NEPH-1

Overview
NameNEPH-1 (AKN21714.1)
Smed IDSMED30012144
Length (bp)3038
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NEPH-1 (SMED30012144) t-SNE clustered cells

Violin plots show distribution of expression levels for NEPH-1 (SMED30012144) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NEPH-1 (SMED30012144) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NEPH-1 (SMED30012144) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012144

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30012144SMESG000074081.1 SmedASXL_014931SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30012144SMESG000074081.1 dd_Smed_v4_11554_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012144SMESG000074081.1 dd_Smed_v6_11554_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30012144SMESG000074081.1 Contig1293newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30012144SMESG000074081.1 Contig1293uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30012144SMESG000014241.1 SMESG000014240.1 Contig1293newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30012144SMESG000014241.1 SMESG000014240.1 Contig1293uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NEPH-1 vs. Ensembl Human
Match: KIRREL1 (kirre like nephrin family adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:15734])

HSP 1 Score: 88.5817 bits (218), Expect = 3.250e-17
Identity = 139/620 (22.42%), Postives = 231/620 (37.26%), Query Frame = 3
Query:  243 LYIYLWMVKFADNQILG--------PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQI--ILRVQYSP-IILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERL---AGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            L + +W++  +D    G        P   +V+    A L C V  N S     VQW KDG      + L+     RY++ G  + G Y+L I   +  DD  Y CQ   A      ++   LTV++PP+  ++           T +               L+C    ++PA  ++W       R+G       Q+ G V +     D   +    + S L +       G +  C   NE      + K   ++L+V     V + + P        E E +   C A+ NP  + Y W K                                I     S       YS F            V+C E H   GS+ +  ++ V ++P I++D    T    +G  VTL C    NPP  +TW  +K  S  +++N + +  +                         ++T AD  G + C A+       ++ V +     P I++++ +  A  G   ++ C I S P PD+    W +N     +E  +  + Y  ER    +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L      P+  I G++
Sbjct:    2 LSLLVWILTLSDTFSQGTQTRFSQEPADQTVVAGQRAVLPC-VLLNYSGI---VQWTKDGLALGMGQGLKAW--PRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL---RSRRAKLTVLIPPEDTRIDGGPVILLQAGTPHN--------------LTCRAFNAKPAATIIW------FRDGT------QQEGAVASTELLKDGKRE---TTVSQLLINPTDLDIGRVFTCRSMNEAI---PSGKETSIELDVHHPPTVTLSIEPQ----TVQEGERVVFTCQATANPEILGYRWAK----------------------------GGFLIEDAHESRYETNVDYSFFTEP---------VSC-EVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTD--IGSDVTLTCVWVGNPPLTLTW--TKKDSNMVLSNSNQLLLK-------------------------SVTQAD-AGTYTCRAIVPRIGVAEREVPLYVNG-PPIISSEAVQYAVRGDGGKVECFIGSTPPPDRIAWAWKENF----LEVGTLER-YTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 502          
BLAST of NEPH-1 vs. Ensembl Human
Match: NPHS1 (NPHS1 adhesion molecule, nephrin [Source:HGNC Symbol;Acc:HGNC:7908])

HSP 1 Score: 58.9214 bits (141), Expect = 4.967e-8
Identity = 76/327 (23.24%), Postives = 128/327 (39.14%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILE-TTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKT---TTIIKYFDRSGVLKIKVRRDLNNMFIRCQVL-SVLAGKE 1259
            P + +V+  ++  LRC V+   S     VQW KDG     +     F  RY++ G    G + L I + D  DD EY CQV  +    E  +  + L+++VPP  + L           T        W    E+ +++C    ++PA ++   L              GQ +  ++  +   +   Q  +  E+  R+  R   N ++L C  +   S   + P  A   +NVLF     +   P     H    + +++ C A          W+K      T   T   +   RS VL + VR + +   + C+   SV AG +
Sbjct:   38 PENLTVVEGASVELRCGVSTPGS----AVQWAKDGLLLGPDPRIPGFP-RYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLL-----------TPEAGTMVTWVAGQEY-VVNCVSGDAKPAPDITILL-------------SGQTISDIS--ANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEAS---SPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRAGQSLELPCVARGGNPLATLQWLKNGQPVSTAWGTEHTQAVARS-VLVMTVRPEDHGAQLSCEAHNSVSAGTQ 328          
BLAST of NEPH-1 vs. Ensembl Human
Match: NPHS1 (NPHS1 adhesion molecule, nephrin [Source:HGNC Symbol;Acc:HGNC:7908])

HSP 1 Score: 58.9214 bits (141), Expect = 5.693e-8
Identity = 76/327 (23.24%), Postives = 128/327 (39.14%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILE-TTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKT---TTIIKYFDRSGVLKIKVRRDLNNMFIRCQVL-SVLAGKE 1259
            P + +V+  ++  LRC V+   S     VQW KDG     +     F  RY++ G    G + L I + D  DD EY CQV  +    E  +  + L+++VPP  + L           T        W    E+ +++C    ++PA ++   L              GQ +  ++  +   +   Q  +  E+  R+  R   N ++L C  +   S   + P  A   +NVLF     +   P     H    + +++ C A          W+K      T   T   +   RS VL + VR + +   + C+   SV AG +
Sbjct:   38 PENLTVVEGASVELRCGVSTPGS----AVQWAKDGLLLGPDPRIPGFP-RYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLL-----------TPEAGTMVTWVAGQEY-VVNCVSGDAKPAPDITILL-------------SGQTISDIS--ANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEAS---SPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRAGQSLELPCVARGGNPLATLQWLKNGQPVSTAWGTEHTQAVARS-VLVMTVRPEDHGAQLSCEAHNSVSAGTQ 328          
BLAST of NEPH-1 vs. Ensembl Human
Match: KIRREL1 (kirre like nephrin family adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:15734])

HSP 1 Score: 57.7658 bits (138), Expect = 9.751e-8
Identity = 92/395 (23.29%), Postives = 154/395 (38.99%), Query Frame = 3
Query:  903 HNGEILKCTIANEQSFMHKTPKPAI----MKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQI--ILRVQYSP-IILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERL---AGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            +N EI    ++++ S+  +  + A+     KL VL    V + + P        E E +   C A+ NP  + Y W K                                I     S       YS F            V+C E H   GS+ +  ++ V ++P I++D    T    +G  VTL C    NPP  +TW  +K  S  +++N + +    L K                     ++T AD  G + C A+       ++ V +     P I++++ +  A  G   ++ C I S P PD+    W +N     +E  +  + Y  ER    +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L      P+  I G++
Sbjct:   22 YNLEITDAELSDDASYECQATEAALRSRRAKLTVLNPPTVTLSIEPQ----TVQEGERVVFTCQATANPEILGYRWAK----------------------------GGFLIEDAHESRYETNVDYSFFTEP---------VSC-EVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTD--IGSDVTLTCVWVGNPPLTLTW--TKKDSNMVLSNSNQL----LLK---------------------SVTQAD-AGTYTCRAIVPRIGVAEREVPLYVNG-PPIISSEAVQYAVRGDGGKVECFIGSTPPPDRIAWAWKENF----LEVGTLER-YTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 338          
BLAST of NEPH-1 vs. Ensembl Human
Match: KIRREL1 (kirre like nephrin family adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:15734])

HSP 1 Score: 57.7658 bits (138), Expect = 9.933e-8
Identity = 68/258 (26.36%), Postives = 116/258 (44.96%), Query Frame = 3
Query: 1311 VNCSERHTANGSSQI--ILRVQYSP-IILDSILETKAAFLGDVVTLDCRADSNPPAKITWYK--SKFSSKEIMANPD-LVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERL---AGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            V+C E H   GS+ +  ++ V ++P I++D    T    +G  VTL C    NPP  +TW K  S    +   + P+  + A+ L    Q+                 ++T AD  G + C A+       ++ V +     P I++++ +  A  G   ++ C I S P PD+    W +N     +E  +  + Y  ER    +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L      P+  I G++
Sbjct:   83 VSC-EVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTD--IGSDVTLTCVWVGNPPLTLTWTKKDSNMGPRPPGSPPEAALSAQVLSNSNQLLLK--------------SVTQAD-AGTYTCRAIVPRIGVAEREVPLYVNG-PPIISSEAVQYAVRGDGGKVECFIGSTPPPDRIAWAWKENF----LEVGTLER-YTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 316          
BLAST of NEPH-1 vs. Ensembl Celegans
Match: syg-1 (Synaptogenesis protein syg-1 [Source:UniProtKB/Swiss-Prot;Acc:B1Q236])

HSP 1 Score: 56.9954 bits (136), Expect = 5.838e-8
Identity = 42/122 (34.43%), Postives = 55/122 (45.08%), Query Frame = 3
Query:  285 ILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDH---FNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKS-INLTVIVPPDKIKLKSSQFDFQ 638
            +  P  T   +  TA L CRV          VQW KD FG    T RD     N RY+M G    G Y+L I +V   DD ++ACQ++ + H      S   LTV+V P   K+  S    +
Sbjct:   26 VEAPKDTLAAVGETAILTCRVEHQQG----PVQWMKDDFGLG--TDRDKPLPGNKRYRMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSKAKLTVLVRPTPPKIVKSHHSLK 141          
BLAST of NEPH-1 vs. Ensembl Celegans
Match: syg-1 (Synaptogenesis protein syg-1 [Source:UniProtKB/Swiss-Prot;Acc:B1Q236])

HSP 1 Score: 56.9954 bits (136), Expect = 6.249e-8
Identity = 42/122 (34.43%), Postives = 55/122 (45.08%), Query Frame = 3
Query:  285 ILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDH---FNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKS-INLTVIVPPDKIKLKSSQFDFQ 638
            +  P  T   +  TA L CRV          VQW KD FG    T RD     N RY+M G    G Y+L I +V   DD ++ACQ++ + H      S   LTV+V P   K+  S    +
Sbjct:   26 VEAPKDTLAAVGETAILTCRVEHQQG----PVQWMKDDFGLG--TDRDKPLPGNKRYRMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSKAKLTVLVRPTPPKIVKSHHSLK 141          
BLAST of NEPH-1 vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 50.447 bits (119), Expect = 8.598e-6
Identity = 50/215 (23.26%), Postives = 89/215 (41.40%), Query Frame = 3
Query: 1383 ILDSILE--TKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVF-VGQGATPQI---VNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIEL 2009
            I+  +LE  +++  +GD    DC+   +P A I+W  +K  + ++  N  + G R L                      FT    DN G++ C+A T   P   +TV  VG G   Q+   V +   ++   G    +SC   +   P++  ++W K     P  ++ +          GV+    +H+   +D G+Y C +      V ST++L
Sbjct: 2352 IIQVLLEVSSESPQIGDRAWFDCKVTGDPSAVISW--TKEGNDDLPPNAQVTGGRLL----------------------FTDLKEDNAGVYRCVAKTKAGPLQTRTVLNVGSGKQDQVTFTVADSLPVVYTVGQPAYLSCIGKTETKPNQ-SVVWTKEEGDLPSGSRVEQ---------GVLMLPSVHR---DDEGSYTCEIVKEENPVFSTVDL 2529          
BLAST of NEPH-1 vs. Ensembl Fly
Match: rst (gene:FBgn0003285 transcript:FBtr0343758)

HSP 1 Score: 118.242 bits (295), Expect = 8.075e-27
Identity = 142/602 (23.59%), Postives = 227/602 (37.71%), Query Frame = 3
Query:  288 LGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSI--NLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKS---EFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFF-------------------HFTEHEMIQINCSASTNPANVIYNW-IKYNP---TTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIEL 2009
            + P   + ++ +   L CRV  N   T   +QW KD FG         F  RY M G  E G Y L I+ V   DD  Y CQV+         +S    LTV+VPP+  K+  +Q D             I+   +  + + C     +PA E+ W              IDG  +G V T +     +   DQ  + ++S LRL  +K+H+     C     Q+   +T + A +++ V +   VK++V+   P                        EH  +++ C A  NP++V Y W I   P     KT  +I+           V R  ++  ++C+V + +   E       +S   D SY  +  +R                        ++  A +G VV+L C  DSNP  +I W +   S + +  + +L                            F++++ +  G + C A   G+  +    +V    +P I  +Q+      G + RI C   S+P      + W  N      E+     I  +    GV S L I       YG YNC+V N YG   + I+L
Sbjct:   32 MEPQDQTAVVGARVTLPCRV-INKQGT---LQWTKDDFGLGTSRDLSGFE-RYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKI--TQGDV------------IYATEDRKVEIECVSVGGKPAAEITW--------------IDG--LGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSC---QAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIR----------NVTRKFHDAIVKCEVQNSVGKSE-------DSETLDISYAPSFRQRP-----------------------QSMEADVGSVVSLTCEVDSNPQPEIVWIQHP-SDRVVGTSTNLT---------------------------FSVSN-ETAGRYYCKANVPGYAEISADAYVYLKGSPAI-GSQRTQYGLVGDTARIECFASSVPR--ARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQL 523          
BLAST of NEPH-1 vs. Ensembl Fly
Match: rst (gene:FBgn0003285 transcript:FBtr0070562)

HSP 1 Score: 118.242 bits (295), Expect = 8.075e-27
Identity = 142/602 (23.59%), Postives = 227/602 (37.71%), Query Frame = 3
Query:  288 LGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSI--NLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKS---EFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFF-------------------HFTEHEMIQINCSASTNPANVIYNW-IKYNP---TTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIEL 2009
            + P   + ++ +   L CRV  N   T   +QW KD FG         F  RY M G  E G Y L I+ V   DD  Y CQV+         +S    LTV+VPP+  K+  +Q D             I+   +  + + C     +PA E+ W              IDG  +G V T +     +   DQ  + ++S LRL  +K+H+     C     Q+   +T + A +++ V +   VK++V+   P                        EH  +++ C A  NP++V Y W I   P     KT  +I+           V R  ++  ++C+V + +   E       +S   D SY  +  +R                        ++  A +G VV+L C  DSNP  +I W +   S + +  + +L                            F++++ +  G + C A   G+  +    +V    +P I  +Q+      G + RI C   S+P      + W  N      E+     I  +    GV S L I       YG YNC+V N YG   + I+L
Sbjct:   32 MEPQDQTAVVGARVTLPCRV-INKQGT---LQWTKDDFGLGTSRDLSGFE-RYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKI--TQGDV------------IYATEDRKVEIECVSVGGKPAAEITW--------------IDG--LGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSC---QAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIR----------NVTRKFHDAIVKCEVQNSVGKSE-------DSETLDISYAPSFRQRP-----------------------QSMEADVGSVVSLTCEVDSNPQPEIVWIQHP-SDRVVGTSTNLT---------------------------FSVSN-ETAGRYYCKANVPGYAEISADAYVYLKGSPAI-GSQRTQYGLVGDTARIECFASSVPR--ARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQL 523          
BLAST of NEPH-1 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0332492)

HSP 1 Score: 116.316 bits (290), Expect = 4.508e-26
Identity = 143/603 (23.71%), Postives = 231/603 (38.31%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKS--INLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKS-EFMDS--FDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHR-PFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTK---TTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPV--QKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQ---IYEEERLA-GVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELI-PPVETPMIFIIGSS 2054
            P   + ++ S   L CRV          +QW KD FG         F  RY M G  E G + L I+ +   DD +Y CQV       +  +S    LTV+VPP+  K+  +Q D+   + + EI             L C  Q  +PA E+ W              IDG  +G V TK  E++     D     + S L+L  +K+H+     C     Q+   +T + A + L V +   V + V+          E   + ++C A  NP  + Y W   +       TT +I +          V R  ++  ++C+V++ +   E     Q++                         L + + P+     +  +A  LG  V++ C    NP  +I W         I  N D V     +   +                      ++  G + C A+ +GFP +  + T++V +     I+ + K+     G  V+I C   SIP  +   I+W  +   K I   S +    I+EE  L  GV + L I       +G YNC+V N YG  S  I L+  P   P++ ++  S
Sbjct:   88 PQDQTAVVGSRVTLPCRVMEKVG----ALQWTKDDFGLGQHRNLSGFE-RYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKI--TQGDYLVTTEDREI------------ELECVSQGGKPAAEITW--------------IDG--LGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTC---QAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIH---------NVSRQYHDAIVKCEVVNAVGKSE-----QSKK------------------------LDISFGPVFRQRPVSVEAD-LGATVSMRCDVAGNPEPEIEW---------ISENSDQVVGVAAELKLK--------------------VSSETAGRYFCKAVVNGFPEIGAEATLYVKRAP---IITSHKVQFGGVGGRVKIDCLAFSIPKAE--HILW--SFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVVMGS 577          
BLAST of NEPH-1 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0309498)

HSP 1 Score: 116.316 bits (290), Expect = 4.508e-26
Identity = 143/603 (23.71%), Postives = 231/603 (38.31%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKS--INLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKS-EFMDS--FDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHR-PFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTK---TTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPV--QKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQ---IYEEERLA-GVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELI-PPVETPMIFIIGSS 2054
            P   + ++ S   L CRV          +QW KD FG         F  RY M G  E G + L I+ +   DD +Y CQV       +  +S    LTV+VPP+  K+  +Q D+   + + EI             L C  Q  +PA E+ W              IDG  +G V TK  E++     D     + S L+L  +K+H+     C     Q+   +T + A + L V +   V + V+          E   + ++C A  NP  + Y W   +       TT +I +          V R  ++  ++C+V++ +   E     Q++                         L + + P+     +  +A  LG  V++ C    NP  +I W         I  N D V     +   +                      ++  G + C A+ +GFP +  + T++V +     I+ + K+     G  V+I C   SIP  +   I+W  +   K I   S +    I+EE  L  GV + L I       +G YNC+V N YG  S  I L+  P   P++ ++  S
Sbjct:   88 PQDQTAVVGSRVTLPCRVMEKVG----ALQWTKDDFGLGQHRNLSGFE-RYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKI--TQGDYLVTTEDREI------------ELECVSQGGKPAAEITW--------------IDG--LGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTC---QAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIH---------NVSRQYHDAIVKCEVVNAVGKSE-----QSKK------------------------LDISFGPVFRQRPVSVEAD-LGATVSMRCDVAGNPEPEIEW---------ISENSDQVVGVAAELKLK--------------------VSSETAGRYFCKAVVNGFPEIGAEATLYVKRAP---IITSHKVQFGGVGGRVKIDCLAFSIPKAE--HILW--SFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVVMGS 577          
BLAST of NEPH-1 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0070560)

HSP 1 Score: 116.316 bits (290), Expect = 4.508e-26
Identity = 143/603 (23.71%), Postives = 231/603 (38.31%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKS--INLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKS-EFMDS--FDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHR-PFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTK---TTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPV--QKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQ---IYEEERLA-GVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELI-PPVETPMIFIIGSS 2054
            P   + ++ S   L CRV          +QW KD FG         F  RY M G  E G + L I+ +   DD +Y CQV       +  +S    LTV+VPP+  K+  +Q D+   + + EI             L C  Q  +PA E+ W              IDG  +G V TK  E++     D     + S L+L  +K+H+     C     Q+   +T + A + L V +   V + V+          E   + ++C A  NP  + Y W   +       TT +I +          V R  ++  ++C+V++ +   E     Q++                         L + + P+     +  +A  LG  V++ C    NP  +I W         I  N D V     +   +                      ++  G + C A+ +GFP +  + T++V +     I+ + K+     G  V+I C   SIP  +   I+W  +   K I   S +    I+EE  L  GV + L I       +G YNC+V N YG  S  I L+  P   P++ ++  S
Sbjct:   88 PQDQTAVVGSRVTLPCRVMEKVG----ALQWTKDDFGLGQHRNLSGFE-RYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKI--TQGDYLVTTEDREI------------ELECVSQGGKPAAEITW--------------IDG--LGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTC---QAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIH---------NVSRQYHDAIVKCEVVNAVGKSE-----QSKK------------------------LDISFGPVFRQRPVSVEAD-LGATVSMRCDVAGNPEPEIEW---------ISENSDQVVGVAAELKLK--------------------VSSETAGRYFCKAVVNGFPEIGAEATLYVKRAP---IITSHKVQFGGVGGRVKIDCLAFSIPKAE--HILW--SFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVVMGS 577          
BLAST of NEPH-1 vs. Ensembl Zebrafish
Match: kirrel1a (kirre like nephrin family adhesion molecule 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2126])

HSP 1 Score: 100.908 bits (250), Expect = 3.179e-21
Identity = 140/583 (24.01%), Postives = 222/583 (38.08%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDV---VTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTD--GFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLA----GVVSYLYIHKVTYEDY-GTYNCSVSNPYGRVSSTIEL 2009
            P   SV++     L C V FN S     VQW KDG      E LR     RY++    + G Y+L I + +  DD  Y CQ   A      ++   LTV++PPD+  ++ S           EI+       N    +SC  + ++PA+ + W+              DG  +    + +E +   D+    + S+L ++      G+   C   N    M K    A + LNV     V + + P        E E +   C A+ NP  + Y W K         ++    R  V   K         + CQV + +                      N S          I++ V + PI+   ++E K   + DV   VTL+C+   NPP  +TW K K SS  +  N  L                          Y  +++ AD  G ++C A+    G    + T+ V     P I++++    A  G    + C+I S P PDK    W +N+  K     S+    E+ + +     V+S L I+ +   D+  TYNC+  N +G  +  I L
Sbjct:   26 PADQSVVLGQRVVLSC-VVFNYSGI---VQWTKDGLALGIGEDLRAW--PRYRVLRLVDVGQYNLEISAAELSDDSLYECQATEAAL---RSRRAKLTVLIPPDEPVIEGSP----------EILLTAGVPYN----MSCVSRGAKPASVIEWQK-------------DGLPIEGAVSTTEVLP--DRKRVTTRSYLPIQPLDTDTGKNFTCVATNLAVPMGKR---ATITLNVHHPPVVTLSIEPR----SVLEGERVTFTCQATANPPIMGYKWAKGG-------VVIQGARESVFVTKADHSFFTEPVSCQVFNAVGS-------------------TNVS----------ILVDVHFGPIL---VVEPKPVTV-DVDSDVTLNCKWAGNPPLTLTWTK-KGSSMVLSNNNQL--------------------------YLKSVSQAD-AGQYVCKAIVPRIGVGETEVTLTVNG---PPIISSEPFQYAVRGERGEVKCYIASTPPPDKIVWAWKENVWEKEKGTLSERYTVEQSKPSAQGGAVLSTLTINNIMESDFQSTYNCTAWNSFGSGTMIISL 492          
BLAST of NEPH-1 vs. Ensembl Zebrafish
Match: kirrel1a (kirre like nephrin family adhesion molecule 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2126])

HSP 1 Score: 100.908 bits (250), Expect = 3.179e-21
Identity = 140/583 (24.01%), Postives = 222/583 (38.08%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDV---VTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTD--GFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLA----GVVSYLYIHKVTYEDY-GTYNCSVSNPYGRVSSTIEL 2009
            P   SV++     L C V FN S     VQW KDG      E LR     RY++    + G Y+L I + +  DD  Y CQ   A      ++   LTV++PPD+  ++ S           EI+       N    +SC  + ++PA+ + W+              DG  +    + +E +   D+    + S+L ++      G+   C   N    M K    A + LNV     V + + P        E E +   C A+ NP  + Y W K         ++    R  V   K         + CQV + +                      N S          I++ V + PI+   ++E K   + DV   VTL+C+   NPP  +TW K K SS  +  N  L                          Y  +++ AD  G ++C A+    G    + T+ V     P I++++    A  G    + C+I S P PDK    W +N+  K     S+    E+ + +     V+S L I+ +   D+  TYNC+  N +G  +  I L
Sbjct:   26 PADQSVVLGQRVVLSC-VVFNYSGI---VQWTKDGLALGIGEDLRAW--PRYRVLRLVDVGQYNLEISAAELSDDSLYECQATEAAL---RSRRAKLTVLIPPDEPVIEGSP----------EILLTAGVPYN----MSCVSRGAKPASVIEWQK-------------DGLPIEGAVSTTEVLP--DRKRVTTRSYLPIQPLDTDTGKNFTCVATNLAVPMGKR---ATITLNVHHPPVVTLSIEPR----SVLEGERVTFTCQATANPPIMGYKWAKGG-------VVIQGARESVFVTKADHSFFTEPVSCQVFNAVGS-------------------TNVS----------ILVDVHFGPIL---VVEPKPVTV-DVDSDVTLNCKWAGNPPLTLTWTK-KGSSMVLSNNNQL--------------------------YLKSVSQAD-AGQYVCKAIVPRIGVGETEVTLTVNG---PPIISSEPFQYAVRGERGEVKCYIASTPPPDKIVWAWKENVWEKEKGTLSERYTVEQSKPSAQGGAVLSTLTINNIMESDFQSTYNCTAWNSFGSGTMIISL 492          
BLAST of NEPH-1 vs. Ensembl Zebrafish
Match: kirrel1b (kirre like nephrin family adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-070912-173])

HSP 1 Score: 98.5969 bits (244), Expect = 1.548e-20
Identity = 141/595 (23.70%), Postives = 224/595 (37.65%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTD--GFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLA----GVVSYLYIHKVTYEDY-GTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            P   SV+I     L C V FN +     VQW KDG      E LR     RY++    + G Y+L I S D  DD  Y CQ   A      ++   LTV++PPD   ++ S           EI+       N    L+C  + ++P + + W               DG  V    T +E +   D+    ++S L ++      G    C  +N  + + K    + + LN+     V + + P        E E ++  C A+ NP  + Y W K         +I    R  V +           + C V + +            SI+ D  +                IL V+  P+ +D         +   VTL+C+   NPP  +TW  +K  S  +++N + +                         +  +++ AD  G ++C A+    G    + T+ V     P I++++ I  A  G    I C+I S P PDK    W +N+  K      +    E+ R A     V+S L I+ V   D+  TYNC+  N +G  +  I L      P+  I G S
Sbjct:   31 PADQSVVIGERVVLSC-VVFNYTGI---VQWTKDGLALGIGEDLRAW--PRYRVLRIMDVGQYNLEITSADLTDDSLYECQATEAAL---RSRRAKLTVLIPPDGPVIEGSP----------EILLTAGTSFN----LTCVSRGAKPMSTIEWYK-------------DGIIVEGAHTSTEVLS--DRKRVTTKSFLEIQPMDTDTGRNFTCVASNLAAPLGKR---STVTLNIHHPPTVILSIEPR----SVLEGERVKFTCQATANPPIMGYRWAKGG-------VILDGARESVFETTADHSFFTEPVSCLVFNAVGSTNV-------SILVDVHF--------------GPILVVEPRPVTVD---------VDSDVTLNCKWSGNPPLTLTW--TKKGSSMVLSNSNQL-------------------------FLKSVSQAD-AGQYVCKAIVPRIGVGETEVTLTVNG---PPIISSEPIQYAVRGEKGEIKCYIASTPPPDKIVWAWKENVWEKERGTLLERYTVEQSRPATQGGAVLSTLTINNVMEADFQSTYNCTAWNAFGPGTMIITLEETDIVPVGVIAGGS 512          
BLAST of NEPH-1 vs. Ensembl Zebrafish
Match: kirrel1b (kirre like nephrin family adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-070912-173])

HSP 1 Score: 98.5969 bits (244), Expect = 1.776e-20
Identity = 141/595 (23.70%), Postives = 224/595 (37.65%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTD--GFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLA----GVVSYLYIHKVTYEDY-GTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            P   SV+I     L C V FN +     VQW KDG      E LR     RY++    + G Y+L I S D  DD  Y CQ   A      ++   LTV++PPD   ++ S           EI+       N    L+C  + ++P + + W               DG  V    T +E +   D+    ++S L ++      G    C  +N  + + K    + + LN+     V + + P        E E ++  C A+ NP  + Y W K         +I    R  V +           + C V + +            SI+ D  +                IL V+  P+ +D         +   VTL+C+   NPP  +TW  +K  S  +++N + +                         +  +++ AD  G ++C A+    G    + T+ V     P I++++ I  A  G    I C+I S P PDK    W +N+  K      +    E+ R A     V+S L I+ V   D+  TYNC+  N +G  +  I L      P+  I G S
Sbjct:   31 PADQSVVIGERVVLSC-VVFNYTGI---VQWTKDGLALGIGEDLRAW--PRYRVLRIMDVGQYNLEITSADLTDDSLYECQATEAAL---RSRRAKLTVLIPPDGPVIEGSP----------EILLTAGTSFN----LTCVSRGAKPMSTIEWYK-------------DGIIVEGAHTSTEVLS--DRKRVTTKSFLEIQPMDTDTGRNFTCVASNLAAPLGKR---STVTLNIHHPPTVILSIEPR----SVLEGERVKFTCQATANPPIMGYRWAKGG-------VILDGARESVFETTADHSFFTEPVSCLVFNAVGSTNV-------SILVDVHF--------------GPILVVEPRPVTVD---------VDSDVTLNCKWSGNPPLTLTW--TKKGSSMVLSNSNQL-------------------------FLKSVSQAD-AGQYVCKAIVPRIGVGETEVTLTVNG---PPIISSEPIQYAVRGEKGEIKCYIASTPPPDKIVWAWKENVWEKERGTLLERYTVEQSRPATQGGAVLSTLTINNVMEADFQSTYNCTAWNAFGPGTMIITLEETDIVPVGVIAGGS 512          
BLAST of NEPH-1 vs. Ensembl Zebrafish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 66.6254 bits (161), Expect = 9.611e-11
Identity = 113/547 (20.66%), Postives = 198/547 (36.20%), Query Frame = 3
Query:  378 VQWQKDGFGYENETLRDHFNG--RYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIEL 2009
            V W +DG        RD  +G  RY + G   +G + L I  V+  DD  + CQ   AI     ++   LTV+VPPD   +           T   ++    G   + L L+C    ++PA  ++W      +R G+   ++G        +    +S     Y S S++        +G+ + C  +N+        K   + +++  +  V + V P +P     E  +++ +CSA  NP    Y W K     K  +   Y       ++ V        + C+V + L       N      +Y                      R+   P  L   L + A F       +C    NP   I W K    S  +++N +++  +++++                          ++ G ++C A+       +K V +     P I + Q    A  G   +I C I S P PD+    W + +       +   +    E   GV+S L +  +   D+ T YNC+  N +G  +  I L
Sbjct:   64 VLWLRDGLALG--VGRD-LSGYPRYAVVGDHGSGEHHLRIQKVELMDDAVFECQ---AIQAAMRSRPARLTVLVPPDDPMI-----------TGGPVVSLRAG---DPLNLTCHADNAKPAASIIW------IRNGEV--LNGAMYSKTLLRDGRRESTVSTLYISASNI-------ESGQKIICRASNKAV---PNGKETSVTIDIQHLPLVNLSVEP-QPVL---EGNLVKFHCSAKANPPVTQYKWAKGGSVIKEVSGDTY-------EVIVDHSFFTEPVSCEVTNPLGSTNISRNVD----VYFGP-------------------RMAAEPQSLQVDLGSDAVF-------NCAWTGNPSLTIVWMKR--GSGVVLSNENILTLKSVRQ--------------------------EDAGKYVCRAVVPRVGAAEKEVSLTVNGPPTISSTQT-HQAPHGEKGQIKCFIRSTPPPDRIAWSWKETVLESGTSGRYTVETVSTED--GVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRL 500          
BLAST of NEPH-1 vs. Ensembl Xenopus
Match: igfbp4 (insulin like growth factor binding protein 4 [Source:Xenbase;Acc:XB-GENE-484795])

HSP 1 Score: 110.923 bits (276), Expect = 3.720e-24
Identity = 150/623 (24.08%), Postives = 249/623 (39.97%), Query Frame = 3
Query:  243 LYIYLWMV--------KFADNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREG--KSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQI--ILRVQYSPIILDSILETKAAF--LGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTD--GFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKN-LNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            L++++W+          F    I  P   +V+      L C V  N S     VQW KDG      + LR     RYQ+ G  E+G Y+L I +    DD  + CQ   A   L + K+  LTV++PP+   ++             EI+       N    L+C    ++P   +VW       R+G  ++GD+   EV             D     + S+L +       G +  C  +NE      + K   +KLNV     V + + P        E E ++  CSA+ NP    Y W K                 G + I+  RD           S    +  YS F            V+C E H   GS+ +  ++ VQ++P +   ++E K     +G  VTL C    NPP  +TW  +K  S  +++N + +  +++++                          ++ G ++C A+    G    + T+FV     P I+ ++++  A  G   ++ C I S P PD+    W +N L T  +E   +  +      +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L+     P+  I G++
Sbjct:    2 LFLFIWIFTLPETLSQAFQPRFIQEPTDQTVVAGQKVVLTC-VVLNYSGI---VQWTKDGLALGLGQNLR--IWPRYQIVGNVESGQYNLEISNASIVDDANFECQATEA--ALRSQKA-KLTVLIPPEDPVIEGGP----------EILLRAGTPTN----LTCRANSAKPPASIVW------FRDGNQQAGDVYSTEVLA-----------DGKRATTVSYLLISPTDQDIGRVFTCRTSNE---AIPSGKETSVKLNVHHPPTVTLSIHPQ----TVQEGERVRFTCSATANPEIKGYRWAK-----------------GGMIIESARD-----------SSYETQVDYSFFTEP---------VSC-EVHNEVGSTNVSTLVDVQFAPRV---VVEPKPTTTDMGSDVTLTCIWAGNPPLTLTW--TKKGSNMVLSNGNQLFLKSVKQ--------------------------EDAGPYVCKAIVPRIGVGEREVTLFVNG---PPIIASEEVQYAARGDKGKVECFIGSTPPPDRIAWAWKENVLETGTLE---RYTVERTTSTSGVLSTLTINNVMESDFQTRYNCTAWNSFGPGTAIIQLLEREVVPVGIIAGAT 502          
BLAST of NEPH-1 vs. Ensembl Xenopus
Match: igfbp4 (insulin like growth factor binding protein 4 [Source:Xenbase;Acc:XB-GENE-484795])

HSP 1 Score: 108.227 bits (269), Expect = 1.836e-23
Identity = 148/609 (24.30%), Postives = 243/609 (39.90%), Query Frame = 3
Query:  261 MVKFADNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREG--KSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQI--ILRVQYSPIILDSILETKAAF--LGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTD--GFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKN-LNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            +  F    I  P   +V+      L C V  N S     VQW KDG      + LR     RYQ+ G  E+G Y+L I +    DD  + CQ   A   L + K+  LTV++PP+   ++             EI+       N    L+C    ++P   +VW       R+G  ++GD+   EV             D     + S+L +       G +  C  +NE      + K   +KLNV     V + + P        E E ++  CSA+ NP    Y W K                 G + I+  RD           S    +  YS F            V+C E H   GS+ +  ++ VQ++P +   ++E K     +G  VTL C    NPP  +TW  +K  S  +++N + +  +++++                          ++ G ++C A+    G    + T+FV     P I+ ++++  A  G   ++ C I S P PD+    W +N L T  +E   +  +      +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L+     P+  I G++
Sbjct:   21 LPAFQPRFIQEPTDQTVVAGQKVVLTC-VVLNYSGI---VQWTKDGLALGLGQNLR--IWPRYQIVGNVESGQYNLEISNASIVDDANFECQATEAA--LRSQKA-KLTVLIPPEDPVIEGGP----------EILLRAGTPTN----LTCRANSAKPPASIVW------FRDGNQQAGDVYSTEV-----------LADGKRATTVSYLLISPTDQDIGRVFTCRTSNE---AIPSGKETSVKLNVHHPPTVTLSIHPQ----TVQEGERVRFTCSATANPEIKGYRWAK-----------------GGMIIESARD-----------SSYETQVDYSFFTEP---------VSC-EVHNEVGSTNVSTLVDVQFAPRV---VVEPKPTTTDMGSDVTLTCIWAGNPPLTLTW--TKKGSNMVLSNGNQLFLKSVKQ--------------------------EDAGPYVCKAIVPRIGVGEREVTLFVNG---PPIIASEEVQYAARGDKGKVECFIGSTPPPDRIAWAWKENVLETGTLE---RYTVERTTSTSGVLSTLTINNVMESDFQTRYNCTAWNSFGPGTAIIQLLEREVVPVGIIAGAT 507          
BLAST of NEPH-1 vs. Ensembl Xenopus
Match: igfbp4 (insulin like growth factor binding protein 4 [Source:Xenbase;Acc:XB-GENE-484795])

HSP 1 Score: 108.612 bits (270), Expect = 1.966e-23
Identity = 148/608 (24.34%), Postives = 243/608 (39.97%), Query Frame = 3
Query:  264 VKFADNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREG--KSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQI--ILRVQYSPIILDSILETKAAF--LGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTD--GFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKN-LNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            + F    I  P   +V+      L C V  N S     VQW KDG      + LR     RYQ+ G  E+G Y+L I +    DD  + CQ   A   L + K+  LTV++PP+   ++             EI+       N    L+C    ++P   +VW       R+G  ++GD+   EV             D     + S+L +       G +  C  +NE      + K   +KLNV     V + + P        E E ++  CSA+ NP    Y W K                 G + I+  RD           S    +  YS F            V+C E H   GS+ +  ++ VQ++P +   ++E K     +G  VTL C    NPP  +TW  +K  S  +++N + +  +++++                          ++ G ++C A+    G    + T+FV     P I+ ++++  A  G   ++ C I S P PD+    W +N L T  +E   +  +      +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L+     P+  I G++
Sbjct:   15 LSFQPRFIQEPTDQTVVAGQKVVLTC-VVLNYSGI---VQWTKDGLALGLGQNLR--IWPRYQIVGNVESGQYNLEISNASIVDDANFECQATEA--ALRSQKA-KLTVLIPPEDPVIEGGP----------EILLRAGTPTN----LTCRANSAKPPASIVW------FRDGNQQAGDVYSTEV-----------LADGKRATTVSYLLISPTDQDIGRVFTCRTSNE---AIPSGKETSVKLNVHHPPTVTLSIHPQ----TVQEGERVRFTCSATANPEIKGYRWAK-----------------GGMIIESARD-----------SSYETQVDYSFFTEP---------VSC-EVHNEVGSTNVSTLVDVQFAPRV---VVEPKPTTTDMGSDVTLTCIWAGNPPLTLTW--TKKGSNMVLSNGNQLFLKSVKQ--------------------------EDAGPYVCKAIVPRIGVGEREVTLFVNG---PPIIASEEVQYAARGDKGKVECFIGSTPPPDRIAWAWKENVLETGTLE---RYTVERTTSTSGVLSTLTINNVMESDFQTRYNCTAWNSFGPGTAIIQLLEREVVPVGIIAGAT 500          
BLAST of NEPH-1 vs. Ensembl Xenopus
Match: igfbp4 (insulin like growth factor binding protein 4 [Source:Xenbase;Acc:XB-GENE-484795])

HSP 1 Score: 108.227 bits (269), Expect = 2.223e-23
Identity = 148/606 (24.42%), Postives = 242/606 (39.93%), Query Frame = 3
Query:  270 FADNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREG--KSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQI--ILRVQYSPIILDSILETKAAF--LGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTD--GFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKN-LNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            F    I  P   +V+      L C V  N S     VQW KDG      + LR     RYQ+ G  E+G Y+L I +    DD  + CQ   A   L + K+  LTV++PP+   ++             EI+       N    L+C    ++P   +VW       R+G  ++GD+   EV             D     + S+L +       G +  C  +NE      + K   +KLNV     V + + P        E E ++  CSA+ NP    Y W K                 G + I+  RD           S    +  YS F            V+C E H   GS+ +  ++ VQ++P +   ++E K     +G  VTL C    NPP  +TW  +K  S  +++N + +  +++++                          ++ G ++C A+    G    + T+FV     P I+ ++++  A  G   ++ C I S P PD+    W +N L T  +E   +  +      +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L+     P+  I G++
Sbjct:   21 FQPRFIQEPTDQTVVAGQKVVLTC-VVLNYSGI---VQWTKDGLALGLGQNLR--IWPRYQIVGNVESGQYNLEISNASIVDDANFECQATEAA--LRSQKA-KLTVLIPPEDPVIEGGP----------EILLRAGTPTN----LTCRANSAKPPASIVW------FRDGNQQAGDVYSTEV-----------LADGKRATTVSYLLISPTDQDIGRVFTCRTSNE---AIPSGKETSVKLNVHHPPTVTLSIHPQ----TVQEGERVRFTCSATANPEIKGYRWAK-----------------GGMIIESARD-----------SSYETQVDYSFFTEP---------VSC-EVHNEVGSTNVSTLVDVQFAPRV---VVEPKPTTTDMGSDVTLTCIWAGNPPLTLTW--TKKGSNMVLSNGNQLFLKSVKQ--------------------------EDAGPYVCKAIVPRIGVGEREVTLFVNG---PPIIASEEVQYAARGDKGKVECFIGSTPPPDRIAWAWKENVLETGTLE---RYTVERTTSTSGVLSTLTINNVMESDFQTRYNCTAWNSFGPGTAIIQLLEREVVPVGIIAGAT 504          
BLAST of NEPH-1 vs. Ensembl Xenopus
Match: igfbp4 (insulin like growth factor binding protein 4 [Source:Xenbase;Acc:XB-GENE-484795])

HSP 1 Score: 104.375 bits (259), Expect = 2.439e-22
Identity = 146/605 (24.13%), Postives = 242/605 (40.00%), Query Frame = 3
Query:  243 LYIYLWMVKFADNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPP-DKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREG--KSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYL---VNCSERHTANGSSQI--ILRVQYSPIILDSILETKAAF--LGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTD--GFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKN-LNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELI 2012
            L +YL    F    I  P   +V+      L C V  N S     VQW KDG      + LR     RYQ+ G  E+G Y+L I +    DD  + CQ   A   L + K+  LTV++PP D +     +   +  +  N               L+C    ++P   +VW       R+G  ++GD+   EV             D     + S+L +       G +  C  +NE      + K   +KLNV     V + + P        E E ++  CSA+ NP    Y W K                 G + I+  RD                    S+++ +    D S+    V+C E H   GS+ +  ++ VQ++P +   ++E K     +G  VTL C    NPP  +TW  +K  S  +++N + +  +++++                          ++ G ++C A+    G    + T+FV     P I+ ++++  A  G   ++ C I S P PD+    W +N L T  +E   +  +      +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L+
Sbjct:    2 LRLYL---SFQPRFIQEPTDQTVVAGQKVVLTC-VVLNYSGI---VQWTKDGLALGLGQNLR--IWPRYQIVGNVESGQYNLEISNASIVDDANFECQATEA--ALRSQKA-KLTVLIPPEDPVIEGGPEILLRAGTPTN---------------LTCRANSAKPPASIVW------FRDGNQQAGDVYSTEV-----------LADGKRATTVSYLLISPTDQDIGRVFTCRTSNE---AIPSGKETSVKLNVHHPPTVTLSIHPQ----TVQEGERVRFTCSATANPEIKGYRWAK-----------------GGMIIESARD--------------------SSYETQ---VDYSFFTEPVSC-EVHNEVGSTNVSTLVDVQFAPRV---VVEPKPTTTDMGSDVTLTCIWAGNPPLTLTW--TKKGSNMVLSNGNQLFLKSVKQ--------------------------EDAGPYVCKAIVPRIGVGEREVTLFVN---GPPIIASEEVQYAARGDKGKVECFIGSTPPPDRIAWAWKENVLETGTLE---RYTVERTTSTSGVLSTLTINNVMESDFQTRYNCTAWNSFGPGTAIIQLL 477          
BLAST of NEPH-1 vs. Ensembl Mouse
Match: Kirrel (kirre like nephrin family adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:1891396])

HSP 1 Score: 83.1889 bits (204), Expect = 1.174e-15
Identity = 132/592 (22.30%), Postives = 218/592 (36.82%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERL---AGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            P   +V+    A L C V  N S     VQW KDG      + L+     RY++ G  + G Y+L I   +  DD  Y CQ   A      ++   LTV++PP++ ++           T                 L+C    ++PA  ++W       R+G       Q+ G VT+     D   +    + S L +       G +  C   NE        K   ++L+V     V + + P        E E +   C A+ NP  + Y W K                 G L            +     +     E Y+   + ++    S LVN                V ++P I+     T    +G  VTL C    NPP  +TW  +K  S  +++N + +  +                         ++T AD  G + C A+       ++ V +     P I++++ +  A  G   ++ C I S P PD+    W +N     +E  +  + Y  ER    +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L      P+  I G++
Sbjct:   59 PADQTVVAGQRAVLPC-VLLNYSGI---VQWTKDGLALGMGQGLKAW--PRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL---RSRRAKLTVLIPPEETRIDGGPVILLQAGTPYN--------------LTCRAFNAKPAATIIW------FRDGT------QQEGAVTSTELLKDGKRE---TTISQLLIEPTDLDIGRVFTCRSMNE---AIPNGKETSIELDVHHPPTVTLSIEPQ----TVLEGERVIFTCQATANPEILGYRWAK----------------GGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNV----STLVN----------------VHFAPRIVVYPKPTTTD-IGSDVTLTCVWVGNPPLTLTW--TKKDSNMVLSNSNQLLLK-------------------------SVTQAD-AGTYTCRAIVPRIGVAEREVPLYVNG-PPIISSEAVQFAVRGDGGKVECFIGSTPPPDRIAWAWKENF----LEVGTLER-YTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 534          
BLAST of NEPH-1 vs. Ensembl Mouse
Match: Kirrel (kirre like nephrin family adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:1891396])

HSP 1 Score: 83.1889 bits (204), Expect = 1.174e-15
Identity = 132/592 (22.30%), Postives = 218/592 (36.82%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERL---AGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            P   +V+    A L C V  N S     VQW KDG      + L+     RY++ G  + G Y+L I   +  DD  Y CQ   A      ++   LTV++PP++ ++           T                 L+C    ++PA  ++W       R+G       Q+ G VT+     D   +    + S L +       G +  C   NE        K   ++L+V     V + + P        E E +   C A+ NP  + Y W K                 G L            +     +     E Y+   + ++    S LVN                V ++P I+     T    +G  VTL C    NPP  +TW  +K  S  +++N + +  +                         ++T AD  G + C A+       ++ V +     P I++++ +  A  G   ++ C I S P PD+    W +N     +E  +  + Y  ER    +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L      P+  I G++
Sbjct:   59 PADQTVVAGQRAVLPC-VLLNYSGI---VQWTKDGLALGMGQGLKAW--PRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL---RSRRAKLTVLIPPEETRIDGGPVILLQAGTPYN--------------LTCRAFNAKPAATIIW------FRDGT------QQEGAVTSTELLKDGKRE---TTISQLLIEPTDLDIGRVFTCRSMNE---AIPNGKETSIELDVHHPPTVTLSIEPQ----TVLEGERVIFTCQATANPEILGYRWAK----------------GGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNV----STLVN----------------VHFAPRIVVYPKPTTTD-IGSDVTLTCVWVGNPPLTLTW--TKKDSNMVLSNSNQLLLK-------------------------SVTQAD-AGTYTCRAIVPRIGVAEREVPLYVNG-PPIISSEAVQFAVRGDGGKVECFIGSTPPPDRIAWAWKENF----LEVGTLER-YTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 534          
BLAST of NEPH-1 vs. Ensembl Mouse
Match: Kirrel (kirre like nephrin family adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:1891396])

HSP 1 Score: 81.2629 bits (199), Expect = 3.010e-15
Identity = 133/592 (22.47%), Postives = 222/592 (37.50%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERL---AGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            P   +V+    A L C V  N S     VQW KDG      + L+     RY++ G  + G Y+L I   +  DD  Y CQ   A      ++   LTV++PP++ ++           T                 L+C    ++PA  ++W       R+G       Q+ G VT+     D   +    + S L +       G +  C   NE        K   ++L+V     V + + P        E E +   C A+ NP  + Y W K     +     +Y       +  V        + C+V         Y+   + ++    S LVN                V ++P I+     T    +G  VTL C    NPP  +TW  +K  S  +++N + +  +                         ++T AD  G + C A+       ++ V +     P I++++ +  A  G   ++ C I S P PD+    W +N     +E  +  + Y  ER    +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L      P+  I G++
Sbjct:   59 PADQTVVAGQRAVLPC-VLLNYSGI---VQWTKDGLALGMGQGLKAW--PRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL---RSRRAKLTVLIPPEETRIDGGPVILLQAGTPYN--------------LTCRAFNAKPAATIIW------FRDGT------QQEGAVTSTELLKDGKRE---TTISQLLIEPTDLDIGRVFTCRSMNEAI---PNGKETSIELDVHHPPTVTLSIEPQ----TVLEGERVIFTCQATANPEILGYRWAKGGFLIEDAHESRY-------ETNVDYSFFTEPVSCEV---------YNKVGSTNV----STLVN----------------VHFAPRIVVYPKPTTTD-IGSDVTLTCVWVGNPPLTLTW--TKKDSNMVLSNSNQLLLK-------------------------SVTQADA-GTYTCRAIVPRIGVAEREVPLYVNG-PPIISSEAVQFAVRGDGGKVECFIGSTPPPDRIAWAWKENF----LEVGTLER-YTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 534          
BLAST of NEPH-1 vs. Ensembl Mouse
Match: Kirrel2 (kirre like nephrin family adhesion molecule 2 [Source:MGI Symbol;Acc:MGI:2442334])

HSP 1 Score: 65.4698 bits (158), Expect = 3.009e-10
Identity = 100/409 (24.45%), Postives = 154/409 (37.65%), Query Frame = 3
Query:  309 VLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFN-GRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQY-SRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDL 1529
            VL+   ARL C +          VQW KDG     E  RD     RY + G   +G +DL I  V+ +D+  Y CQ + A      ++   L V+VPP+  ++            +  ++  + G+      L+C  +  SRPA EL+W       R+G    +DG      T K       D+     E+ L L      +G  L C  A  Q+    T +   + L++ +   V +   P        E E +   C A+  P    Y W K                S VL  +  R           L V+A     + F  E +  + S  V  + R TA       L V Y P IL +  ++ +  +G   +  C    NP  +ITW +    S+ + + P L
Sbjct:   32 VLLGEEARLPCALGAYRG----LVQWTKDGLALGGE--RDLPGWSRYWISGNSASGQHDLHIKPVELEDEASYECQASQAGL---RSRPAQLHVMVPPEAPQVL--------GGPSVSLVAGVPGN------LTCRSRGDSRPAPELLW------FRDGIR--LDGSSFHQTTLK-------DKATGTVENTLFLTPSSHDDGATLICR-ARSQAL--PTGRDTAVTLSLQYPPMVTLSAEPQT----VQEGEKVTFLCQATAQPPVTGYRWAKGG--------------SPVLGARGPR-----------LEVVAD----ATFLTEPVSCEVSNAVGSANRSTA-------LEVLYGP-ILQAKPKSVSVDVGKDASFSCVWRGNPLPRITWTRMG-GSQVLSSGPTL 357          
BLAST of NEPH-1 vs. Ensembl Mouse
Match: Nphs1 (nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:1859637])

HSP 1 Score: 61.2326 bits (147), Expect = 7.006e-9
Identity = 73/315 (23.17%), Postives = 127/315 (40.32%), Query Frame = 3
Query:  306 SVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILE-TTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRS-----GVLKIKVRRDLNNMFIRCQ 1232
            +V+  ST +L C V    S     VQW KDG           F  RY + G    G + L+I + D  DD EY CQV  +    E  + S+ L+++V P  ++L       +  ST        W    E+ +++C    ++PA ++++  G   + +  S   +G E              ++ ++ +E+  R+  +   NG++L C  +N       TP  A   +N+LF     +   P     H    E +++ C A          W+K     K  +I    + +      VL + VR + +   + CQ
Sbjct:   56 TVVEGSTVKLWCGVRAPGS----VVQWAKDGLLLGPNPKIPGFP-RYSLEGDSAKGEFHLLIEACDLSDDAEYECQVGRSELGPELVSPSVILSILVSPKVLQLTP-----EAGSTVT------WVAGQEY-VVTCVSGDAKPAPDIIFIQGGRTVEDVSSSVNEGSE--------------EKLFF-TEAEARVTPQSSDNGQLLVCEGSNP---ALATPIKASFTMNILFPPGPPVIDWPGLNEGHVRAGENLELPCIARGGNPPATLQWLKNG---KPVSIAWGTEHAQAVAHSVLVMTVRPEDHGARLSCQ 332          
BLAST of NEPH-1 vs. UniProt/SwissProt
Match: sp|Q08180|ICCR_DROME (Irregular chiasm C-roughest protein OS=Drosophila melanogaster OX=7227 GN=rst PE=1 SV=2)

HSP 1 Score: 118.242 bits (295), Expect = 8.094e-26
Identity = 142/602 (23.59%), Postives = 227/602 (37.71%), Query Frame = 3
Query:  288 LGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSI--NLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKS---EFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFF-------------------HFTEHEMIQINCSASTNPANVIYNW-IKYNP---TTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIEL 2009
            + P   + ++ +   L CRV  N   T   +QW KD FG         F  RY M G  E G Y L I+ V   DD  Y CQV+         +S    LTV+VPP+  K+  +Q D             I+   +  + + C     +PA E+ W              IDG  +G V T +     +   DQ  + ++S LRL  +K+H+     C     Q+   +T + A +++ V +   VK++V+   P                        EH  +++ C A  NP++V Y W I   P     KT  +I+           V R  ++  ++C+V + +   E       +S   D SY  +  +R                        ++  A +G VV+L C  DSNP  +I W +   S + +  + +L                            F++++ +  G + C A   G+  +    +V    +P I  +Q+      G + RI C   S+P      + W  N      E+     I  +    GV S L I       YG YNC+V N YG   + I+L
Sbjct:   32 MEPQDQTAVVGARVTLPCRV-INKQGT---LQWTKDDFGLGTSRDLSGFE-RYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKI--TQGDV------------IYATEDRKVEIECVSVGGKPAAEITW--------------IDG--LGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSC---QAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIR----------NVTRKFHDAIVKCEVQNSVGKSE-------DSETLDISYAPSFRQRP-----------------------QSMEADVGSVVSLTCEVDSNPQPEIVWIQHP-SDRVVGTSTNLT---------------------------FSVSN-ETAGRYYCKANVPGYAEISADAYVYLKGSPAI-GSQRTQYGLVGDTARIECFASSVPR--ARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQL 523          
BLAST of NEPH-1 vs. UniProt/SwissProt
Match: sp|Q96J84|KIRR1_HUMAN (Kin of IRRE-like protein 1 OS=Homo sapiens OX=9606 GN=KIRREL1 PE=1 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 1.561e-16
Identity = 139/620 (22.42%), Postives = 231/620 (37.26%), Query Frame = 3
Query:  243 LYIYLWMVKFADNQILG--------PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQI--ILRVQYSP-IILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERL---AGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            L + +W++  +D    G        P   +V+    A L C V  N S     VQW KDG      + L+     RY++ G  + G Y+L I   +  DD  Y CQ   A      ++   LTV++PP+  ++           T +               L+C    ++PA  ++W       R+G       Q+ G V +     D   +    + S L +       G +  C   NE      + K   ++L+V     V + + P        E E +   C A+ NP  + Y W K                                I     S       YS F            V+C E H   GS+ +  ++ V ++P I++D    T    +G  VTL C    NPP  +TW  +K  S  +++N + +  +                         ++T AD  G + C A+       ++ V +     P I++++ +  A  G   ++ C I S P PD+    W +N     +E  +  + Y  ER    +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L      P+  I G++
Sbjct:    2 LSLLVWILTLSDTFSQGTQTRFSQEPADQTVVAGQRAVLPC-VLLNYSGI---VQWTKDGLALGMGQGLKAW--PRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL---RSRRAKLTVLIPPEDTRIDGGPVILLQAGTPHN--------------LTCRAFNAKPAATIIW------FRDGT------QQEGAVASTELLKDGKRE---TTVSQLLINPTDLDIGRVFTCRSMNEAI---PSGKETSIELDVHHPPTVTLSIEPQ----TVQEGERVVFTCQATANPEILGYRWAK----------------------------GGFLIEDAHESRYETNVDYSFFTEP---------VSC-EVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTD--IGSDVTLTCVWVGNPPLTLTW--TKKDSNMVLSNSNQLLLK-------------------------SVTQAD-AGTYTCRAIVPRIGVAEREVPLYVNG-PPIISSEAVQYAVRGDGGKVECFIGSTPPPDRIAWAWKENF----LEVGTLER-YTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 502          
BLAST of NEPH-1 vs. UniProt/SwissProt
Match: sp|Q6X936|KIRR1_RAT (Kin of IRRE-like protein 1 OS=Rattus norvegicus OX=10116 GN=Kirrel1 PE=1 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 6.917e-15
Identity = 132/592 (22.30%), Postives = 218/592 (36.82%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERL---AGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            P   +V+    A L C V  N S     VQW KDG      + L+     RY++ G  + G Y+L I   +  DD  Y CQ   A      ++   LTV++PP+  ++           T                 L+C    ++PA  ++W       R+G       Q+ G VT+     D   +    + S L ++      G +  C   NE        K   ++L+V     V + + P        E E +   C A+ NP  + Y W K                 G L            +     +     E Y+   + ++    S LVN                V ++P I+     T    +G  VTL C    NPP  +TW  +K  S  +++N + +  +                         ++T AD  G + C A+       ++ V +     P I++++ +  A  G   ++ C I S P PD+    W +N     +E  +  + Y  ER    +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L      P+  I G++
Sbjct:   59 PADQTVVAGHRAVLPC-VLLNYSGI---VQWTKDGLALGMGQGLKAW--PRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL---RSRRAKLTVLIPPEDTRIDGGPVILLQAGTPYN--------------LTCRAFNAKPAATIIW------FRDGT------QQEGAVTSTELLKDGKRE---TTISQLLIQPTDLDIGRVFTCRSMNEAI---PNGKETSIELDVHHPPTVTLSIEPQT----VLEGERVIFTCQATANPEILGYRWAK----------------GGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNV----STLVN----------------VHFAPRIVVYPKPTTTD-IGSDVTLTCVWVGNPPLTLTW--TKKDSNMVLSNSNQLLLK-------------------------SVTQAD-AGTYTCRAIVPRIGVAEREVPLYVNG-PPIISSEAVQFAVRGDGGKVECFIGSTPPPDRIAWAWKENF----LEVGTLER-YTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 534          
BLAST of NEPH-1 vs. UniProt/SwissProt
Match: sp|Q80W68|KIRR1_MOUSE (Kin of IRRE-like protein 1 OS=Mus musculus OX=10090 GN=Kirrel1 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 8.210e-15
Identity = 132/592 (22.30%), Postives = 218/592 (36.82%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERL---AGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            P   +V+    A L C V  N S     VQW KDG      + L+     RY++ G  + G Y+L I   +  DD  Y CQ   A      ++   LTV++PP++ ++           T                 L+C    ++PA  ++W       R+G       Q+ G VT+     D   +    + S L +       G +  C   NE        K   ++L+V     V + + P        E E +   C A+ NP  + Y W K                 G L            +     +     E Y+   + ++    S LVN                V ++P I+     T    +G  VTL C    NPP  +TW  +K  S  +++N + +  +                         ++T AD  G + C A+       ++ V +     P I++++ +  A  G   ++ C I S P PD+    W +N     +E  +  + Y  ER    +GV+S L I+ V   D+ T YNC+  N +G  ++ I+L      P+  I G++
Sbjct:   59 PADQTVVAGQRAVLPC-VLLNYSGI---VQWTKDGLALGMGQGLKAW--PRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL---RSRRAKLTVLIPPEETRIDGGPVILLQAGTPYN--------------LTCRAFNAKPAATIIW------FRDGT------QQEGAVTSTELLKDGKRE---TTISQLLIEPTDLDIGRVFTCRSMNE---AIPNGKETSIELDVHHPPTVTLSIEPQ----TVLEGERVIFTCQATANPEILGYRWAK----------------GGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNV----STLVN----------------VHFAPRIVVYPKPTTTD-IGSDVTLTCVWVGNPPLTLTW--TKKDSNMVLSNSNQLLLK-------------------------SVTQAD-AGTYTCRAIVPRIGVAEREVPLYVNG-PPIISSEAVQFAVRGDGGKVECFIGSTPPPDRIAWAWKENF----LEVGTLER-YTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGAT 534          
BLAST of NEPH-1 vs. UniProt/SwissProt
Match: sp|Q9QZS7|NPHN_MOUSE (Nephrin OS=Mus musculus OX=10090 GN=Nphs1 PE=1 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 4.901e-8
Identity = 73/315 (23.17%), Postives = 127/315 (40.32%), Query Frame = 3
Query:  306 SVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILE-TTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRS-----GVLKIKVRRDLNNMFIRCQ 1232
            +V+  ST +L C V    S     VQW KDG           F  RY + G    G + L+I + D  DD EY CQV  +    E  + S+ L+++V P  ++L       +  ST        W    E+ +++C    ++PA ++++  G   + +  S   +G E              ++ ++ +E+  R+  +   NG++L C  +N       TP  A   +N+LF     +   P     H    E +++ C A          W+K     K  +I    + +      VL + VR + +   + CQ
Sbjct:   56 TVVEGSTVKLWCGVRAPGS----VVQWAKDGLLLGPNPKIPGFP-RYSLEGDSAKGEFHLLIEACDLSDDAEYECQVGRSELGPELVSPSVILSILVSPKVLQLTP-----EAGSTVT------WVAGQEY-VVTCVSGDAKPAPDIIFIQGGRTVEDVSSSVNEGSE--------------EKLFF-TEAEARVTPQSSDNGQLLVCEGSNP---ALATPIKASFTMNILFPPGPPVIDWPGLNEGHVRAGENLELPCIARGGNPPATLQWLKNG---KPVSIAWGTEHAQAVAHSVLVMTVRPEDHGARLSCQ 332          
BLAST of NEPH-1 vs. TrEMBL
Match: A0A0H3YJP5 (NEPH-1 OS=Schmidtea mediterranea OX=79327 GN=NEPH-1 PE=2 SV=1)

HSP 1 Score: 1875.91 bits (4858), Expect = 0.000e+0
Identity = 934/934 (100.00%), Postives = 934/934 (100.00%), Query Frame = 3
Query:  189 MLIVHGAFHIPGNLAFTSLYIYLWMVKFADNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSSXXXXXXXXXXXXXXXXXRTSKNRSTSTNQRSVYMKGHMMSPCHSPLSQENFGTGFTNAYIDGVGDFGNMDFMQMSSKNNYESTCASGPQSMINNISGIYLDSNLNYYQTNTKDMKVIPEMDQIHNHNIYQRRSEWMENHNSQIEGANESTRSYDSGVCPDESILTSCSPYHPNQSTNFGVPSCQIIPLYQSSKTDQELSQSSQNIYYPALNVSKNILSSVSLASVLYHKPIISCSNRNDYNYQFPTIKDSFIVPNIQSEVQPFDQEQYRTINNLPDLTDVREPVLPYIIAYSPTCITRKNLDWTSLNQSTKL 2990
            MLIVHGAFHIPGNLAFTSLYIYLWMVKFADNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQMSSYSSMTLLSISDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSSCAIALAVLFAFIIFCIIRTSKNRSTSTNQRSVYMKGHMMSPCHSPLSQENFGTGFTNAYIDGVGDFGNMDFMQMSSKNNYESTCASGPQSMINNISGIYLDSNLNYYQTNTKDMKVIPEMDQIHNHNIYQRRSEWMENHNSQIEGANESTRSYDSGVCPDESILTSCSPYHPNQSTNFGVPSCQIIPLYQSSKTDQELSQSSQNIYYPALNVSKNILSSVSLASVLYHKPIISCSNRNDYNYQFPTIKDSFIVPNIQSEVQPFDQEQYRTINNLPDLTDVREPVLPYIIAYSPTCITRKNLDWTSLNQSTKL
Sbjct:    1 MLIVHGAFHIPGNLAFTSLYIYLWMVKFADNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQMSSYSSMTLLSISDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSSCAIALAVLFAFIIFCIIRTSKNRSTSTNQRSVYMKGHMMSPCHSPLSQENFGTGFTNAYIDGVGDFGNMDFMQMSSKNNYESTCASGPQSMINNISGIYLDSNLNYYQTNTKDMKVIPEMDQIHNHNIYQRRSEWMENHNSQIEGANESTRSYDSGVCPDESILTSCSPYHPNQSTNFGVPSCQIIPLYQSSKTDQELSQSSQNIYYPALNVSKNILSSVSLASVLYHKPIISCSNRNDYNYQFPTIKDSFIVPNIQSEVQPFDQEQYRTINNLPDLTDVREPVLPYIIAYSPTCITRKNLDWTSLNQSTKL 934          
BLAST of NEPH-1 vs. TrEMBL
Match: A0A095AEM0 (Irregular chiasm C-roughest protein OS=Schistosoma haematobium OX=6185 GN=MS3_00396 PE=4 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 2.922e-48
Identity = 161/614 (26.22%), Postives = 263/614 (42.83%), Query Frame = 3
Query:  288 LGPVSTSVLINSTARLRCRVTF---NNSNTPVKVQWQKDGFG----------YENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKL-------KSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALR-----EGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            L P S SV +NST RL+CRV      ++   V+V W K+ FG          Y   +  D+   RY +P   + G YDL I +V+  D+G Y CQVN       +  ++ LTV VP +  +L       K  + D     +   I+ +        ++L C  ++ +P   L W +    ++     +   G       G +T + E      +    + S +R  L K H+G++++C   N    MH T +PA  K+ V +   V + V P RP   F EH++I + C+A   P +  + W  Y    +   I + + R     +++ R+L+    RC  +S                                 G ++  ++V++ P    +      A LG+ V +DC A  NP   I W +     +E+++    +   NL+++                          + G +IC A    FPPV K +++ +   P+I  N  I+ A  G   R+ C + S+PLP  G+  W+ N N  PI+  S ++  +EE + GVV  L+I  V   D+G YNCSV N YG     I L    + P+ FIIG++
Sbjct:   64 LHPESQSVTLNSTVRLQCRVRMLIDPDTGAGVQVYWSKNDFGIGGNREDIQEYGRNSRYDY--SRYDLPYNLKEGQYDLQIMNVELSDEGSYVCQVNFMRQQYLSQTAV-LTVQVPSEAPQLVQITNEGKGQRIDI--GPSRPAIVDD-----GSIMVLECIARHGKPGALLTWFIDGVQVKLESNPDSTPGSFISGFSGNLTFQLESSAKIPRLV-DATSSMRAHLNKLHHGKLVECRAENTGYEMH-TLRPAQTKIEVHYAPVVSIQVRPSRPDNQFMEHDIITVECTAHGRPDSFFWEW--YVNGRQVENIAESWYR-----LRLTRELHQSVFRCIAIS------------------------------NKKGVAETTIKVKFGPQFHQASALLFTASLGEDVLMDCPAIGNPTPHIEWRRE--GGREVLSRSVSLKRENLKEE--------------------------DFGTYICTAFVPEFPPVSKQMYIARRKPPRIQPN-PIVHAYLGQPARLRCTVNSVPLPPSGQTHWYFNGN--PIQPDSHHKFEQEEFIGGVVLVLHIAHVMMSDFGQYNCSVKNGYGSDWKLIRLSHQEDIPIQFIIGAA 597          
BLAST of NEPH-1 vs. TrEMBL
Match: A0A430QGF4 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0004533 PE=4 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 3.054e-48
Identity = 161/614 (26.22%), Postives = 263/614 (42.83%), Query Frame = 3
Query:  288 LGPVSTSVLINSTARLRCRVTF---NNSNTPVKVQWQKDGFG----------YENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKL-------KSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALR-----EGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            L P S SV +NST RL+CRV      ++   V+V W K+ FG          Y   +  D+   RY +P   + G YDL I +V+  D+G Y CQVN       +  ++ LTV VP +  +L       K  + D     +   I+ +        ++L C  ++ +P   L W +    ++     +   G       G +T + E      +    + S +R  L K H+G++++C   N    MH T +PA  K+ V +   V + V P RP   F EH++I + C+A   P +  + W  Y    +   I + + R     +++ R+L+    RC  +S                                 G ++  ++V++ P    +      A LG+ V +DC A  NP   I W +     +E+++    +   NL+++                          + G +IC A    FPPV K +++ +   P+I  N  I+ A  G   R+ C + S+PLP  G+  W+ N N  PI+  S ++  +EE + GVV  L+I  V   D+G YNCSV N YG     I L    + P+ FIIG++
Sbjct:  159 LHPESQSVTLNSTVRLQCRVRMLIDPDTGAGVQVYWSKNDFGIGGNREDIQEYGRNSRYDY--SRYDLPYNLKEGQYDLQIMNVELSDEGSYVCQVNFMRQQYLSQTAV-LTVQVPSEAPQLVQITNEGKGQRIDI--GPSRPAIVDD-----GSIMVLECIARHGKPGALLTWFIDGVQVKLESNPDSTPGSFISGFSGNLTFQLESSAKIPRLV-DATSSMRAHLNKLHHGKLVECRAENTGYEMH-TLRPAQTKIEVHYAPVVSIQVRPSRPDNQFMEHDIITVECTAHGRPDSFFWEW--YVNGRQVENIAESWYR-----LRLTRELHQSVFRCIAIS------------------------------NKKGVAETTIKVKFGPQFHQASALLFTASLGEDVLMDCPAIGNPTPHIEWRRE--GGREVLSRSVSLKRENLKEE--------------------------DFGTYICTAFVPEFPPVSKQMYIARRKPPRIQPN-PIVHAYLGQPARLRCTVNSVPLPPSGQTHWYFNGN--PIQPDSHHKFEQEEFIGGVVLVLHIAHVMMSDFGQYNCSVKNGYGSDWKLIRLSHQEDIPIQFIIGAA 692          
BLAST of NEPH-1 vs. TrEMBL
Match: A0A4E0S4A9 (Irregular chiasm C-roughest protein OS=Fasciola hepatica OX=6192 GN=D915_000115 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 6.522e-48
Identity = 153/612 (25.00%), Postives = 257/612 (41.99%), Query Frame = 3
Query:  288 LGPVSTSVLINSTARLRCRVTF---NNSNTPVKVQWQKDGFGYENETLRDHFN----------GRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKL-----KSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFAL-----REGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            L P S +V +NST RL+CRV       +    +V W K+ FG      RD              RY +P   + G YDL I +V+  D+G Y CQVN       +  ++ LTV VP +  KL     +    + +  ++   ++++        L L C  ++ +P   L W +    +      +G++G      VG +T +      F +    + S +  RL K H+G++++C   N     H   +PA  KL V +   V + + P R    + EH++I + C+A   P +  + W       +      Y       ++++ R+++N   RC  +S                                 G +++I+RV++ P   +       A  G+ V + C A  NP  +I W +   S  E++         NL++                          ++ G ++C A    FPP+ K +++ +   P I  N  ++ A+ G   R+ C + S+PLP  G+  WF   N +PI   S++    EE + GVV  L+I  V   DYG YNC+V N YG     IEL+   + P+ FIIG++
Sbjct:   47 LHPESQAVTLNSTVRLQCRVRILVDPTTGAGAQVYWSKNDFGIGGN--RDDIQEYGRSARYKYSRYDLPYNLKDGQYDLQIINVELSDEGSYVCQVNFMKQQYLSQTAV-LTVQVPSEAPKLIQITKEGKGPEVEVGASTPAVVED-----GAILALKCVARHGKPGALLTWLIDGVPVIVEPGGDGQNGTFRSGFVGNLTVQVTPSSKFPRL-MDATSQMSARLNKLHHGKLIECRAENVGYESHAL-RPAYTKLEVHYAPVVSIQIRPQRRNNEYMEHDVITVECTAHGRPDSFFWEWFVNGRQVENLVDPWY-------RLRLTRNMHNAVFRCIAIS------------------------------NRKGHAEMIVRVKFGPQFQEPSALLFTASPGEDVAMSCPARGNPEPRIDWRRE--SGHEVLHRGVTYRKDNLRE--------------------------EDFGTYVCTAYVQEFPPISKQMYIAKRRPPTIQPN-PLVPARLGRPARLRCTVNSVPLPPMGQTHWF--YNGRPIRPDSQHTFEREEFIGGVVLILHIAHVMMTDYGKYNCTVQNGYGTDWKLIELVHQEDIPLQFIIGAA 580          
BLAST of NEPH-1 vs. TrEMBL
Match: A0A5K4F0U6 (Nephrin related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.148e-47
Identity = 160/614 (26.06%), Postives = 262/614 (42.67%), Query Frame = 3
Query:  288 LGPVSTSVLINSTARLRCRVTF---NNSNTPVKVQWQKDGFG----------YENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKL-------KSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALR-----EGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            L P S SV +NST RL+CRV      ++   V+V W K+ FG          Y   +  D+   RY +P   + G YDL I +V+  D+G Y CQVN       +  ++ LTV VP +  +L       K  + D     +   I+ +        ++L C  ++ +P   L W +    ++     +   G       G +T + E      +    + S +R  L K H+G++++C   N    MH T +PA  K+ V +   V + V P RP   F EH++I + C+A   P +  + W  Y    +   I + + R     +++ R+L+    RC  +S                                 G ++  ++V++ P    +      A  G+ V +DC A  NP   I W +     +E+++    +   NL+++                          + G +IC A    FPPV K +++ +   P+I  N  I+ A  G   R+ C + S+PLP  G+  W+ N N  PI+  S ++  +EE + GVV  L+I  V   D+G YNCSV N YG     I L    + P+ FIIG++
Sbjct:   22 LHPESQSVTLNSTVRLQCRVRMLIDPDTGAGVQVYWSKNDFGIGGNREDIQEYGRNSRYDY--SRYDLPYNLKEGQYDLQIMNVELSDEGSYVCQVNFMRQQYLSQTAV-LTVQVPSEAPQLVQITNEGKGQRIDI--GPSRPAIVDD-----GSIMVLECIARHGKPGALLTWFIDGVQVKLESNPDSTPGSFISGFSGNLTFQLEASAKIPRLV-DATSSMRAHLNKLHHGKLVECRAENTGYEMH-TLRPAQTKIEVHYAPVVSIQVRPSRPDNQFMEHDIITVECTAHGRPDSFFWEW--YVNGRQVENIAESWYR-----LRLTRELHQSVFRCIAIS------------------------------NKKGVAETTIKVKFGPQFHQASALLFTASPGEDVLMDCPAIGNPTPHIEWRRE--GGREVLSRSVSLKRENLKEE--------------------------DFGTYICTAFVPEFPPVSKQMYIAKRKPPRIQPN-PIVHAYLGQPARLRCTVNSVPLPPSGQTHWYFNGN--PIQPDSHHKFEQEEFIGGVVLVLHIAHVMMSDFGQYNCSVKNGYGSDWKLIRLSHQEDIPIQFIIGAA 555          
BLAST of NEPH-1 vs. Ensembl Cavefish
Match: kirrel1a (kirre like nephrin family adhesion molecule 1 [Source:NCBI gene;Acc:103031116])

HSP 1 Score: 97.0561 bits (240), Expect = 4.537e-20
Identity = 146/608 (24.01%), Postives = 224/608 (36.84%), Query Frame = 3
Query:  261 MVKFADNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTD--GFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERL------AGVVSYLYIHKVTYEDY-GTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            M +F+      P   SV++     L C V FN S     VQW KDG      E LR     RY++    + G Y+L I S +  DD  Y CQ   A      ++   LTV++PPD+  ++ S           EI+       N    LSC  + ++P   + W+              DG  +    + +E +   D+    + S L +       G+   C   N    M K      + LNV     V + + P        E E +   C A+ NP  + Y W K         ++    R  V   K         + CQV + +            SI+ D  +                IL V+  P+ +DS  +         VTL+C+   NPP  +TW K K SS  +  N  L                          Y  +++ AD  G ++C A+    G    + T+ V     P I++++ +  A  G    + C+I S P PD  KI+W    N    E  +  + Y  E+         V+S L I+ V   D+  TYNC+  N +G  +  I L      P+  I G +
Sbjct:    1 MARFSQE----PADQSVVLGQRVVLSC-VVFNYSGI---VQWTKDGLALGIGEDLRAW--PRYRVLRMVDIGQYNLEISSAELSDDSLYECQATEAAL---RSRRAKLTVLIPPDEPVIEGSP----------EILLTAGVPHN----LSCVSRGAKPPAAIEWQK-------------DGLPIEGAFSTTEVLP--DRKRVTTRSFLPVLPVDTDTGKNFTCMATNPAVPMGKR---TTITLNVHHPPVVVLSIEPR----SVLEGERVTFTCQATANPPIMGYKWAKGG-------VVIQGARESVFITKADHSFFTEPVSCQVFNAVGSTNV-------SILVDVHF--------------GPILVVEPKPVTVDSDSD---------VTLNCKWAGNPPLTLTWTK-KGSSMVLSNNNQL--------------------------YLKSVSQAD-AGQYVCKAIVPRIGVGETEVTLTVNG---PPIISSEPVQYAVRGERGEVKCYIASTPPPD--KIVWAWKENVWEKEKGTLPERYTVEQSKPSSDGGAVLSTLTINNVMESDFQSTYNCTAWNGFGPGTMIITLEETEVVPVGIIAGGT 489          
BLAST of NEPH-1 vs. Ensembl Cavefish
Match: kirrel1b (kirre like nephrin family adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-070912-173])

HSP 1 Score: 84.3445 bits (207), Expect = 3.663e-16
Identity = 139/580 (23.97%), Postives = 214/580 (36.90%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTD--GFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKP----IEAKSKNQIYEEERLAGVVSYLYIHKVTYEDY-GTYNCSVSNPYGRVSSTIEL 2009
            P   SV++     L C V FN +     VQW KDG      E LR     RY++    + G Y+L I S +  DD  Y CQ   A      ++   LTV++PPD   ++ +           EI+       N    L+C  + ++P + + W               DG  V    T +E +   D+    + S L ++      G    C  +N    + K    A + LNV     V + + P        E E +   C A+ NP  + Y W K         +I    R  V             + CQV + +            SI+ D  +                IL V+  P+ +D         +   VTL+C+   NPP  +TW K K SS  +  N  L                          Y  +++ AD  G ++C A+    G    + T+ V     P I++++ +  A  G    I C+I S P PDK    W +N+  K     +E  +  Q     +   V+S L I+ V   D+  TYNC+  N +G  +  I L
Sbjct:   29 PADQSVVLGERVVLSC-VVFNYTGI---VQWTKDGLALGIGEDLRAW--PRYRVLRIVDVGQYNLEISSSELSDDSLYECQATEAAL---RSRRAKLTVLIPPDDPVIEGAP----------EILLMAGVPYN----LTCVSRGAKPLSTIEWYK-------------DGVIVDGAHTSTEVLA--DRKRVTTRSFLPIQPVDTDTGHNFSCVASNLAVPLGKR---ATITLNVHHAPTVLLSISPR----SVLEGERVTFTCQATANPPVMGYRWAKGG-------VILEGARESVFVTTADHSFFTEPVSCQVFNAVGSTNV-------SILVDVHF--------------GPILVVEPRPVTVD---------VDSDVTLNCKWAGNPPLTLTWTK-KGSSMVLSNNNQL--------------------------YLKSVSQAD-AGQYVCKAIVPRIGVGETEVTLTVNG---PPIISSEPVQYAVRGEKGEIKCYIASTPPPDKIVWAWKENVWEKERGTLLERYTVEQSKPVSQGGAVLSTLTINNVMESDFQSTYNCTAWNSFGPGTMIITL 495          
BLAST of NEPH-1 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 65.855 bits (159), Expect = 1.708e-10
Identity = 119/563 (21.14%), Postives = 200/563 (35.52%), Query Frame = 3
Query:  378 VQWQKDGFGYENETLRDHFNG--RYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVW-KLGEF--ALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIG 2048
            V W KDG        RD  +G  RY + G   +G + L I  V+  DD  + CQ   AI     ++   LTV+VPP+   +                   +     + L L+C    ++PA  ++W + GE        K+   DG+   TV+T            Y S S++         G+ + C  +N+        K   + +++  +  V + V P +P     E  +++ +CSA  NP    Y W K     K  +   Y       ++ V        + C+V + L       N      +Y                      R+   P  L   L + A F       +C    NP   I W K    S  +++N +++  + +++                          ++ G ++C A+       +K V +     P I + Q    A  G   +I C I S P PD+    W + +       +   +    E   GV+S L +  +   D+ T YNC+  N +G  +  I L      P+  IIG
Sbjct:   30 VLWIKDGLALG--VGRD-LSGYPRYTVVGDHSSGEHHLRIQRVELMDDAVFECQ---AIQAAMRSRPARLTVLVPPEDPVIDGGPI--------------VSLRAGDPLNLTCHADNAKPAASIIWIRNGEVLNGAMYSKTLLRDGRRESTVST-----------LYISPSNI-------ETGQKIICRASNKAI---PNGKETSVTIDIQHLPLVNLSVEP-QPVL---EGNLVKFHCSAKANPPVTQYKWAKGGTVIKEVSGDTY-------EVIVDHSFFTEAVSCEVTNPLGSTNISRNVD----VYFGP-------------------RMAAEPQSLQVDLGSDAVF-------NCAWTGNPSLTIVWMKR--GSGVVLSNENILTLKAVRQ--------------------------EDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQ-THQAPHGEKGQIKCFIRSTPPPDRIAWSWKETVLESGTSGRYTVETVSTED--GVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 479          
BLAST of NEPH-1 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 65.4698 bits (158), Expect = 2.122e-10
Identity = 119/563 (21.14%), Postives = 200/563 (35.52%), Query Frame = 3
Query:  378 VQWQKDGFGYENETLRDHFNG--RYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVW-KLGEF--ALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIG 2048
            V W KDG        RD  +G  RY + G   +G + L I  V+  DD  + CQ   AI     ++   LTV+VPP+   +                   +     + L L+C    ++PA  ++W + GE        K+   DG+   TV+T            Y S S++         G+ + C  +N+        K   + +++  +  V + V P +P     E  +++ +CSA  NP    Y W K     K  +   Y       ++ V        + C+V + L       N      +Y                      R+   P  L   L + A F       +C    NP   I W K    S  +++N +++  + +++                          ++ G ++C A+       +K V +     P I + Q    A  G   +I C I S P PD+    W + +       +   +    E   GV+S L +  +   D+ T YNC+  N +G  +  I L      P+  IIG
Sbjct:   30 VLWIKDGLALG--VGRD-LSGYPRYTVVGDHSSGEHHLRIQRVELMDDAVFECQ---AIQAAMRSRPARLTVLVPPEDPVIDGGPI--------------VSLRAGDPLNLTCHADNAKPAASIIWIRNGEVLNGAMYSKTLLRDGRRESTVST-----------LYISPSNI-------ETGQKIICRASNKAI---PNGKETSVTIDIQHLPLVNLSVEP-QPVL---EGNLVKFHCSAKANPPVTQYKWAKGGTVIKEVSGDTY-------EVIVDHSFFTEAVSCEVTNPLGSTNISRNVD----VYFGP-------------------RMAAEPQSLQVDLGSDAVF-------NCAWTGNPSLTIVWMKR--GSGVVLSNENILTLKAVRQ--------------------------EDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQ-THQAPHGEKGQIKCFIRSTPPPDRIAWSWKETVLESGTSGRYTVETVSTED--GVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 479          
BLAST of NEPH-1 vs. Ensembl Cavefish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 55.8398 bits (133), Expect = 1.913e-7
Identity = 57/232 (24.57%), Postives = 96/232 (41.38%), Query Frame = 3
Query:  441 RYQMPGPRETGTYDLVIHSVDKQDDGEYACQ-VNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVW-KLGEF--ALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIK 1124
            RY + G    G Y L+I   +  DDG + CQ + A I     ++   LTV+VPPD   +  +                +     + L L+C    ++PA  ++W + GE        K+   DGQ   TV+T            Y S S++        +G+ + C  +N+ +      K A + +++  +  V + V P +P     E  +++ +CSA  NP    Y W K
Sbjct:   77 RYDVIGDHSKGEYHLLIQRTELGDDGSFECQGIQAGIR----SRPARLTVLVPPDDPVIIGAPI--------------VSLRAGDPLNLTCHADNAKPAASIIWIRNGEVLNGAMYSKTLLRDGQRESTVST-----------LYISASNI-------ESGQRITCRASNKAA---PNGKEATVTIDIQHLPLVNLSVEP-QPIL---EGNLVKFHCSAKANPPVTHYRWAK 265          
BLAST of NEPH-1 vs. Ensembl Medaka
Match: kirrel1a (kin of IRRE-like protein 1 [Source:NCBI gene;Acc:101168819])

HSP 1 Score: 107.457 bits (267), Expect = 2.498e-23
Identity = 145/596 (24.33%), Postives = 230/596 (38.59%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYE-NETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQV-NAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTD--GFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLA----GVVSYLYIHKVTYEDY-GTYNCSVSNPYGRVSSTIELIPPVETPM-IFIIGS 2051
            P   SV+      L C V FN S     VQW KDG      E LR     RY++   +E+G Y+L I S D  DD  Y CQ  +AA+     ++   LTV++PPD   +              E++ N      E   LSC  + ++P + + W      L+       DG  V    + +E +   D+    ++SHL +       G    C  +N       + K   + LNV     V + + P        E + +   C A  NP  + Y W K         ++    R  V   K         + C V + + GK   S                            I++ VQ+ PI+L    + K   +   VTL+C+   NPP  +TW+K    S  +++N + +                         Y  +++ AD  G ++C A+    G    + T+ V     P I+++  +  A  G    + C+I S P PDK    W +N+  K      +    E+ +L+    GV+S L I+ V   D+  TYNC+  N +G  +  I L    E P+ I  +G+
Sbjct:   22 PADQSVVRGQRVILSC-VVFNYSGI---VQWTKDGLALGIGEDLRAW--PRYRVLRVQESGQYNLEILSADLSDDAVYECQAPDAALR----SRRAKLTVLIPPDDPVIDGGP----------EVLLNA----GESYNLSCVSRGAKPPSTIEW------LK-------DGLPVEGAVSITEVL--ADRKRVTTQSHLPIHPVDTDTGRNYSCVTSN---LAVPSGKSTTVTLNVHHPPVVTLSIEPR----SVLEGDRVTFTCQAHANPPIMGYRWAKGG-------VVLQGARESVFTTKADHSFFTEPVSCLVFNAV-GKTNVS----------------------------ILVDVQFGPILLVEP-QPKTVDVNSDVTLNCKWAGNPPLTLTWFKK--GSNMVLSNSNQL-------------------------YLQSVSQAD-AGQYVCKAIVPRIGVGETEVTLTVNG---PPIISSDPVQYAVRGERGEVKCYIASTPPPDKIVWAWKENVWEKERGTLQERYTVEQSKLSAEGGGVLSTLTINNVMESDFLSTYNCTAWNSFGPGTMIITLEEKEEVPVGIIAVGT 503          
BLAST of NEPH-1 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 73.559 bits (179), Expect = 8.065e-13
Identity = 117/560 (20.89%), Postives = 200/560 (35.71%), Query Frame = 3
Query:  378 VQWQKDGFGYENETLRDHFNG--RYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIG 2048
            V W KDG        RD  +G  RY + G   +G + L I  V+  DD  + CQ   A+     ++   LTV+VPPD   +                   +     + L L+C    ++PA  ++W      +R G+   ++G     V+ ++   D   +    + S L L       G+ + C  +N+        K A + +++  +  V + V P        E  +++  CSA  NP   +Y W K     K  +   Y       ++ V        + C+V + L       N      +Y                      R+   P  L   L + A F       +C    NP   I W K    S  +++N +L+  +++++                          ++ G ++C A+       +K V +     P I + Q    A  G   +I C I S P PD+    W + +       +   +    E   GV+S L +  +   D+ T YNC+  N +G  +  I L      P+  IIG
Sbjct:   48 VLWIKDGLALG--VGRD-LSGYPRYTVIGDHGSGEHHLRIQRVELMDDAVFECQ---AVQAAMRSRPARLTVLVPPDDPVIGGGPV--------------VSLRAGDPLNLTCHADNAKPAASIIW------MRNGEV--LNGAMYSKVSIEALVRDGRRE---STVSTLYLSPSNIETGQQIICRASNKAV---PNGKEASVTIDIQHLPLVNLSVEPQ----AVLEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTY-------EVIVDHSFFTEPVSCEVTNSLGSTNVSRNVD----VYFGP-------------------RMAAEPQSLQVDLGSDAVF-------NCAWTGNPSLTIVWMKR--GSGVVLSNENLLTLKSVRQ--------------------------EDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQ-TQQALHGEKGQIKCFIRSTPPPDRIAWSWKETVLESGTSGRYTVETVNTEE--GVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 501          
BLAST of NEPH-1 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 72.7886 bits (177), Expect = 1.169e-12
Identity = 116/560 (20.71%), Postives = 198/560 (35.36%), Query Frame = 3
Query:  378 VQWQKDGFGYENETLRDHFNG--RYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIG 2048
            V W KDG        RD  +G  RY + G   +G + L I  V+  DD  + CQ   A+     ++   LTV+VPPD   +                   +     + L L+C    ++PA  ++W      +R G+   ++G        +    +S     Y S S++         G+ + C  +N+        K A + +++  +  V + V P        E  +++  CSA  NP   +Y W K     K  +   Y       ++ V        + C+V + L       N      +Y                      R+   P  L   L + A F       +C    NP   I W K    S  +++N +L+  +++++                          ++ G ++C A+       +K V +     P I + Q    A  G   +I C I S P PD+    W + +       +   +    E   GV+S L +  +   D+ T YNC+  N +G  +  I L      P+  IIG
Sbjct:   76 VLWIKDGLALG--VGRD-LSGYPRYTVIGDHGSGEHHLRIQRVELMDDAVFECQ---AVQAAMRSRPARLTVLVPPDDPVIGGGPV--------------VSLRAGDPLNLTCHADNAKPAASIIW------MRNGEV--LNGAMYSKALVRDGRRESTVSTLYLSPSNI-------ETGQQIICRASNKAV---PNGKEASVTIDIQHLPLVNLSVEPQ----AVLEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTY-------EVIVDHSFFTEPVSCEVTNSLGSTNVSRNVD----VYFGP-------------------RMAAEPQSLQVDLGSDAVF-------NCAWTGNPSLTIVWMKR--GSGVVLSNENLLTLKSVRQ--------------------------EDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQ-TQQALHGEKGQIKCFIRSTPPPDRIAWSWKETVLESGTSGRYTVETVNTEE--GVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 525          
BLAST of NEPH-1 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 72.4034 bits (176), Expect = 1.763e-12
Identity = 116/560 (20.71%), Postives = 198/560 (35.36%), Query Frame = 3
Query:  378 VQWQKDGFGYENETLRDHFNG--RYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIELIPPVETPMIFIIG 2048
            V W KDG        RD  +G  RY + G   +G + L I  V+  DD  + CQ   A+     ++   LTV+VPPD   +                   +     + L L+C    ++PA  ++W      +R G+   ++G        +    +S     Y S S++         G+ + C  +N+        K A + +++  +  V + V P        E  +++  CSA  NP   +Y W K     K  +   Y       ++ V        + C+V + L       N      +Y                      R+   P  L   L + A F       +C    NP   I W K    S  +++N +L+  +++++                          ++ G ++C A+       +K V +     P I + Q    A  G   +I C I S P PD+    W + +       +   +    E   GV+S L +  +   D+ T YNC+  N +G  +  I L      P+  IIG
Sbjct:  118 VLWIKDGLALG--VGRD-LSGYPRYTVIGDHGSGEHHLRIQRVELMDDAVFECQ---AVQAAMRSRPARLTVLVPPDDPVIGGGPV--------------VSLRAGDPLNLTCHADNAKPAASIIW------MRNGEV--LNGAMYSKALVRDGRRESTVSTLYLSPSNI-------ETGQQIICRASNKAV---PNGKEASVTIDIQHLPLVNLSVEPQ----AVLEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTY-------EVIVDHSFFTEPVSCEVTNSLGSTNVSRNVD----VYFGP-------------------RMAAEPQSLQVDLGSDAVF-------NCAWTGNPSLTIVWMKR--GSGVVLSNENLLTLKSVRQ--------------------------EDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQ-TQQALHGEKGQIKCFIRSTPPPDRIAWSWKETVLESGTSGRYTVETVNTEE--GVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 567          
BLAST of NEPH-1 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 68.1662 bits (165), Expect = 3.462e-11
Identity = 112/547 (20.48%), Postives = 193/547 (35.28%), Query Frame = 3
Query:  378 VQWQKDGFGYENETLRDHFNG--RYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGT-YNCSVSNPYGRVSSTIEL 2009
            V W KDG        RD  +G  RY + G   +G + L I  V+  DD  + CQ   A+     ++   LTV+VPPD   +                   +     + L L+C    ++PA  ++W      +R G+   ++G        +    +S     Y S S++         G+ + C  +N+        K A + +++  +  V + V P        E  +++  CSA  NP   +Y W K     K  +   Y       ++ V        + C+V + L       N      +Y                      R+   P  L   L + A F       +C    NP   I W K    S  +++N +L+  +++++                          ++ G ++C A+       +K V +     P I + Q    A  G   +I C I S P PD+    W + +       +   +    E   GV+S L +  +   D+ T YNC+  N +G  +  I L
Sbjct:   44 VLWIKDGLALG--VGRD-LSGYPRYTVIGDHGSGEHHLRIQRVELMDDAVFECQ---AVQAAMRSRPARLTVLVPPDDPVIGGGPV--------------VSLRAGDPLNLTCHADNAKPAASIIW------MRNGEV--LNGAMYSKALVRDGRRESTVSTLYLSPSNI-------ETGQQIICRASNKAV---PNGKEASVTIDIQHLPLVNLSVEPQ----AVLEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTY-------EVIVDHSFFTEPVSCEVTNSLGSTNVSRNVD----VYFGP-------------------RMAAEPQSLQVDLGSDAVF-------NCAWTGNPSLTIVWMKR--GSGVVLSNENLLTLKSVRQ--------------------------EDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQ-TQQALHGEKGQIKCFIRSTPPPDRIAWSWKETVLESGTSGRYTVETVNTEE--GVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRL 480          
BLAST of NEPH-1 vs. Planmine SMEST
Match: SMESG000074081.1 (SMESG000074081.1)

HSP 1 Score: 1871.67 bits (4847), Expect = 0.000e+0
Identity = 932/934 (99.79%), Postives = 933/934 (99.89%), Query Frame = 3
Query:  189 MLIVHGAFHIPGNLAFTSLYIYLWMVKFADNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSSXXXXXXXXXXXXXXXXXRTSKNRSTSTNQRSVYMKGHMMSPCHSPLSQENFGTGFTNAYIDGVGDFGNMDFMQMSSKNNYESTCASGPQSMINNISGIYLDSNLNYYQTNTKDMKVIPEMDQIHNHNIYQRRSEWMENHNSQIEGANESTRSYDSGVCPDESILTSCSPYHPNQSTNFGVPSCQIIPLYQSSKTDQELSQSSQNIYYPALNVSKNILSSVSLASVLYHKPIISCSNRNDYNYQFPTIKDSFIVPNIQSEVQPFDQEQYRTINNLPDLTDVREPVLPYIIAYSPTCITRKNLDWTSLNQSTKL 2990
            MLIVHGAFHIPGNLAFTSLYIYLWMVKFADNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAG+ECYSNFQ ESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQMSSYSSMTLLSISDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSSCAIALAVLFAFIIFCIIRTSKNRSTSTNQRSVYMKGHMMSPCHSPLSQENFGTGFTNAYIDGVGDFGNMDFMQMSSKNNYESTCASGPQSMINNISGIYLDSNLNYYQTNTKDMKVIPEMDQIHNHNIYQRRSEWMENHNSQIEGANESTRSYDSGVCPDESILTSCSPYHPNQSTNFGVPSCQIIPLYQSSKTDQELSQSSQNIYYPALNVSKNILSSVSLASVLYHKPIISCSNRNDYNYQFPTIKDSFIVPNIQSEVQPFDQEQYRTINNLPDLTDVREPVLPYIIAYSPTCITRKNLDWTSLNQSTKL
Sbjct:    1 MLIVHGAFHIPGNLAFTSLYIYLWMVKFADNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGQECYSNFQPESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQMSSYSSMTLLSISDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSSCAIALAVLFAFIIFCIIRTSKNRSTSTNQRSVYMKGHMMSPCHSPLSQENFGTGFTNAYIDGVGDFGNMDFMQMSSKNNYESTCASGPQSMINNISGIYLDSNLNYYQTNTKDMKVIPEMDQIHNHNIYQRRSEWMENHNSQIEGANESTRSYDSGVCPDESILTSCSPYHPNQSTNFGVPSCQIIPLYQSSKTDQELSQSSQNIYYPALNVSKNILSSVSLASVLYHKPIISCSNRNDYNYQFPTIKDSFIVPNIQSEVQPFDQEQYRTINNLPDLTDVREPVLPYIIAYSPTCITRKNLDWTSLNQSTKL 934          
BLAST of NEPH-1 vs. Planmine SMEST
Match: SMESG000022777.1 (SMESG000022777.1)

HSP 1 Score: 188.734 bits (478), Expect = 2.546e-49
Identity = 168/609 (27.59%), Postives = 270/609 (44.33%), Query Frame = 3
Query:  276 DNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETL-------RDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQ--VNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQN----IWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEV-GTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDS-ILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIW-FKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            D  ++ P      +NST  L+CRV         +V W KDGFG  N          R     R+ +P     G YDL I  ++  D+G + CQ  VN   +   +++ + + V+VP DK +L       Q N    + I+N    I  +  E+L + C  ++ RP   L W L E  +   K+G ++   + G +T  SE  ++  + Y    S L L++    NG  LKC +A    + ++       ++ V  V  V ++V P +    F E+++++  CSAS  P++  + W     T    +++    R    K+K+ R                               D+   + C     + G +   + V+Y P   DS  L   AA +G+ + ++CRAD NP   ITW   + SS E++A     G+  L+ D Q                      AD+ G +IC A    FP   K +++G+   P+I  N  +   + G S R+SC I SIP P+  +I W FKN   K +   +++++Y +     V S L+I  V   D+G YNCSVS  YG   +TI L+   ETPM+ I+G++
Sbjct:   21 DYILVHPERQVAALNSTITLKCRVKVVEK---YEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAY---SSQKVLVQVLVPSDKPQL------VQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKHGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNS-LELKIVSLKNGNWLKC-LAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAW-----TIGDESLVNI--RDPKYKLKITR------------------------------VDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITW--QRISSNEVIAR----GSILLRNDIQ----------------------ADDFGDYICKAAVKEFPERHKYIYLGEKGPPEI-KNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKN---KQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 546          
BLAST of NEPH-1 vs. Planmine SMEST
Match: SMESG000022777.1 (SMESG000022777.1)

HSP 1 Score: 188.734 bits (478), Expect = 2.740e-49
Identity = 168/609 (27.59%), Postives = 270/609 (44.33%), Query Frame = 3
Query:  276 DNQILGPVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETL-------RDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQ--VNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQN----IWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEV-GTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDS-ILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIW-FKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSS 2054
            D  ++ P      +NST  L+CRV         +V W KDGFG  N          R     R+ +P     G YDL I  ++  D+G + CQ  VN   +   +++ + + V+VP DK +L       Q N    + I+N    I  +  E+L + C  ++ RP   L W L E  +   K+G ++   + G +T  SE  ++  + Y    S L L++    NG  LKC +A    + ++       ++ V  V  V ++V P +    F E+++++  CSAS  P++  + W     T    +++    R    K+K+ R                               D+   + C     + G +   + V+Y P   DS  L   AA +G+ + ++CRAD NP   ITW   + SS E++A     G+  L+ D Q                      AD+ G +IC A    FP   K +++G+   P+I  N  +   + G S R+SC I SIP P+  +I W FKN   K +   +++++Y +     V S L+I  V   D+G YNCSVS  YG   +TI L+   ETPM+ I+G++
Sbjct:   18 DYILVHPERQVAALNSTITLKCRVKVVEK---YEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAY---SSQKVLVQVLVPSDKPQL------VQINKIGPQAIRNEKNPIIVNDGEYLHIKCIAKHGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNS-LELKIVSLKNGNWLKC-LAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAW-----TIGDESLVNI--RDPKYKLKITR------------------------------VDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITW--QRISSNEVIAR----GSILLRNDIQ----------------------ADDFGDYICKAAVKEFPERHKYIYLGEKGPPEI-KNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKN---KQLLEGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGAT 543          
BLAST of NEPH-1 vs. Planmine SMEST
Match: SMESG000077979.1 (SMESG000077979.1)

HSP 1 Score: 169.859 bits (429), Expect = 6.068e-43
Identity = 152/602 (25.25%), Postives = 257/602 (42.69%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSI----NLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQN----IWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLD---VKMDVIPHRPFFHFTEHEMIQINCSASTNPANVI-YNW-IKYNPTTKTTTIIKYF-DRSGVLKIKVRRDLNNMFIR--CQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYH-FTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGR--VSSTIELIPPVETPMIFI 2042
            P    V++     L+CR+    +   +K+QW KD FG EN T++D + GR  +PG  ++G YDL   + + QD+  Y C +   +   E  +S+    +L +I PP ++     QF   N S +  I Q     IW   N+ L  +C  +   P  +L+W                     TV T++   D+      + +++  +RL  D +   + C I N++ ++      A++ + VL++ +   ++ +    +P  +    E +  +C++   P  +I Y+W ++YN   K     +Y  +RS    I ++      F R  C + + +    C SN              N   RH A  S    L + Y P I           +G+ V L C  DSNP A I WYK+ F + +   N   +          ++  + +  +  S  YH F + +  +L ++IC A    F  + K V V +   P I   Q  I  ++     + C + S P P    I W+   +   I +  +  +  + +L GV S L+  KV   DYGTY CS S  YG+  V+  I L+P     +IFI
Sbjct:   20 PSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGF---QFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------------------TVKTETGLSDNGK---IQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHN---GEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNG--EYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRN---------CNIELRHKAVSSKS--LNILYPPKIKTPFENITVTNIGEWVVLSCEVDSNPQASIRWYKTHFGTSK---NTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFS--YGKTIVTKQIHLLPLKNKFIIFI 573          
BLAST of NEPH-1 vs. Planmine SMEST
Match: SMESG000077979.1 (SMESG000077979.1)

HSP 1 Score: 169.859 bits (429), Expect = 6.326e-43
Identity = 152/602 (25.25%), Postives = 257/602 (42.69%), Query Frame = 3
Query:  294 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSI----NLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQN----IWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLD---VKMDVIPHRPFFHFTEHEMIQINCSASTNPANVI-YNW-IKYNPTTKTTTIIKYF-DRSGVLKIKVRRDLNNMFIR--CQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQXXXXXXXXXXXXXDKYH-FTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGR--VSSTIELIPPVETPMIFI 2042
            P    V++     L+CR+    +   +K+QW KD FG EN T++D + GR  +PG  ++G YDL   + + QD+  Y C +   +   E  +S+    +L +I PP ++     QF   N S +  I Q     IW   N+ L  +C  +   P  +L+W                     TV T++   D+      + +++  +RL  D +   + C I N++ ++      A++ + VL++ +   ++ +    +P  +    E +  +C++   P  +I Y+W ++YN   K     +Y  +RS    I ++      F R  C + + +    C SN              N   RH A  S    L + Y P I           +G+ V L C  DSNP A I WYK+ F + +   N   +          ++  + +  +  S  YH F + +  +L ++IC A    F  + K V V +   P I   Q  I  ++     + C + S P P    I W+   +   I +  +  +  + +L GV S L+  KV   DYGTY CS S  YG+  V+  I L+P     +IFI
Sbjct:   33 PSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGF---QFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------------------TVKTETGLSDNGK---IQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHN---GEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNG--EYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRN---------CNIELRHKAVSSKS--LNILYPPKIKTPFENITVTNIGEWVVLSCEVDSNPQASIRWYKTHFGTSK---NTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFS--YGKTIVTKQIHLLPLKNKFIIFI 586          
The following BLAST results are available for this feature:
BLAST of NEPH-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL13.250e-1722.42kirre like nephrin family adhesion molecule 1 [Sou... [more]
NPHS14.967e-823.24NPHS1 adhesion molecule, nephrin [Source:HGNC Symb... [more]
NPHS15.693e-823.24NPHS1 adhesion molecule, nephrin [Source:HGNC Symb... [more]
KIRREL19.751e-823.29kirre like nephrin family adhesion molecule 1 [Sou... [more]
KIRREL19.933e-826.36kirre like nephrin family adhesion molecule 1 [Sou... [more]
back to top
BLAST of NEPH-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
syg-15.838e-834.43Synaptogenesis protein syg-1 [Source:UniProtKB/Sw... [more]
syg-16.249e-834.43Synaptogenesis protein syg-1 [Source:UniProtKB/Sw... [more]
unc-528.598e-623.26Basement membrane proteoglycan [Source:UniProtKB/... [more]
back to top
BLAST of NEPH-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rst8.075e-2723.59gene:FBgn0003285 transcript:FBtr0343758[more]
rst8.075e-2723.59gene:FBgn0003285 transcript:FBtr0070562[more]
kirre4.508e-2623.71gene:FBgn0028369 transcript:FBtr0332492[more]
kirre4.508e-2623.71gene:FBgn0028369 transcript:FBtr0309498[more]
kirre4.508e-2623.71gene:FBgn0028369 transcript:FBtr0070560[more]
back to top
BLAST of NEPH-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kirrel1a3.179e-2124.01kirre like nephrin family adhesion molecule 1a [So... [more]
kirrel1a3.179e-2124.01kirre like nephrin family adhesion molecule 1a [So... [more]
kirrel1b1.548e-2023.70kirre like nephrin family adhesion molecule 1b [So... [more]
kirrel1b1.776e-2023.70kirre like nephrin family adhesion molecule 1b [So... [more]
KIRREL39.611e-1120.66kirre like nephrin family adhesion molecule 3 [Sou... [more]
back to top
BLAST of NEPH-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igfbp43.720e-2424.08insulin like growth factor binding protein 4 [Sour... [more]
igfbp41.836e-2324.30insulin like growth factor binding protein 4 [Sour... [more]
igfbp41.966e-2324.34insulin like growth factor binding protein 4 [Sour... [more]
igfbp42.223e-2324.42insulin like growth factor binding protein 4 [Sour... [more]
igfbp42.439e-2224.13insulin like growth factor binding protein 4 [Sour... [more]
back to top
BLAST of NEPH-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kirrel1.174e-1522.30kirre like nephrin family adhesion molecule 1 [Sou... [more]
Kirrel1.174e-1522.30kirre like nephrin family adhesion molecule 1 [Sou... [more]
Kirrel3.010e-1522.47kirre like nephrin family adhesion molecule 1 [Sou... [more]
Kirrel23.009e-1024.45kirre like nephrin family adhesion molecule 2 [Sou... [more]
Nphs17.006e-923.17nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:18... [more]
back to top
BLAST of NEPH-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08180|ICCR_DROME8.094e-2623.59Irregular chiasm C-roughest protein OS=Drosophila ... [more]
sp|Q96J84|KIRR1_HUMAN1.561e-1622.42Kin of IRRE-like protein 1 OS=Homo sapiens OX=9606... [more]
sp|Q6X936|KIRR1_RAT6.917e-1522.30Kin of IRRE-like protein 1 OS=Rattus norvegicus OX... [more]
sp|Q80W68|KIRR1_MOUSE8.210e-1522.30Kin of IRRE-like protein 1 OS=Mus musculus OX=1009... [more]
sp|Q9QZS7|NPHN_MOUSE4.901e-823.17Nephrin OS=Mus musculus OX=10090 GN=Nphs1 PE=1 SV=... [more]
back to top
BLAST of NEPH-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJP50.000e+0100.00NEPH-1 OS=Schmidtea mediterranea OX=79327 GN=NEPH-... [more]
A0A095AEM02.922e-4826.22Irregular chiasm C-roughest protein OS=Schistosoma... [more]
A0A430QGF43.054e-4826.22Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
A0A4E0S4A96.522e-4825.00Irregular chiasm C-roughest protein OS=Fasciola he... [more]
A0A5K4F0U61.148e-4726.06Nephrin related OS=Schistosoma mansoni OX=6183 PE=... [more]
back to top
BLAST of NEPH-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kirrel1a4.537e-2024.01kirre like nephrin family adhesion molecule 1 [Sou... [more]
kirrel1b3.663e-1623.97kirre like nephrin family adhesion molecule 1b [So... [more]
KIRREL31.708e-1021.14kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL32.122e-1021.14kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel3a1.913e-724.57kirre like nephrin family adhesion molecule 3a [So... [more]
back to top
BLAST of NEPH-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NEPH-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NEPH-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NEPH-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kirrel1a2.498e-2324.33kin of IRRE-like protein 1 [Source:NCBI gene;Acc:1... [more]
KIRREL38.065e-1320.89kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL31.169e-1220.71kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL31.763e-1220.71kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL33.462e-1120.48kirre like nephrin family adhesion molecule 3 [Sou... [more]
back to top
BLAST of NEPH-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074081.10.000e+099.79SMESG000074081.1[more]
SMESG000022777.12.546e-4927.59SMESG000022777.1[more]
SMESG000022777.12.740e-4927.59SMESG000022777.1[more]
SMESG000077979.16.068e-4325.25SMESG000077979.1[more]
SMESG000077979.16.326e-4325.25SMESG000077979.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012144
GenBankAKN21714.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012144 ID=SMED30012144|Name=NEPH-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3038bp
TGCAAATGGTAAATTGTAAAATTGTTTTTGAACGAGTCATTGCCTATCAA
ATTTAGTATTTTGGAGCAGTTTCATAACCTAATTCTTATCAGTAACTCAT
CATAAATCCCTGTCGGATATAAAAGCATCAAACATCATCTATCAATATAA
TTTGATTGCTTTCAAAAGGAGAAAAGAAACAATTAAATATGTTGATAGTC
CATGGTGCTTTCCATATTCCAGGAAATTTAGCTTTTACATCATTGTACAT
TTACCTATGGATGGTGAAGTTTGCAGATAATCAGATATTGGGCCCAGTAT
CAACGTCAGTTCTCATTAATTCAACAGCTCGATTGAGATGTAGAGTAACA
TTTAACAATTCGAATACCCCTGTGAAAGTGCAGTGGCAGAAAGATGGGTT
CGGCTATGAAAATGAAACGCTAAGAGATCATTTTAATGGACGATATCAAA
TGCCAGGACCAAGAGAAACTGGAACGTACGACTTGGTTATCCACTCTGTT
GACAAACAGGATGACGGCGAATATGCGTGTCAAGTGAATGCGGCAATACA
TATTTTAGAAACAACCAAATCAATAAATCTAACCGTGATAGTACCACCAG
ATAAAATCAAATTAAAATCGTCACAATTTGATTTTCAAAACAATTCAACA
AATAATGAAATCATACAAAACATTTGGGGACATCTTAACGAATTTTTGAT
TCTTTCCTGTGAAATTCAATATTCCAGACCTGCGACAGAGCTAGTATGGA
AACTTGGAGAATTTGCGCTGCGAGAAGGAAAGTCAGGAGACATAGACGGC
CAAGAAGTCGGTACAGTGACAACAAAATCTGAATTCATGGACTCATTTGA
TCAGTTTTACTATAAAAGTGAATCACATCTTAGATTACGACTACGTAAAG
ATCATAACGGAGAAATCCTCAAGTGTACTATAGCCAATGAGCAGAGTTTC
ATGCATAAAACACCAAAACCTGCAATTATGAAATTAAATGTTTTATTTGT
TTTAGATGTAAAAATGGATGTAATTCCTCATAGACCGTTTTTTCACTTTA
CTGAGCATGAAATGATTCAGATTAATTGTTCAGCATCTACAAATCCGGCA
AATGTCATTTATAACTGGATCAAATACAATCCAACTACCAAAACAACTAC
AATTATTAAATATTTCGATAGGTCTGGAGTTTTGAAAATAAAAGTTAGAC
GAGATTTAAACAACATGTTTATTCGATGCCAAGTTCTGTCAGTTTTAGCT
GGGAAAGAGTGCTATAGCAATTTTCAGGCCGAATCCATAATATATGATAA
TTCTTATTTGGTAAACTGTTCTGAAAGACATACGGCAAACGGCAGTAGTC
AAATAATTCTTCGAGTGCAATATTCTCCTATAATTCTTGATTCAATTCTT
GAAACCAAAGCTGCATTTCTTGGTGATGTTGTAACATTGGATTGCCGGGC
GGACTCAAATCCTCCGGCAAAAATAACTTGGTATAAATCAAAGTTTTCAT
CAAAAGAAATCATGGCAAATCCTGATTTGGTCGGCGCTCGAAATCTGCAA
AAAGATACCCAAATGTCCTCGTACTCATCAATGACTTTGCTATCAATATC
AGATAAATATCATTTCACCATTACAGATGCGGATAATCTTGGTTTATTTA
TTTGTATTGCCCTCACCGACGGTTTTCCACCAGTACAGAAAACTGTTTTT
GTTGGACAGGGTGCTACTCCACAAATTGTAAACAACCAGAAAATAATAAT
CGCAAAATCAGGATTATCGGTGAGAATTTCTTGTCATATAATCAGCATTC
CTTTGCCCGATAAAGGGAAAATAATTTGGTTTAAAAACTTGAATACCAAA
CCAATTGAGGCCAAATCAAAAAATCAGATTTATGAGGAAGAACGGTTGGC
AGGCGTTGTTAGCTATTTATATATTCACAAGGTAACTTATGAGGATTATG
GAACTTACAACTGTTCAGTATCAAACCCTTATGGACGTGTTTCTTCGACG
ATTGAATTGATTCCTCCTGTTGAGACTCCAATGATTTTTATAATTGGAAG
CTCATGTGCCATCGCATTAGCTGTATTATTCGCCTTCATCATATTCTGCA
TAATAAGAACCTCCAAAAATCGATCAACTTCTACAAACCAACGTTCAGTG
TATATGAAAGGTCATATGATGTCTCCTTGTCATTCTCCACTGAGCCAGGA
AAACTTTGGAACTGGCTTTACTAATGCTTATATTGACGGAGTTGGGGATT
TTGGAAATATGGACTTCATGCAAATGTCTTCAAAGAACAATTATGAATCT
ACATGTGCCAGTGGACCTCAATCTATGATTAATAACATATCTGGAATATA
TTTAGATTCTAATCTTAATTATTATCAAACAAACACCAAAGATATGAAAG
TGATTCCAGAAATGGATCAAATTCATAATCACAATATTTATCAAAGGCGC
TCAGAATGGATGGAAAATCACAATTCACAGATAGAAGGTGCAAATGAGAG
TACCAGATCCTATGACAGTGGCGTATGTCCAGATGAAAGTATATTAACTT
CCTGTAGCCCCTATCATCCTAATCAGTCAACAAATTTCGGCGTACCATCC
TGTCAAATAATTCCATTATATCAATCGTCAAAGACTGATCAAGAATTATC
ACAGAGTTCACAAAATATTTACTATCCTGCACTTAATGTGTCAAAAAATA
TTTTATCATCGGTTTCGCTGGCATCAGTATTGTATCACAAACCAATTATT
AGTTGTTCAAATCGAAATGATTACAATTATCAGTTTCCAACCATAAAGGA
CTCATTTATTGTACCAAATATTCAATCTGAAGTTCAACCTTTCGATCAAG
AACAATACAGAACAATAAATAATTTACCGGATTTAACAGACGTCCGTGAA
CCTGTTCTGCCGTATATTATAGCGTATTCTCCAACATGTATAACTCGTAA
AAATCTCGACTGGACCTCACTAAATCAGAGTACAAAACTATAATATTATT
TTTCATGAATTATTGTAAAATAATAGATAATTTGAAGT
back to top

protein sequence of SMED30012144-orf-1

>SMED30012144-orf-1 ID=SMED30012144-orf-1|Name=SMED30012144-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=935bp
MLIVHGAFHIPGNLAFTSLYIYLWMVKFADNQILGPVSTSVLINSTARLR
CRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLV
IHSVDKQDDGEYACQVNAAIHILETTKSINLTVIVPPDKIKLKSSQFDFQ
NNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSG
DIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIAN
EQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSAS
TNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVL
SVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIIL
DSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGA
RNLQKDTQMSSYSSMTLLSISDKYHFTITDADNLGLFICIALTDGFPPVQ
KTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKN
LNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGR
VSSTIELIPPVETPMIFIIGSSCAIALAVLFAFIIFCIIRTSKNRSTSTN
QRSVYMKGHMMSPCHSPLSQENFGTGFTNAYIDGVGDFGNMDFMQMSSKN
NYESTCASGPQSMINNISGIYLDSNLNYYQTNTKDMKVIPEMDQIHNHNI
YQRRSEWMENHNSQIEGANESTRSYDSGVCPDESILTSCSPYHPNQSTNF
GVPSCQIIPLYQSSKTDQELSQSSQNIYYPALNVSKNILSSVSLASVLYH
KPIISCSNRNDYNYQFPTIKDSFIVPNIQSEVQPFDQEQYRTINNLPDLT
DVREPVLPYIIAYSPTCITRKNLDWTSLNQSTKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003598Ig_sub2
IPR013106Ig_V-set
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR013151Immunoglobulin
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013106Immunoglobulin V-set domainSMARTSM00406igv1_8coord: 46..116
e-value: 0.14
score: 13.3
coord: 527..594
e-value: 0.1
score: 14.7
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 42..121
e-value: 0.041
score: 20.4
coord: 410..496
e-value: 2.0
score: 4.4
coord: 523..599
e-value: 0.017
score: 24.1
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 404..504
e-value: 4.0
score: 14.9
coord: 36..134
e-value: 1.2E-10
score: 51.4
coord: 517..610
e-value: 1.1E-7
score: 41.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 30..141
e-value: 3.5E-20
score: 74.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 509..608
e-value: 1.5E-15
score: 59.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 160..271
e-value: 1.9E-6
score: 29.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 384..494
e-value: 4.7E-8
score: 35.1
IPR013151ImmunoglobulinPFAMPF00047igcoord: 36..119
e-value: 5.2E-10
score: 39.4
NoneNo IPR availablePFAMPF13927Ig_3coord: 511..596
e-value: 8.7E-10
score: 39.1
NoneNo IPR availablePANTHERPTHR11640:SF31NEPHROSIS 1, CONGENITAL, FINNISH TYPE (NEPHRIN)-RELATEDcoord: 35..661
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 35..661
NoneNo IPR availableCDDcd00096Igcoord: 528..606
e-value: 8.88332E-11
score: 56.4816
NoneNo IPR availableCDDcd00096Igcoord: 47..116
e-value: 2.69476E-6
score: 43.7701
NoneNo IPR availableTMHMMTMhelixcoord: 617..639
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 44..130
score: 10.753
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 397..504
score: 9.41
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 511..608
score: 12.277
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 261..349
score: 6.542
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 35..139
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 391..607