
SMESG000042544.18.371e-3033.33SMESG000042544.1[more]
SMESG000036910.11.124e-2733.96SMESG000036910.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012152 ID=SMED30012152|Name=Lysine-specific demethylase 5A|organism=Schmidtea mediterranea sexual|type=transcript|length=7617bp
TTTGCAAATGTCCAAATCCATTATTGTCAATTAAATTTTTTTATTTTTTA
ATTTATTATGCCTAATAAAAAAGTAATATTTGAACGTCCTCCAGCGGCGC
CTGTTTTTAGACCTACATTAAAAGAGTTTGAAGATCCATTAGATTACATT
GAAAAAATTAGACCTGTTGCTCAAAAGTATGGTATATGTAAAATTATATC
ACCAAAGCAATGGAATCCTCCATTTGCAGTTGATTCACATACTTTCAAAT
TTCGACCTCGCGTACAAAGATTAAATGAAATTGGCGCACATTCTCGTATA
AAAAATAATTTTATACGAACTATTGAAGCCTTTTGGGAATGTCAAAATAA
CCCACTTGAAATTCCAATTGTGAAGAATAATCCATTAGATTTATTTGAAT
TACACACTAAAGTTAAACAGTATGGTGGATGTCACCAGGTCACTAAAAAT
AAACAATGGACTCATATTTGTCGAGAGTTAGGATATGGCGAAAAATCCAA
GCAATTGTGTTCAATTGTCAGATCGTATTTTGAGAAAATCATTCAACCAT
ATCTGGACTTTTATGACAACATTTTTATAAATAAAAACCCGGATTTATTT
CCAGAAAATATCCAGCCTAAAACAATGAAATACAAGACCGCATTAACTCT
TGAATCACCTAAAATGACACGATCGAAAGCGCTGATTGTTCAAAAACCGG
TGAATGAGTTGTGCAAAATTTGCGAGTCTCCAACGAGCCCATCGACCATG
GTTACGTGTTTCGAATGTGACTGTCGATATCACATCAGTTGCGTCGATCC
GCCCTTGTCCGACGTGCCTAAAACCGGCTGGATCTGCAAGCGATGTCTGC
AGGTTTCATGCCAAAAAGAGTTGGCCCGCCTCAACACCGAAGTGTTCGGT
TTCTCGCAATCCAACTGCAAATACAGTCTCGACAGTTTCTCGGTATACGC
CGATAATTTTAAGAAAACGTATTTTAACGACCGCAAAAATGTCAGTCTGA
AAGAAGTCGAAGAGGAATACTGGAGATTGGTGGCAGCGGAAAACGTGTCG
GACGATGTTGTAGTCAAATACGGAGCCGATATTAGTTCTGGACTGACGAG
TAGCGGGTTTCCCACGCGAACCAATCAGACAATGTTCAATGAGAAAGACC
AGAAATATGTTGACAGTGGGTGGAATCTCAACAATCTCCCGGTGTTGAAG
AAATCCATCTTTCGGTTTGTGTCTAATGACATATCCGGGATGACAGTGCC
TTGGTGTTACGTCGGGATGGTGTTTTCGTGTTTCTGTTGGCATATCGAGG
ATCACTGGAGTTACTCGATAAATTATTTGCACACCGGGGACTGCAAAACC
TGGTATGGAGTACCGGAAAGTGATGCGGAAAAATTTGAGGATTTAATGCG
ACAGGAAGCCAGTGAACTTTTTGAGAAATCTCCGGATTTATTGCATCACA
TTACTACTCAGATCAATCCGACTCTGTTGATCAAGAACGATATCAAGGTC
TACCGAACTGACCAGGCAGCCGGGGAATTTGTGGTCACGTTTCCAAGAGC
ATATCATGCCGGTTTCAATCAGGGATTTAATTTTGCTGAAGCCGTCAATT
TTTGTCCAGCTGATTGGCTTACCAAAGGCCGAGCATCCGTGGAAAGCTAT
CGATTAGTTAAGCGACCTTCTGTGTTTTCCCACAATGAATTGATCTGCAA
AATGGCGTCCTCTCTCGAATCACTGGATTTGCTGCTGCTAAAAGCGGTTT
ACGATGAAATGATGATAATCCAGCAGGAAGAGAAGCTGCACCGGAAGCAG
ATCTGTACAATGGTGCAGGGCGTGTGCCGGACCGAGCGGTTGCTACTGGA
CCAAATCCCAGAGGACGACAGGGAGTGTATGATCTGCCGGACAACATTGT
ACATATCAGGGGTGACATGCAGTGTGTGCTGCCAGGACAAACTGGCAGAT
CGGATGTCCTGTCTGGATCACGTGTCTCAACTGTGCAGCTGTGCCAGCAA
GGAGAACATTGTGCTTAAATATCGATATTCCCTCGATGAGATCACGGTGC
TCGTATCGAATGTCCACAAGCAGTTGGAGCAATACAAGTTGTGGATGAGT
AGGGTTTATCACCTGGCCAAATCAGAGTTCTGCTCGAGCCCGGTCACTCC
GGAGGAGGGACGGGTAATGAGGAATGTCTCCTCATTCATTGAGAATCTCG
ATATTCTCCGCGAGCAGTTCAACAATAAAAATATCGAGGAGAAACCGAAT
CTAGAGGAATTGAAGATGCTTTTACAAATCGGCCGGAACATGAATATTCC
AATTTATCTCCTTGATTTTCTGGAAGCGATAGTCGAGACGTGCCAGCGTG
CGATGGCCATGACCGATCAATTATTGAGCTCTCATAAGGCTATTATTAAA
GAAGAAAATAAAGAAAATGAAAATTCCGTCAAATCTGAATCAAAATTGAA
GAAATCCAACAATAATAATACTAATAATAACATTGAATTGAAATCAACCA
ATAAAATCGTCAGCAGCCATGAAGAACAAGCGGAAAAATTGACACTAGGA
GAAATGCGATTATTGGTGGAAAAGTTGCGCAGCTTGCCGGCACATGTGCC
CCAATTGGAAGAGGCTGCACAAACTCTTCATTCAATCAATGAGTGGCGGA
AAAAGGTTCGAATGACCGTTTCTTGTGTCGATGTAATTGAAGAGAACGTA
ATAACGAATCTCGTCGAATCCGGCGAATCAAATCTCGTTTATTTATCAGA
ATATCAAATGCTTCAAAAAATGCGACTGTACACGGTTTGGATCGGCAAAT
CCCGACAGCTATTTAAGTCCTCGGAACATTGTCCCCCGCCACCACTGGAT
GAATTTAGAAAAGTTCGCGACGAAGGAATCGGGCTTATTAACACGATAGA
AATTGATCGGATTGCGACTCTGACCGAAACTCTCGAGCTGGAAGATGAAG
ACGAGCCAGCGGATGATTACGATGAGTCTGCTGATTTCCGAATGAGCGGT
TGGAGGATTCTGGTGGACAATTTACAGAAAAATGAAAAACAGCTATCAAA
GATTATAATCGACGGAGATGCGATGCAAAAGAAAGCAGAAGATATTCTGA
AATCTACACCTGGCGTTTTCGCACTGTTCTCATTGAATTCTTTATTGAAA
TCGGCAGATGCTGAATTGAAATGTACAGTGCCTGGAATCGATAGGTTGAA
AGAAGTTGTCAATGAAGCTGTGATAGTAAATGAGGGAATTAATGAAATGT
GGCAAAAACTGCAACAATGTCGTCGACTTGTTCACGTAGAAGAAATGCAA
ACTCTCATCAAACAAGCCGATTCTTTGTGCGTTGCATTTGACCGTTTATC
GGATTTAAAGTCGCTCTTTCGAACTATAGATGCATGGAAAAAGAACTTAC
ATGGTTTATTCATTAAAAACAGTCACAATTCGTATTTGACAACACCAACC
TTGCTGGAAGTACTTTTTCCTAGACCTCAACGGCAATTCAAATTGATGAT
AGCAAGAGAAGCGGTTTCATCGAAATTAGTCGATGATTGTAAAACCGAAT
CGACAATGAAAGAATCTAGTGTAAAAGATGAGCCGGAATCATGTGATGAA
GAAAAACAAACCGATGATCAAAAATCGATAAAAACAAATCGAAGCTGTCG
AAAAAGTCGTGGTCGTCAAAAACGATCTTCTTTGGCTCCAGATGATCCAC
AAATTGCCCGTTTGGATAACGTAGTGGTATTTGAGTCTCACTTGAGATCG
GGATATGTAGGAGAATCGGAATTCAATGGGAATTATAAGAAGATGTGTGT
CAATGAACTGGAATGGATGTGGAATCTTAGAGAATTAAATGAAGACAAAG
CTAGCAAAGACAGCAGTGGGCATGACTTCTATTGTTTTTGTCGGAAACGT
GGAATGGATCAAAAGGGAGCACAGGTTATGTGCGATCTATGCCAGGATTG
GTTTCACTTATCGTGTCTCGGTATCCAAAATAAAGACATGAGCAAAAAGA
AATTTCTTTGTCCACAATGTGAGCGATCAAAACGTCCACCATTTGAAGTG
ATTCTCGCCGAAAAACGAAAATTGGAACAAGAGGCAAAAATGTTGAAAAT
CCCCGAACATATAGCTCTGTGTTTGATGTCTCAACGAGTAATCAATTTCC
ATAAACATACAAACCATTTGTTTTCTCCTCAAACTGAACTAGGAGCTGCT
TTCGCAGAATATAAACGGCTATTTGGTGTGCAAGCGATCTTGCCTAAATT
CAATCAATCAGGAACTCCAACACAACAAGAGCTCTCTCCTATTCTCGACC
AAGTTCAAGACGCATCTCTGTTACATTTATCCACCAGTAAACAGTCTCGT
AAAACTCCTCATTGTATGTCTAAAAATGCCGTTTCTACTACAAATCCTAT
AATTCCTCCACAAATAAATCTCAAATCGTCTCCAGTTCCCAACAAGGAAA
CACTGATGAACATCAATCGATTAAAATCCTCCCTATCCGAAGATGCGCGT
CGGGAATTGGAGGAAATCTATATAGAATTATGCTTACTGGAAGTTAGTCA
GCCTACGGTGACCTGGATCTGGAAATTGTATCACAGTTTGATTGACAATG
ATGATGAAGAATTGCAAAATCAAATCGGATCAGACACTGAAACCTGCAAG
CGAGAACTGCGTGTCGATAAATCCGGGGAAAATTCTGACAACAGTGACAC
TGAAGATGAAACATATGACATTCCCAATATGGAATATATGCGCAATGTTC
TTAGCCAGAAGCGGGGCGGCAGAAAGGACTACAAAATGATGATACCACTC
GGTGACGGTGGCGGTGATATTAGGCATGACAACAAACATGTCAAGCGGGA
ACCCAGTGCATTCAGCATCCTCGGAACCTCAGACGACAAACGAGAGCCTT
TGTGTAAATTTTCTTTCAAAAGAAAATTGGCGGCAAAGGATTTGGTCCAA
TCATCTGTCACTAATACCACCACATCCGGTTCCACCGGTATCTCCGTGAA
AAAGCAACCAGTGGAAAAAGTAGTGAAAGGTGGTCCGACCCGAAAACGAG
GTCGCGGGGGTAAAGTCGCATCAAGGGATAGGGATATGTGGGATTGCTCA
AAAAATCCCACGATATCCAGCGAGTATTACGACATGGAAAACGACATGAT
ATTGTTGGATAAAGTTGTGAAATCTCAGGAAAATAAAGCAAAATCTAAAA
AGTCCAAAGCGAGTGCCAGTAGTAATTCGGGAGTCGCGGAATTGTCACGA
GCAGTGGCAGCACCGACGGATGAAGTGAAACTGAGCGGTACGAGGCAACC
GCGAGTAACCGCTAGCAACAAATACGCCAAATTGTCAATGTCAGACAAGA
GTGATTATTCGGACGAGGTAGCTCCCTCGCATAAATCTCTGGAAATCAAG
CCCGTTATCACCCAGTCTAAGCGCGGCAGGAAACCCGGCTCCACAGTGAA
TAAAGAACCCAGCACTGGTGGAGCAATGAAACGGAGAAGGAAATGTGGAG
TAGGGACGGGCCCCGGGCACGCAAGCACTGGCCGCGGGGTCGGCGGAGGG
GGAACCAAGCGCATATGCAATGATGATTGCTCTGCCGATATGTGCGTTCA
ACAGTCCAGCGAAAAGGTCAACTGGGTTGCGTGTGACAGTTGCGATCAGT
GGTTTCATTGGCTATGTGTTGACATCAAATCAGAAATTGAGTTTCGAATT
CAGATCGAGCAAAAATTCCTCTGTCCCAGGTGTAAATGTTCCAAGAGACA
GAAACGGATCCCGGTATTAATTTCTGATCATAAACCGCAGACTCGCGACC
ACAGAATCCCGACAGTGGTTACTGACCGTGGTGACGGTGACGGTGATGAC
AATATCGATAATGATGACGACGATGATGACGATGATGATGGAATCGCAGA
AGATGAAATGGATGGAGATGACCTAAATGTCACACTGGATGAAGAAATAA
TCCCCCTCTCAAAACCGATCAGTTTGCCTCCAGTTCTCAATCGATTGAAA
TCTGTGGATTTGCTCTCTCCCCTCTGTCCTCAAGATGGCAATGTTAATTT
CTCGATGAATTTGTCCCCGCCGTCTTTATTTATGCAGCCAGAGTGTTGCG
TTCAGGAAGAAGTGGTGGAGATCAGTTACGCTTCCCGATCCGACAGTGAT
TCCTGATCGGACTCCGCCGAGTCGCGATTAATTCCGCATGTAAATATGAG
CTCGCACACATACACACATACATACAAATATATTGCTATTTATTAGTAGA
TTCCGTCATCACTGTACAGCAGTAGTCAGCGCAATTAGAGGATTATCATT
TACAGCAATCCCCTTCTGGCCCCATTGGCTGAATTTAGTCACCTCCATTT
GCCGCTGTCCTTTTCTTTTAGCATTGTGATCTATCTTATTATTGTTATTA
TCATTTCCATTATTATTATTATTGTTGTCACCGTCACCACCACCACCACC
ATTGCAGCAGCCTCTATTGTGTTGGTTATCTATTCTTATTCTTTTCACTG
ATTAAATCGATATGATGAATTTTTTGACTTGATTTTGTTTGTGTAAATAA
ATTGTGATTTTAATATTATTCTTTGTAATTATCAATATTGATTTCATTGT
TTTCTGTTATCGTCGCTCGGGGTTAGTTGGTGATTTGTTATTTATTTATT
TATTACGATTGTGTGTGTGTATACCTCTGTAAATATTGTCTTTATTTTTA
TATTTATATATACATATGCACATGTCTGGTTATTACTACAGCTTCAATTG
ATAGCAAGTGTGCCCTTCTGGAACTGAGTTTCACTCTAATTGGCAACCCC
ATTATACATTTGTATGTTATCTGATTGGCTGGCAAATATGAATTCCGTGG
CGTTGGGTTGATTTATTATTTTTATATTTGTTTTAGATTTTAATATTATT
GTATTTATCTAATATTTGATAATTTTCATATACGAATGGAAGTAACTTGA
TTTTCGTTCTAAAACTTTAATGTTTTGAAAAAAATTGTTTTTATCACGGC
TATACTTAATCCAATATTGGAAGCAATTAGAGCAGATTTTAGTTTTTCGT
ATTGAATTGCAGAATTATATTCTATGTTTTAGGCAATTTAATCAACTTTG
TCTTTTATGTTGTATGGTGTACAAAATTATTTTTATAATCAAATGAAGTG
TAAACTTTGATAAATTTGTATTTGCCATCCAGGAGGCGTTTGTTGGTGTT
GATTAAGTCTGGCAATGTCCTCGGTATTGAAATGTTATTAGTCTTATTTA
AGAAGGCAGGATTAAGTGCCATGACCTGCTCTATGACTGCTATTTGCACA
TAAAAATGCGGCAACATTGACTTGTATTTTGTAAATACCGATGCACACTG
TTTAACGATATAAATAAAATGTAACGCTATATTACCTTACAGAAACTCTC
ATATACTTTTGTATGCGGTGTGATTCCTTAAGATAAGTTTCTATTGAAAC
AACGATGATTTGGCTCTTTAGTTGTATTTAATATTTTATAAGATTTATTT
CGAAAAAGGTGTATTGGGAACAGTAATTTAATGTCTTTTGTTTATGGACC
AAATGATCGTCAACTTATATGAGCTCACACGACCACTCAGGTGGAGCTAG
TAAATGTTTCATGTACA
back to top

protein sequence of SMED30012152-orf-1

>SMED30012152-orf-1 ID=SMED30012152-orf-1|Name=SMED30012152-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2033bp
MPNKKVIFERPPAAPVFRPTLKEFEDPLDYIEKIRPVAQKYGICKIISPK
QWNPPFAVDSHTFKFRPRVQRLNEIGAHSRIKNNFIRTIEAFWECQNNPL
EIPIVKNNPLDLFELHTKVKQYGGCHQVTKNKQWTHICRELGYGEKSKQL
CSIVRSYFEKIIQPYLDFYDNIFINKNPDLFPENIQPKTMKYKTALTLES
PKMTRSKALIVQKPVNELCKICESPTSPSTMVTCFECDCRYHISCVDPPL
SDVPKTGWICKRCLQVSCQKELARLNTEVFGFSQSNCKYSLDSFSVYADN
FKKTYFNDRKNVSLKEVEEEYWRLVAAENVSDDVVVKYGADISSGLTSSG
FPTRTNQTMFNEKDQKYVDSGWNLNNLPVLKKSIFRFVSNDISGMTVPWC
YVGMVFSCFCWHIEDHWSYSINYLHTGDCKTWYGVPESDAEKFEDLMRQE
ASELFEKSPDLLHHITTQINPTLLIKNDIKVYRTDQAAGEFVVTFPRAYH
AGFNQGFNFAEAVNFCPADWLTKGRASVESYRLVKRPSVFSHNELICKMA
SSLESLDLLLLKAVYDEMMIIQQEEKLHRKQICTMVQGVCRTERLLLDQI
PEDDRECMICRTTLYISGVTCSVCCQDKLADRMSCLDHVSQLCSCASKEN
IVLKYRYSLDEITVLVSNVHKQLEQYKLWMSRVYHLAKSEFCSSPVTPEE
GRVMRNVSSFIENLDILREQFNNKNIEEKPNLEELKMLLQIGRNMNIPIY
LLDFLEAIVETCQRAMAMTDQLLSSHKAIIKEENKENENSVKSESKLKKS
NNNNTNNNIELKSTNKIVSSHEEQAEKLTLGEMRLLVEKLRSLPAHVPQL
EEAAQTLHSINEWRKKVRMTVSCVDVIEENVITNLVESGESNLVYLSEYQ
MLQKMRLYTVWIGKSRQLFKSSEHCPPPPLDEFRKVRDEGIGLINTIEID
RIATLTETLELEDEDEPADDYDESADFRMSGWRILVDNLQKNEKQLSKII
IDGDAMQKKAEDILKSTPGVFALFSLNSLLKSADAELKCTVPGIDRLKEV
VNEAVIVNEGINEMWQKLQQCRRLVHVEEMQTLIKQADSLCVAFDRLSDL
KSLFRTIDAWKKNLHGLFIKNSHNSYLTTPTLLEVLFPRPQRQFKLMIAR
EAVSSKLVDDCKTESTMKESSVKDEPESCDEEKQTDDQKSIKTNRSCRKS
RGRQKRSSLAPDDPQIARLDNVVVFESHLRSGYVGESEFNGNYKKMCVNE
LEWMWNLRELNEDKASKDSSGHDFYCFCRKRGMDQKGAQVMCDLCQDWFH
LSCLGIQNKDMSKKKFLCPQCERSKRPPFEVILAEKRKLEQEAKMLKIPE
HIALCLMSQRVINFHKHTNHLFSPQTELGAAFAEYKRLFGVQAILPKFNQ
SGTPTQQELSPILDQVQDASLLHLSTSKQSRKTPHCMSKNAVSTTNPIIP
PQINLKSSPVPNKETLMNINRLKSSLSEDARRELEEIYIELCLLEVSQPT
VTWIWKLYHSLIDNDDEELQNQIGSDTETCKRELRVDKSGENSDNSDTED
ETYDIPNMEYMRNVLSQKRGGRKDYKMMIPLGDGGGDIRHDNKHVKREPS
AFSILGTSDDKREPLCKFSFKRKLAAKDLVQSSVTNTTTSGSTGISVKKQ
PVEKVVKGGPTRKRGRGGKVASRDRDMWDCSKNPTISSEYYDMENDMILL
DKVVKSQENKAKSKKSKASASSNSGVAELSRAVAAPTDEVKLSGTRQPRV
TASNKYAKLSMSDKSDYSDEVAPSHKSLEIKPVITQSKRGRKPGSTVNKE
PSTGGAMKRRRKCGVGTGPGHASTGRGVGGGGTKRICNDDCSADMCVQQS
SEKVNWVACDSCDQWFHWLCVDIKSEIEFRIQIEQKFLCPRCKCSKRQKR
IPVLISDHKPQTRDHRIPTVVTDRGDGDGDDNIDNDDDDDDDDDGIAEDE
MDGDDLNVTLDEEIIPLSKPISLPPVLNRLKSVDLLSPLCPQDGNVNFSM
NLSPPSLFMQPECCVQEEVVEISYASRSDSDS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036431ARID_dom_sf
IPR003349JmjN
IPR001965Znf_PHD
IPR003347JmjC_dom
IPR001606ARID_dom
IPR013637Lys_sp_deMease-like_dom
IPR004198Znf_C5HC2
IPR013083Znf_RING/FYVE/PHD
IPR019787Znf_PHD-finger
IPR019786Zinc_finger_PHD-type_CS
IPR011011Znf_FYVE_PHD
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0003677DNA binding
GO:0016706oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors
GO:0008168methyltransferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0032259methylation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003349JmjN domainSMARTSM00545JmjN_1coord: 13..54
e-value: 3.7E-20
score: 83.0
IPR003349JmjN domainPFAMPF02375JmjNcoord: 15..47
e-value: 1.1E-15
score: 57.2
IPR003349JmjN domainPROSITEPS51183JMJNcoord: 14..55
score: 18.317
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 218..264
e-value: 4.1E-10
score: 49.6
coord: 1275..1322
e-value: 6.2E-10
score: 49.0
coord: 1845..1893
e-value: 1.6E-5
score: 34.4
NoneNo IPR availableSMARTSM01014ARID_2coord: 76..166
e-value: 2.0E-20
score: 83.9
NoneNo IPR availableGENE3DG3DSA:2.60.120.650coord: 236..538
e-value: 8.5E-113
score: 379.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1909..1941
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1762..1829
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1710..1730
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1164..1194
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 783..813
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1762..1776
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 796..813
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1909..1928
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1164..1212
NoneNo IPR availablePANTHERPTHR10694JUMONJI DOMAIN CONTAINING PROTEINcoord: 217..687
coord: 1247..1374
NoneNo IPR availablePANTHERPTHR10694:SF3LYSINE-SPECIFIC DEMETHYLASE 5Bcoord: 217..687
coord: 1247..1374
NoneNo IPR availablePANTHERPTHR10694JUMONJI DOMAIN CONTAINING PROTEINcoord: 8..171
NoneNo IPR availablePANTHERPTHR10694:SF3LYSINE-SPECIFIC DEMETHYLASE 5Bcoord: 8..171
NoneNo IPR availableCDDcd16864ARID_JARIDcoord: 79..165
e-value: 5.73406E-22
score: 89.6769
NoneNo IPR availableSUPERFAMILYSSF51197Clavaminate synthase-likecoord: 308..568
IPR001606ARID DNA-binding domainSMARTSM00501bright_3coord: 80..171
e-value: 2.1E-19
score: 80.5
IPR001606ARID DNA-binding domainPFAMPF01388ARIDcoord: 82..165
e-value: 2.9E-15
score: 56.7
IPR001606ARID DNA-binding domainPROSITEPS51011ARIDcoord: 79..170
score: 22.542
IPR003347JmjC domainSMARTSM00558cupin_9coord: 366..532
e-value: 1.5E-62
score: 223.8
IPR003347JmjC domainPFAMPF02373JmjCcoord: 399..515
e-value: 3.3E-43
score: 146.7
IPR003347JmjC domainPROSITEPS51184JMJCcoord: 366..532
score: 40.055
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1260..1327
e-value: 9.7E-15
score: 55.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1838..1901
e-value: 1.8E-12
score: 48.6
IPR036431ARID DNA-binding domain superfamilyGENE3DG3DSA:1.10.150.60coord: 67..172
e-value: 7.8E-29
score: 101.7
IPR036431ARID DNA-binding domain superfamilySUPERFAMILYSSF46774ARID-likecoord: 60..169
IPR004198Zinc finger, C5HC2-typePFAMPF02928zf-C5HC2coord: 607..663
e-value: 1.9E-11
score: 44.2
IPR019787Zinc finger, PHD-fingerPFAMPF00628PHDcoord: 219..264
e-value: 6.8E-9
score: 35.5
coord: 1275..1323
e-value: 3.0E-9
score: 36.6
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 1273..1324
score: 9.339
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 1838..1895
score: 8.6
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 216..266
score: 9.472
IPR013637Lysine-specific demethylase-like domainPFAMPF08429PLU-1coord: 727..1123
e-value: 1.1E-24
score: 87.3
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 219..263
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 1276..1321
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 1265..1332
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 1836..1900
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 217..269