Tumor necrosis factor alpha-induced protein 8

Overview
NameTumor necrosis factor alpha-induced protein 8
Smed IDSMED30012143
Length (bp)916
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tumor necrosis factor alpha-induced protein 8 (SMED30012143) t-SNE clustered cells

Violin plots show distribution of expression levels for Tumor necrosis factor alpha-induced protein 8 (SMED30012143) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tumor necrosis factor alpha-induced protein 8 (SMED30012143) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tumor necrosis factor alpha-induced protein 8 (SMED30012143) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012143

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012143SMESG000023256.1 SmedASXL_007903SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30012143SMESG000023256.1 dd_Smed_v4_6451_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30012143SMESG000023256.1 dd_Smed_v4_6451_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal cellSMED30012143SMESG000023256.1 dd_Smed_v4_6451_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30012143SMESG000023256.1 dd_Smed_v6_6451_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30012143SMESG000023256.1 OX_Smed_1.0.04537ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Human
Match: TNFAIP8L1 (TNF alpha induced protein 8 like 1 [Source:HGNC Symbol;Acc:HGNC:28279])

HSP 1 Score: 83.9593 bits (206), Expect = 7.061e-19
Identity = 53/187 (28.34%), Postives = 99/187 (52.94%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            D F++++++++ QKKL SK+++K +V   +D+TS+ V + L    R F  S+KEA K++K +VK+  KL +L     L   ++ +L + R+    +A   ++ H+  +  T +   L     +C + +      +LT KS  +I        D +FL  ++   EPY   + +ICE +  ++D G L
Sbjct:    2 DTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDF--TFDRRVLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Human
Match: TNFAIP8L1 (TNF alpha induced protein 8 like 1 [Source:HGNC Symbol;Acc:HGNC:28279])

HSP 1 Score: 83.9593 bits (206), Expect = 7.061e-19
Identity = 53/187 (28.34%), Postives = 99/187 (52.94%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            D F++++++++ QKKL SK+++K +V   +D+TS+ V + L    R F  S+KEA K++K +VK+  KL +L     L   ++ +L + R+    +A   ++ H+  +  T +   L     +C + +      +LT KS  +I        D +FL  ++   EPY   + +ICE +  ++D G L
Sbjct:    2 DTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDF--TFDRRVLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Human
Match: TNFAIP8L3 (TNF alpha induced protein 8 like 3 [Source:HGNC Symbol;Acc:HGNC:20620])

HSP 1 Score: 82.0333 bits (201), Expect = 5.110e-18
Identity = 58/206 (28.16%), Postives = 113/206 (54.85%), Query Frame = 1
Query:  127 MTDKKTQNSEPESIEE---DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            M     + SE E +     D F+S++++++ QKK+ SK+++K +    ID+TS+ +F+ L  + +    +KKEA+K+MK ++K+  K+ IL+ N   S  ++ I+ K R    + A   ++ +  +Y  T + + L     +C + +  + + +LT ++  +I    N F D EFL T++S        +++ICE I +L+D  +L
Sbjct:    1 MDSDSGEQSEGEPVTAAGPDVFSSKSLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTKEHTHNKKEAHKIMKDLIKVAIKIGILYRNNQFSQEELVIVEKFRKKLNQTAMTIVSFYEVEY--TFDRNVLSNLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYSLDGDCRPNLKRICEGINKLLDEKVL 204          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Human
Match: TNFAIP8 (TNF alpha induced protein 8 [Source:HGNC Symbol;Acc:HGNC:17260])

HSP 1 Score: 80.4925 bits (197), Expect = 1.526e-17
Identity = 53/197 (26.90%), Postives = 108/197 (54.82%), Query Frame = 1
Query:  142 TQNSEPESIEEDHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGF---MEKICEDIQELID 723
            ++  E + +  D FNS+ ++++ QKK+  K+ +K +    ID+TS+ V + L  + R +  +KKEA K++K ++K   KLAIL+ N   +  ++ ++ K +    ++A   ++ H+  Y  T + + L     +C   +  I + +LT KS  ++    + F D EFL  +++   P+  F   ++K+C+ I +++D
Sbjct:    3 SEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDY--TFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYN---PFGNFKPHLQKLCDGINKMLD 194          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Human
Match: TNFAIP8 (TNF alpha induced protein 8 [Source:HGNC Symbol;Acc:HGNC:17260])

HSP 1 Score: 80.4925 bits (197), Expect = 1.526e-17
Identity = 53/197 (26.90%), Postives = 108/197 (54.82%), Query Frame = 1
Query:  142 TQNSEPESIEEDHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGF---MEKICEDIQELID 723
            ++  E + +  D FNS+ ++++ QKK+  K+ +K +    ID+TS+ V + L  + R +  +KKEA K++K ++K   KLAIL+ N   +  ++ ++ K +    ++A   ++ H+  Y  T + + L     +C   +  I + +LT KS  ++    + F D EFL  +++   P+  F   ++K+C+ I +++D
Sbjct:    3 SEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDY--TFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYN---PFGNFKPHLQKLCDGINKMLD 194          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Fly
Match: sigmar (gene:FBgn0034894 transcript:FBtr0072096)

HSP 1 Score: 54.6842 bits (130), Expect = 1.021e-8
Identity = 54/183 (29.51%), Postives = 94/183 (51.37%), Query Frame = 1
Query:  181 FNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRG 729
            F S  I ++ QKK+ S+++TK + K FID T+A + +NL  L +   G+K +A KL+K ++KI  K+ +L  N   S+ +++     +  F       ++ +   +  T +L  L +   +   ++  I + +LTEKS  +I    +FF ++  L T F    PY   M KI  DI   ++ G
Sbjct:    6 FKSHDIGLRAQKKILSRMATKNIAKTFIDGTTASLLDNLYRLCKMHTGNKAKAEKLIKNIIKIVIKIGVLHRNNQFSDEELQKAELFKRKFQNTQLSIISFYEVDF--TFDLPYLQKSIAESQVALKSIVQPHLTEKSLGRIDEVFDFFGEEALLETAFRPDSPYREVMGKIVADINAAMETG 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Fly
Match: sigmar (gene:FBgn0034894 transcript:FBtr0072098)

HSP 1 Score: 54.6842 bits (130), Expect = 1.021e-8
Identity = 54/183 (29.51%), Postives = 94/183 (51.37%), Query Frame = 1
Query:  181 FNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRG 729
            F S  I ++ QKK+ S+++TK + K FID T+A + +NL  L +   G+K +A KL+K ++KI  K+ +L  N   S+ +++     +  F       ++ +   +  T +L  L +   +   ++  I + +LTEKS  +I    +FF ++  L T F    PY   M KI  DI   ++ G
Sbjct:    6 FKSHDIGLRAQKKILSRMATKNIAKTFIDGTTASLLDNLYRLCKMHTGNKAKAEKLIKNIIKIVIKIGVLHRNNQFSDEELQKAELFKRKFQNTQLSIISFYEVDF--TFDLPYLQKSIAESQVALKSIVQPHLTEKSLGRIDEVFDFFGEEALLETAFRPDSPYREVMGKIVADINAAMETG 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Fly
Match: sigmar (gene:FBgn0034894 transcript:FBtr0072097)

HSP 1 Score: 55.0694 bits (131), Expect = 1.156e-8
Identity = 55/190 (28.95%), Postives = 98/190 (51.58%), Query Frame = 1
Query:  160 ESIEEDHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRG 729
            E + ++ F S  I ++ QKK+ S+++TK + K FID T+A + +NL  L +   G+K +A KL+K ++KI  K+ +L  N   S+ +++     +  F       ++ +   +  T +L  L +   +   ++  I + +LTEKS  +I    +FF ++  L T F    PY   M KI  DI   ++ G
Sbjct:   21 EVMADNVFKSHDIGLRAQKKILSRMATKNIAKTFIDGTTASLLDNLYRLCKMHTGNKAKAEKLIKNIIKIVIKIGVLHRNNQFSDEELQKAELFKRKFQNTQLSIISFYEVDF--TFDLPYLQKSIAESQVALKSIVQPHLTEKSLGRIDEVFDFFGEEALLETAFRPDSPYREVMGKIVADINAAMETG 208          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Zebrafish
Match: tnfaip8l1 (tumor necrosis factor, alpha-induced protein 8-like 1 [Source:NCBI gene;Acc:393303])

HSP 1 Score: 88.1965 bits (217), Expect = 1.309e-20
Identity = 54/187 (28.88%), Postives = 105/187 (56.15%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            D F+++ ++++ QKKL SK++TK +   FID+TS+ V + L  + + +  ++KEA K++K ++K+  KL +L+ NG  +N ++ ++ + R     +A   ++ ++  +  T +   +      C   +      +LT KS  +I    N F D +FL T++   E Y G ++KICE + +++D G L
Sbjct:    2 DSFSTKNLALQAQKKLMSKMATKTVANLFIDDTSSEVLDELYRVTKEYTRNRKEAQKIIKNLIKMVVKLGVLYRNGQFNNEELALVERFRKKVHTLAMTAVSFYQIDF--TFDRRVMSNLLNDCRELLHQAINRHLTAKSHARINHVFNHFADCDFLATLYGPSEVYRGHLQKICEGVNKMLDEGNL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Zebrafish
Match: tnfaip8l1 (tumor necrosis factor, alpha-induced protein 8-like 1 [Source:NCBI gene;Acc:393303])

HSP 1 Score: 88.1965 bits (217), Expect = 1.309e-20
Identity = 54/187 (28.88%), Postives = 105/187 (56.15%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            D F+++ ++++ QKKL SK++TK +   FID+TS+ V + L  + + +  ++KEA K++K ++K+  KL +L+ NG  +N ++ ++ + R     +A   ++ ++  +  T +   +      C   +      +LT KS  +I    N F D +FL T++   E Y G ++KICE + +++D G L
Sbjct:    2 DSFSTKNLALQAQKKLMSKMATKTVANLFIDDTSSEVLDELYRVTKEYTRNRKEAQKIIKNLIKMVVKLGVLYRNGQFNNEELALVERFRKKVHTLAMTAVSFYQIDF--TFDRRVMSNLLNDCRELLHQAINRHLTAKSHARINHVFNHFADCDFLATLYGPSEVYRGHLQKICEGVNKMLDEGNL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Zebrafish
Match: tnfaip8l3 (tumor necrosis factor, alpha-induced protein 8-like 3 [Source:NCBI gene;Acc:393322])

HSP 1 Score: 87.8113 bits (216), Expect = 2.705e-20
Identity = 58/202 (28.71%), Postives = 109/202 (53.96%), Query Frame = 1
Query:  130 TDKKTQNSEPESIEEDHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            +D   Q+    S   + FNS++++++ QKK+ SK++T  +     D+TS+ + + L    R +  SKKEA+K++K V+KI  K+ IL+ N   S  ++E + + +    + A   ++ +  +Y  T +   L E   +C + +  + +++LT +S  +I    N F D +FL  ++   E Y   + KIC+ I +L+D G L
Sbjct:    3 SDSGEQSEGELSPGHESFNSKSLALQAQKKILSKMATMAVANLLTDDTSSEILDELYKASREYTKSKKEAHKIIKDVIKIALKIGILYRNHQFSPEEMETVERFKKKMNQAAMTVVSFYEVEY--TFDRGILSELLLECRDLLHELVEHHLTMRSHGRIDHVFNHFADVDFLTELYGPSEDYRLNLRKICDGINKLLDEGTL 202          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Zebrafish
Match: CR407586.1 (pep chromosome:GRCz11:CHR_ALT_CTG18_1_44:39521878:39524417:-1 gene:ENSDARG00000111865.1 transcript:ENSDART00000187129.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR407586.1)

HSP 1 Score: 86.6557 bits (213), Expect = 5.100e-20
Identity = 55/185 (29.73%), Postives = 103/185 (55.68%), Query Frame = 1
Query:  181 FNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            FNS++++++ QKK+ SK++T  +     D+TS+ + + L    R +  SKKEA+K++K V+KI  K+ IL+ N   S  ++E + + +    + A   ++ +  +Y  T +   L E   +C + +  + +++LT +S  +I    N F D +FL  ++   E Y   + KIC+ I +L+D G L
Sbjct:   12 FNSKSLALQAQKKILSKMATMAVANLLTDDTSSEILDELYKASREYTKSKKEAHKIIKDVIKIALKIGILYRNHQFSPEEMETVERFKKKMNQAAMTVVSFYEVEY--TFDRGILSELLLECRDLLHELVEHHLTMRSHGRIDHVFNHFADVDFLTELYGPSEDYRLNLRKICDGINKLLDEGTL 194          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Zebrafish
Match: tnfaip8l2a (tumor necrosis factor, alpha-induced protein 8-like 2a [Source:NCBI gene;Acc:723996])

HSP 1 Score: 65.4698 bits (158), Expect = 2.167e-12
Identity = 45/185 (24.32%), Postives = 96/185 (51.89%), Query Frame = 1
Query:  181 FNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            F+S+ ++++ QKK+ S++++K + + FID+ S+ V + L  + +   G++ EA K++K ++KI  K+ +LF +   S  ++ I  + R      A   ++    ++  T +   +I     C + ++ + + +LT KS  +I    N + + E L  ++  Q      + KIC  +  +I+ G L
Sbjct:    4 FSSKDMAMQAQKKILSRMASKSVAQMFIDDNSSEVLDELYRVSKEHSGNRAEAQKVVKNMIKIAVKVGVLFRHEKFSAEELSIAQEFRKKLHHGAMTAISFQEVEF--TFDKSVMINLLSDCRDLLLKLVEKHLTPKSLDRIRHVFNHYSNPELLTHLYDPQGNLWSNLSKICSGLNRMIEEGKL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Xenopus
Match: TNFAIP8L3 (TNF alpha induced protein 8 like 3 [Source:NCBI gene;Acc:100494749])

HSP 1 Score: 84.3445 bits (207), Expect = 7.749e-19
Identity = 53/185 (28.65%), Postives = 106/185 (57.30%), Query Frame = 1
Query:  181 FNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            F+S++ +++ QKK+ SK++TK +    ID+TS+ +F+ L  + + +  +KKEA+K++K +VK+  K+ IL+ N   S  +++I+ K R    +     ++ +  +Y  T + + L     +C   +  + + +LT KS  +I    N F D EFL  ++S +  Y  ++++IC  + +L+D  +L
Sbjct:   20 FSSKSFAVQAQKKILSKMATKTMANMLIDDTSSEIFDELFKVTKEYVKNKKEAHKVLKDLVKVAVKVGILYRNNQFSAEELKIVEKFRKKLNQACMTAISFYEVEY--TFDKNVLSGLLHECKTLLHELVQRHLTPKSHSRIDRVFNHFADVEFLTALYSLEGNYRPYLKRICGGVNKLLDERVL 202          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Xenopus
Match: tnfaip8 (TNF alpha induced protein 8 [Source:NCBI gene;Acc:549938])

HSP 1 Score: 75.8702 bits (185), Expect = 8.188e-16
Identity = 48/195 (24.62%), Postives = 108/195 (55.38%), Query Frame = 1
Query:  142 TQNSEPESIEEDHFNSQTISIKVQXXXXXXXXXXXX-XXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELID 723
            +++ E   +  D F+S+ ++++ QKK+  K+++ K      ID+TS  V + L  L R +  SKKE+ K++K ++K   KLA+L+ N   +  +I ++ K +    ++A   ++ ++ +Y  T + + L +   +C   +  + + +LT KS  ++    + F + EFL  +++   P+   ++++CE + +++D
Sbjct:    3 SESDESRDVATDVFSSKNLAVQAQKKILGKMASSKYIATSLIDDTSGEVLDELYQLTREYTQSKKESEKVIKNLIKTVIKLAVLYRNNQFNEEEIALMEKFKRKVHQLAMTVVSFYQVEY--TFDRNVLSKLLNECRELLHQVIQRHLTAKSHGRVNNVFDHFSNCEFLAALYNPFGPFKQHLQRLCEGVNKMLD 195          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Xenopus
Match: tnfaip8l2 (TNF alpha induced protein 8 like 2 [Source:NCBI gene;Acc:595002])

HSP 1 Score: 74.3294 bits (181), Expect = 1.894e-15
Identity = 49/185 (26.49%), Postives = 101/185 (54.59%), Query Frame = 1
Query:  181 FNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            F+S+ ++++ QKK+ S++++K +V  FIDETS+ + + L  + + +  +K E+ K++K ++KI  K+ +LF +   S  ++ +    ++     A   ++ +  ++  T   D L +   +C N ++ + + +LT KS  +I    N F D E L  ++  +      ++KIC  + +LID G L
Sbjct:    4 FSSKDLALQAQKKILSRMASKSMVNMFIDETSSEILDELYRVSKEYTKNKSESQKVIKNLIKIAVKIGVLFRHNRFSPEELVLAQDFKSKLHNGAMTAISFYEVEF--TFEKDVLPDILMECKNLLLRLVEKHLTPKSHGRIQHVFNHFADPEMLCQLYDPKGSLWPHLQKICHGLNKLIDEGKL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Xenopus
Match: tnfaip8 (TNF alpha induced protein 8 [Source:NCBI gene;Acc:549938])

HSP 1 Score: 73.1738 bits (178), Expect = 5.312e-15
Identity = 39/155 (25.16%), Postives = 85/155 (54.84%), Query Frame = 1
Query:  259 FIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELID 723
             ID+TS  V + L  L R +  SKKE+ K++K ++K   KLA+L+ N   +  +I ++ K +    ++A   ++ ++ +Y  T + + L +   +C   +  + + +LT KS  ++    + F + EFL  +++   P+   ++++CE + +++D
Sbjct:   33 LIDDTSGEVLDELYQLTREYTQSKKESEKVIKNLIKTVIKLAVLYRNNQFNEEEIALMEKFKRKVHQLAMTVVSFYQVEY--TFDRNVLSKLLNECRELLHQVIQRHLTAKSHGRVNNVFDHFSNCEFLAALYNPFGPFKQHLQRLCEGVNKMLD 185          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Xenopus
Match: tnfaip8l2 (TNF alpha induced protein 8 like 2 [Source:NCBI gene;Acc:595002])

HSP 1 Score: 73.9442 bits (180), Expect = 7.845e-15
Identity = 49/185 (26.49%), Postives = 101/185 (54.59%), Query Frame = 1
Query:  181 FNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            F+S+ ++++ QKK+ S++++K +V  FIDETS+ + + L  + + +  +K E+ K++K ++KI  K+ +LF +   S  ++ +    ++     A   ++ +  ++  T   D L +   +C N ++ + + +LT KS  +I    N F D E L  ++  +      ++KIC  + +LID G L
Sbjct:   62 FSSKDLALQAQKKILSRMASKSMVNMFIDETSSEILDELYRVSKEYTKNKSESQKVIKNLIKIAVKIGVLFRHNRFSPEELVLAQDFKSKLHNGAMTAISFYEVEF--TFEKDVLPDILMECKNLLLRLVEKHLTPKSHGRIQHVFNHFADPEMLCQLYDPKGSLWPHLQKICHGLNKLIDEGKL 244          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Mouse
Match: Tnfaip8l1 (tumor necrosis factor, alpha-induced protein 8-like 1 [Source:MGI Symbol;Acc:MGI:1913693])

HSP 1 Score: 80.8777 bits (198), Expect = 6.255e-18
Identity = 52/185 (28.11%), Postives = 102/185 (55.14%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRG 729
            D F++++++++ QKK+ SK+++K +V  F+D TS+ V + L    + F  S+KEA +++K +VK+  KLA+L     L ++++  L + R     +A   L+ H+  +  T +   L     +C + +      +LT KS  +I    + F + +FL  ++S  EPY   + +IC+ +  ++D G
Sbjct:    2 DTFSTKSLALQAQKKVLSKMASKAMVAVFVDNTSSEVLDELYQATKEFTRSRKEAQRVVKNLVKVAVKLAVLLRADQLDSNELAQLQRFRGRVRSLAMTALSFHQVDF--TFDRRVLATGLLECRDLLHQAIGPHLTAKSHGRINHIFSHFANGDFLAALYSPAEPYRSHLCRICDGLGRMLDEG 184          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Mouse
Match: Tnfaip8l3 (tumor necrosis factor, alpha-induced protein 8-like 3 [Source:MGI Symbol;Acc:MGI:2685363])

HSP 1 Score: 80.4925 bits (197), Expect = 1.282e-17
Identity = 55/196 (28.06%), Postives = 107/196 (54.59%), Query Frame = 1
Query:  151 SEPESIEEDH-FNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
             EP +    H F+S+ ++++ QKK+ SK+++K +    ID+TS+ +F+ L  +      +KKEA+K+MK  +K+  K+ IL+ N   S  ++ I+ K R    + A   ++ +  +Y  T + + L +   +C + +  + + +LT ++  +I    N F D EFL T++         +++ICE I +L+D  +L
Sbjct:   11 GEPGTAAGPHVFSSKNLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTEIHTHNKKEAHKIMKDAIKVAIKIGILYRNKQFSQEEVIIVEKLRKKLNQTAMTMVSFYEVEY--TFDTNVLSKLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYGPHGNCRPNLKRICEGINKLLDDKIL 204          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Mouse
Match: Tnfaip8 (tumor necrosis factor, alpha-induced protein 8 [Source:MGI Symbol;Acc:MGI:2147191])

HSP 1 Score: 78.9518 bits (193), Expect = 6.516e-17
Identity = 50/204 (24.51%), Postives = 110/204 (53.92%), Query Frame = 1
Query:  112 IKPTNMTDKKTQNSEPESIEEDHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELID 723
            + P +M    ++  EP  +  D FNS+ ++++ QKK+  K+ +K +    ID+TS+ V + L  + + +  +KKEA +++K ++K   KLA+L  N   +  ++ ++ K +    ++A   ++ H+ +Y  T + + L     +C   +  I + +LT KS  ++    + F D +FL  +++    +   ++K+C+ I +++D
Sbjct:   10 VHPDSML---SEAEEPREVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVEY--TFDRNVLSRLLNECRELLHEIIQRHLTAKSHGRVNNVFDHFSDCDFLAALYNPFGKFKPHLQKLCDGINKMLD 208          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Mouse
Match: Tnfaip8 (tumor necrosis factor, alpha-induced protein 8 [Source:MGI Symbol;Acc:MGI:2147191])

HSP 1 Score: 77.0258 bits (188), Expect = 2.847e-16
Identity = 49/194 (25.26%), Postives = 106/194 (54.64%), Query Frame = 1
Query:  142 TQNSEPESIEEDHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELID 723
            T + E  S+  D FNS+ ++++ QKK+  K+ +K +    ID+TS+ V + L  + + +  +KKEA +++K ++K   KLA+L  N   +  ++ ++ K +    ++A   ++ H+ +Y  T + + L     +C   +  I + +LT KS  ++    + F D +FL  +++    +   ++K+C+ I +++D
Sbjct:   17 TSHGEVTSVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVEY--TFDRNVLSRLLNECRELLHEIIQRHLTAKSHGRVNNVFDHFSDCDFLAALYNPFGKFKPHLQKLCDGINKMLD 208          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Mouse
Match: Tnfaip8 (tumor necrosis factor, alpha-induced protein 8 [Source:MGI Symbol;Acc:MGI:2147191])

HSP 1 Score: 72.4034 bits (176), Expect = 8.025e-15
Identity = 46/183 (25.14%), Postives = 101/183 (55.19%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELID 723
            D FNS+ ++++ QKK+  K+ +K +    ID+TS+ V + L  + + +  +KKEA +++K ++K   KLA+L  N   +  ++ ++ K +    ++A   ++ H+ +Y  T + + L     +C   +  I + +LT KS  ++    + F D +FL  +++    +   ++K+C+ I +++D
Sbjct:    4 DVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAERVIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVEY--TFDRNVLSRLLNECRELLHEIIQRHLTAKSHGRVNNVFDHFSDCDFLAALYNPFGKFKPHLQKLCDGINKMLD 184          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. UniProt/SwissProt
Match: sp|Q7SZE8|TP8L1_DANRE (Tumor necrosis factor alpha-induced protein 8-like protein 1 OS=Danio rerio OX=7955 GN=tnfaip8l1 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 9.883e-20
Identity = 54/187 (28.88%), Postives = 105/187 (56.15%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            D F+++ ++++ QKKL SK++TK +   FID+TS+ V + L  + + +  ++KEA K++K ++K+  KL +L+ NG  +N ++ ++ + R     +A   ++ ++  +  T +   +      C   +      +LT KS  +I    N F D +FL T++   E Y G ++KICE + +++D G L
Sbjct:    2 DSFSTKNLALQAQKKLMSKMATKTVANLFIDDTSSEVLDELYRVTKEYTRNRKEAQKIIKNLIKMVVKLGVLYRNGQFNNEELALVERFRKKVHTLAMTAVSFYQIDF--TFDRRVMSNLLNDCRELLHQAINRHLTAKSHARINHVFNHFADCDFLATLYGPSEVYRGHLQKICEGVNKMLDEGNL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. UniProt/SwissProt
Match: sp|A5PK29|TP8L1_BOVIN (Tumor necrosis factor alpha-induced protein 8-like protein 1 OS=Bos taurus OX=9913 GN=TNFAIP8L1 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.721e-19
Identity = 53/183 (28.96%), Postives = 99/183 (54.10%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELID 723
            D F++++++++ QKKL SK++++ +   FID+TS+ V + L    + F  S+KEA KL+K +VK+  KL +L   G L   ++  L + R    ++A   ++ H+  +  T +   L     +C + +   A  +LT KS  +I        D +FL  ++S  EPY   + +IC+ +  ++D
Sbjct:    2 DTFSTKSLALQAQKKLLSKMASRAVASAFIDDTSSEVLDELYRATKEFTRSRKEAQKLVKNLVKVAVKLGVLLRAGQLGAEELARLQRLRQQARRLAMTAVSFHQVDF--TFDRRVLATTLLECRDLLHQAAGAHLTAKSHGRINHVFGHLADCDFLAALYSPAEPYRSHLRRICDGLTRMLD 182          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. UniProt/SwissProt
Match: sp|Q7T3D0|TP8L3_DANRE (Tumor necrosis factor alpha-induced protein 8-like protein 3 OS=Danio rerio OX=7955 GN=tnfaip8l3 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 2.042e-19
Identity = 58/202 (28.71%), Postives = 109/202 (53.96%), Query Frame = 1
Query:  130 TDKKTQNSEPESIEEDHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            +D   Q+    S   + FNS++++++ QKK+ SK++T  +     D+TS+ + + L    R +  SKKEA+K++K V+KI  K+ IL+ N   S  ++E + + +    + A   ++ +  +Y  T +   L E   +C + +  + +++LT +S  +I    N F D +FL  ++   E Y   + KIC+ I +L+D G L
Sbjct:    3 SDSGEQSEGELSPGHESFNSKSLALQAQKKILSKMATMAVANLLTDDTSSEILDELYKASREYTKSKKEAHKIIKDVIKIALKIGILYRNHQFSPEEMETVERFKKKMNQAAMTVVSFYEVEY--TFDRGILSELLLECRDLLHELVEHHLTMRSHGRIDHVFNHFADVDFLTELYGPSEDYRLNLRKICDGINKLLDEGTL 202          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. UniProt/SwissProt
Match: sp|Q5ZI78|TFIP8_CHICK (Tumor necrosis factor alpha-induced protein 8 OS=Gallus gallus OX=9031 GN=TNFAIP8 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 4.773e-19
Identity = 54/185 (29.19%), Postives = 105/185 (56.76%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRG 729
            D FNS++++I+ QKK+  K+ +K +    ID+TS+ V + L  + + +  +KKEA K++K ++KI  KLAIL+ N   +  +I ++ K +    ++A+  ++ H+  Y  T + + L +    C   +  I + +LT KS  ++    + F D EFL  +++   PY   ++K+C+ +  ++D G
Sbjct:    4 DVFNSKSLAIQAQKKILGKMVSKSIATTLIDDTSSDVLDELYRVTKEYTQNKKEAEKIIKNLIKIVLKLAILYRNNQFNQDEIALMEKFKKKVHQLAKTVVSFHQVDY--TFDRNFLSKLLNDCRELLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGPYKLHLQKLCDGVNRMLDEG 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. UniProt/SwissProt
Match: sp|Q5ZJU8|TP8L1_CHICK (Tumor necrosis factor alpha-induced protein 8-like protein 1 OS=Gallus gallus OX=9031 GN=TNFAIP8L1 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.004e-18
Identity = 50/183 (27.32%), Postives = 103/183 (56.28%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELID 723
            D F+++ ++++ QKKL SK+++K +   FID+TS+ + + L    + +  ++KEA K++K ++KI  KL +L+ NG  S  ++ ++ + R     +A   ++ H+  +  T +   +     +C + +     ++LT KS  +I    N F D EFL  ++   EPY   +++ICE + ++++
Sbjct:    2 DTFSTKNLALQAQKKLLSKMASKTVANVFIDDTSSEILDELYRATKEYTHNRKEAQKIIKNLIKIVMKLGVLYRNGQFSPEELLVMERFRKKVHTLAMTAVSFHQIDF--TFDRRVVSSVLTECRDLLHQAVSSHLTAKSHSRINHVFNHFADYEFLSALYGPAEPYRTHLKRICEGVNKMLE 182          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. TrEMBL
Match: A0A267FNY1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004618g1 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 7.498e-27
Identity = 65/185 (35.14%), Postives = 113/185 (61.08%), Query Frame = 1
Query:  181 FNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            F++Q++S++ QKKL  KL+ +K VK FID TSAR F+++  +++   GS+  A K MK +VK+N K+A+L+ + +LS S+  +  + R+ F  +A   + + R   R  ++ + L +QF  C    + + + +L+EKS   I TC++ F +  FL  +F    P    M  +C+D+QEL+DRG++
Sbjct:   35 FSAQSVSLRAQKKLIGKLANQKAVKIFIDATSARAFDSIYRIVKLHTGSRSRAQKTMKHIVKLNMKVAVLYTHDILSESEKALADQFRDRFNDLATDLVLMQRG--RRQLDKEKLAKQFRDCEAIALRMVRRHLSEKSLTSIRTCSDLFTEPRFLQALFDPSSPLAPHMTSLCQDVQELLDRGVV 217          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. TrEMBL
Match: A0A1I8GAC0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015718g1 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.007e-26
Identity = 65/185 (35.14%), Postives = 113/185 (61.08%), Query Frame = 1
Query:  181 FNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            F++Q++S++ QKKL  KL+ +K VK FID TSAR F+++  +++   GS+  A K MK +VK+N K+A+L+ + +LS S+  +  + R+ F  +A   + + R   R  ++ + L +QF  C    + + + +L+EKS   I TC++ F +  FL  +F    P    M  +C+D+QEL+DRG++
Sbjct:   35 FSAQSVSLRAQKKLIGKLANQKAVKIFIDATSARAFDSIYRIVKLHTGSRSRAQKTMKHIVKLNMKVAVLYTHDILSESEKALADQFRDRFNDLATDLVLMQRG--RRQLDKEKLAKQFRDCEAIALRMVRRHLSEKSLTSIRTCSDLFTEPRFLQALFDRSSPLAPHMTSLCQDVQELLDRGVV 217          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. TrEMBL
Match: A0A1I8J535 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 2.618e-26
Identity = 66/183 (36.07%), Postives = 112/183 (61.20%), Query Frame = 1
Query:  181 FNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRG 729
            F+SQ+ S++ QKK+ SKL+TKK VK FID  SARVF+ +  L++   GS++ A KL+K ++K+N K+ +L++N + ++ +  +    R+ F  +    + +  +  R T++   L+ QF  C   ++ + + +L+EKSQ  + TC  FF +  FL  +F    P    M+ IC+DIQ+L+DRG
Sbjct: 1641 FSSQSFSLRAQKKIVSKLATKKSVKIFIDAASARVFDKIYKLVKTHTGSRQAAQKLLKQIIKLNMKIGVLYLNDMFNDEERAMADDFRDKFNDLTTDLVRMQTR--RSTLDQASLVRQFRDCEQLVLRLIRRHLSEKSQAGVRTCATFFTEPAFLSALFDRSSPLAAQMDSICDDIQDLLDRG 1821          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. TrEMBL
Match: A0A4Z2CLV1 (Tumor necrosis factor, alpha-induced protein 8-like protein 2 A OS=Schistosoma japonicum OX=6182 GN=EWB00_009565 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 5.385e-26
Identity = 68/209 (32.54%), Postives = 122/209 (58.37%), Query Frame = 1
Query:  127 MTDKKT--QNSEPESIEEDHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDP----LIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            MT+K    QNS+      +HF+ Q+IS++ QKKL   L    +   F+D++SAR+F N+  L++ + G+ K A  L K  +K+N K  IL  N +LS+  +    +      ++A+I L + R K R    ++P    LI+   + + +++   K +++++SQ K    +NFFC +EF++ VF+++  Y+  MEKI +D++E++DRG+ 
Sbjct:    1 MTNKPVVPQNSQATEDSTEHFDPQSISLRAQKKLVGSLPKGIIK-LFLDDSSARLFENIFNLIKQYTGNNKLAAYLTKQAIKLNVKALILISNDILSDEQLNHAYEFHEKCHQIAEIALRLGRPKRRLLPGVEPSIDKLIQTMKEANQTLIEAVKQHISQQSQDKFKEFSNFFCQREFVVEVFTNKTKYSTNMEKIYDDLEEMMDRGLF 208          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. TrEMBL
Match: A0A183W8N8 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS8492 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.932e-25
Identity = 69/210 (32.86%), Postives = 122/210 (58.10%), Query Frame = 1
Query:  127 MTDKKT--QNSE-PESIEEDHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDP----LIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            MT+K    QNS+ P     + F+ Q+IS++ QKKL   L    +   F+DE+SAR+F N+  L++ + GS K A  L K  +K+N K  IL  N +LS+ ++    +      +VA+I L + R K R    ++P    LI+   + + +++   K ++++ SQ+K    ++FFC +EF++ VF+++  Y   MEKI +D+++++DRG+ 
Sbjct:    1 MTNKPVVPQNSQTPTDDTVERFDPQSISLRAQKKLVGSLPKGIIK-LFLDESSARLFENIFSLIKQYTGSSKLAAYLTKQAIKLNVKALILISNNILSDEELNHAYEFHEKCHQVAEISLRLGRPKRRLLPGVEPSIDKLIQMMKEANQTLVDAVKQHISQASQEKFKEFSDFFCQREFVVEVFTNKNKYAAHMEKIYDDLEDMMDRGLF 209          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Cavefish
Match: tnfaip8l3 (TNF alpha induced protein 8 like 3 [Source:NCBI gene;Acc:103022034])

HSP 1 Score: 90.8929 bits (224), Expect = 1.295e-21
Identity = 57/185 (30.81%), Postives = 103/185 (55.68%), Query Frame = 1
Query:  181 FNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            FNS++++++ QKK+ SK++T  +     D+TS+ + + L    R F  SKKEA+K++K V+KI  K+ IL+ N      ++E + + +    + A   ++ +  +Y  T +   L E   +C + +  + +N+LT +S  +I    N F D EFL  ++   E Y   + KIC+ I +L+D G+L
Sbjct:   20 FNSKSLALQAQKKILSKMATMAVANLLTDDTSSGILDELYKASREFTKSKKEAHKIIKDVIKIALKVGILYRNHQFGPEELETVERFKKKMNQAAMTVVSFYEVEY--TFDRSILSEMLLECRDLLHELVENHLTARSHGRIDHVFNHFADVEFLTELYGTAEDYRLSLRKICDGINKLLDEGVL 202          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Cavefish
Match: tnfaip8l1 (tumor necrosis factor, alpha-induced protein 8-like 1 [Source:NCBI gene;Acc:393303])

HSP 1 Score: 83.1889 bits (204), Expect = 8.626e-19
Identity = 43/160 (26.88%), Postives = 86/160 (53.75%), Query Frame = 1
Query:  256 FFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
             FID+TS+ V + L  + + +  ++KEA K++K ++K+  KL +L+ NG  SN ++ ++ + R     +A   ++ H+  +  T +   +      C + +      +LT KS  ++    N F D +FL T++S  E Y   +++IC+ + +++D G L
Sbjct:   30 LFIDDTSSEVLDELYRVTKEYTRNRKEAQKIIKNLIKMVVKLGVLYRNGQFSNEELVLVERFRKKVHTLAMTAVSFHQIDF--TFDRRVMSGLLNDCRDLLHQAINRHLTAKSHARVNHVFNHFADCDFLATLYSPSEVYRAHLQRICDGVNKMLDEGNL 187          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Cavefish
Match: tnfaip8l2b (TNF alpha induced protein 8 like 2 [Source:NCBI gene;Acc:103021955])

HSP 1 Score: 80.1073 bits (196), Expect = 8.675e-18
Identity = 49/187 (26.20%), Postives = 103/187 (55.08%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            ++F+S+ +++K QKK+ S ++ K +V+ FID+TS+ + + L  + + F G++ EA K++K ++K+  K+A+LF +   S  ++ +  K +    + A   ++ H  ++  T + + +      C + ++ +   +LT KS  +I    N + D E L  ++    PY   + KIC  + +L++ G L
Sbjct:    2 ENFSSKDLAMKAQKKILSNMANKSVVQMFIDDTSSEILDELYRVSKEFTGNRTEAQKVIKDLIKVVVKIAVLFRHNRFSEEELSLAQKFKKKLQQGAMTAISFHEVEF--TFDKNVMSNILTTCRDMLLKLVGTHLTPKSHGRINHVFNHYSDIELLTHLYDPDGPYKPHLTKICNGLNKLLEEGKL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Sea Lamprey
Match: tnfaip8l3 (tumor necrosis factor, alpha-induced protein 8-like 3 [Source:NCBI gene;Acc:393322])

HSP 1 Score: 75.0998 bits (183), Expect = 1.513e-16
Identity = 48/188 (25.53%), Postives = 97/188 (51.60%), Query Frame = 1
Query:  166 IEEDHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRG 729
            +E + F+S++++++ QKKL  K++T+ +  F ID+ ++ V + L    +AF   +K + K +K +VK+  KLA+L  NG  S  ++      +    +     ++ H  ++  T + D L      C   +  +  ++LTEKS  ++      F D EFL  ++  +  +   + KIC+ + +L++ G
Sbjct:    1 VEMESFSSKSLAVQAQKKLLGKMATRSVAGFLIDDAASDVLDELYRARKAFSHDRKASQKAVKDLVKVAVKLAVLARNGQFSTDELATAECFKRKLNQATLTAVSFHEVEF--TFDRDVLARTLEDCREMLHRLIGHHLTEKSHARVDNVFRSFGDGEFLAVLYGTEPAFQQHLAKICQGLNKLMEDG 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Nematostella
Match: EDO37213 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGA8])

HSP 1 Score: 60.8474 bits (146), Expect = 3.046e-11
Identity = 48/191 (25.13%), Postives = 102/191 (53.40%), Query Frame = 1
Query:  166 IEEDHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFS-DQEPYNGFMEKICEDIQELIDRGML 735
            + +  FNS++++++ QKK+  KLS+K + K  +D+T+  + + L  L +    SKKEA KL+K ++KI  K++ILF N   +  +I +  K R  F   A   ++ +   +  + +   L +   +C   +  + + +LT KS  ++    N+F +   L  +F  +++ +   ++ + + + +L++ G L
Sbjct:    1 MADGGFNSKSVALRAQKKVLGKLSSKGMAKALVDDTTGDLLDQLYKLAKMEASSKKEAEKLIKDLIKIVVKISILFRNNQFNKEEIMLAEKFRKNFKSAAMTFISFYEVDF--SFDRQFLSKSLCECQALLHQLIERHLTSKSHGRVDHVFNYFANGALLERLFDPNEQAFRVILKNMVDGLNKLMEDGSL 189          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Medaka
Match: tnfaip8l3 (TNF alpha induced protein 8 like 3 [Source:NCBI gene;Acc:101174899])

HSP 1 Score: 94.3597 bits (233), Expect = 7.178e-23
Identity = 59/202 (29.21%), Postives = 112/202 (55.45%), Query Frame = 1
Query:  130 TDKKTQNSEPESIEEDHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            +D   Q+    S+ ++ FNS++++++ QKK+ SK++T  +     D+TS+ + + L  + R F  SKKEA+K++K V+KI+ K+ IL+ N   S  +++ + + +    + A   ++ +  +Y  T + + L E   +C + +  + + +LT +S  +I    N F   EFL  ++ D E Y   + KIC  I +L+D G L
Sbjct:    3 SDSGEQSDGDISVGQESFNSRSLALQAQKKILSKMATMVVANMLTDDTSSEILDELYKVSREFTKSKKEAHKIIKDVIKISLKIGILYRNHQFSQEELDTVERFKKKMNQAAMTAVSFYEVEY--TFDRNILSELLFECRDLLHSLVEQHLTARSHGRIDHVFNHFAHGEFLAELYGDGEEYRLSLRKICNGINKLLDEGTL 202          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Medaka
Match: tnfaip8l1 (tumor necrosis factor alpha-induced protein 8-like protein 1 [Source:NCBI gene;Acc:101164796])

HSP 1 Score: 75.485 bits (184), Expect = 5.112e-16
Identity = 47/187 (25.13%), Postives = 104/187 (55.61%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            D F++++++++ QKKL SK++TK +   FID+TS+ V + L  + + +  ++KE+ K++K ++K+  KL +L+ N   ++ ++ ++   R     +A   ++ ++  +  T +   +     +C   +    + +LT KS  +++   N F D +FL  ++   E Y   ++KIC  + +++D G L
Sbjct:    2 DSFSTKSLALQAQKKLMSKMATKSMANLFIDDTSSEVLDELYRVTKEYTRNRKESQKIIKNLIKVVVKLGVLYRNNQFNSEELVLVENFRKKVHTLAMTAVSFYQIDF--TFDRRVMSGILNECRELLHQAIRRHLTAKSHSRVSHVFNHFADCDFLAALYGPSEVYRAHLQKICNGLNKMLDDGNL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Medaka
Match: tnfaip8l1 (tumor necrosis factor alpha-induced protein 8-like protein 1 [Source:NCBI gene;Acc:101164796])

HSP 1 Score: 75.485 bits (184), Expect = 5.112e-16
Identity = 47/187 (25.13%), Postives = 104/187 (55.61%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            D F++++++++ QKKL SK++TK +   FID+TS+ V + L  + + +  ++KE+ K++K ++K+  KL +L+ N   ++ ++ ++   R     +A   ++ ++  +  T +   +     +C   +    + +LT KS  +++   N F D +FL  ++   E Y   ++KIC  + +++D G L
Sbjct:    2 DSFSTKSLALQAQKKLMSKMATKSMANLFIDDTSSEVLDELYRVTKEYTRNRKESQKIIKNLIKVVVKLGVLYRNNQFNSEELVLVENFRKKVHTLAMTAVSFYQIDF--TFDRRVMSGILNECRELLHQAIRRHLTAKSHSRVSHVFNHFADCDFLAALYGPSEVYRAHLQKICNGLNKMLDDGNL 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Medaka
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like protein 2 B [Source:NCBI gene;Acc:101166904])

HSP 1 Score: 75.0998 bits (183), Expect = 6.507e-16
Identity = 48/187 (25.67%), Postives = 99/187 (52.94%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            D F+S+ +++K QKK+ S ++TK  V+ FID+TS+ + + L  + + + G+K EA K++K +VKI  K+ +LF N   SN ++ +    +      A   ++ +   +  T +   + E    C + ++ +   +LT KS  +I    N + D + L  ++     +   + +IC+ + +L++ G +
Sbjct:    2 DAFSSKDMAMKAQKKILSSMATKSSVQMFIDDTSSEILDELYRVSKEYTGNKSEAQKVVKDLVKIAVKIGVLFRNNRFSNEELRVAQDFKKKLHTGAMTAISFYEVDF--TFDKTVMSEILADCRDLLLKLVNTHLTPKSHGRINHVFNHYGDPQLLTKLYDPNSNFRPNLTRICKGLNKLVEDGTI 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Medaka
Match: tnfaip8l2b (tumor necrosis factor, alpha-induced protein 8-like protein 2 B [Source:NCBI gene;Acc:101166904])

HSP 1 Score: 75.0998 bits (183), Expect = 6.507e-16
Identity = 48/187 (25.67%), Postives = 99/187 (52.94%), Query Frame = 1
Query:  175 DHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            D F+S+ +++K QKK+ S ++TK  V+ FID+TS+ + + L  + + + G+K EA K++K +VKI  K+ +LF N   SN ++ +    +      A   ++ +   +  T +   + E    C + ++ +   +LT KS  +I    N + D + L  ++     +   + +IC+ + +L++ G +
Sbjct:    2 DAFSSKDMAMKAQKKILSSMATKSSVQMFIDDTSSEILDELYRVSKEYTGNKSEAQKVVKDLVKIAVKIGVLFRNNRFSNEELRVAQDFKKKLHTGAMTAISFYEVDF--TFDKTVMSEILADCRDLLLKLVNTHLTPKSHGRINHVFNHYGDPQLLTKLYDPNSNFRPNLTRICKGLNKLVEDGTI 186          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Planmine SMEST
Match: SMESG000023256.1 (SMESG000023256.1)

HSP 1 Score: 383.645 bits (984), Expect = 5.867e-136
Identity = 203/203 (100.00%), Postives = 203/203 (100.00%), Query Frame = 1
Query:  127 MTDKKTQNSEPESIEEDHFNSQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            MTDKKTQNSEPESIEEDHFNSQTISIKVQKKLASKLSTKKLVKFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML
Sbjct:    1 MTDKKTQNSEPESIEEDHFNSQTISIKVQKKLASKLSTKKLVKFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 203          
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Planmine SMEST
Match: SMESG000055619.1 (SMESG000055619.1)

HSP 1 Score: 110.538 bits (275), Expect = 3.702e-29
Identity = 69/183 (37.70%), Postives = 118/183 (64.48%), Query Frame = 1
Query:  187 SQTISIKVQXXXXXXXXXXXXXXFFIDETSARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIEILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKNYLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDRGML 735
            +QT+ ++ QKKLASK S+K LVKF ++E + R+F+N++ LL  +  S++ ANK MK ++K+N K+ +LFIN V S+ +IE     R+ F K+ ++ +   R+    +V +D L+E   +  + ++++   +LT+KS+ KI  C  F   +EFL    S  EP+   M++IC D+Q+++DRG+L
Sbjct:   13 TQTMVLRCQKKLASKFSSKYLVKFLMNEPANRIFDNVHRLLFHYTNSRQLANKQMKDMIKLNIKITLLFINDVFSDEEIEKSNDFRDVFFKICELIIK-SRRCRNHSVLIDLLLENLMKAKSILLLLVHRHLTDKSKCKIINCAEFLVTREFLTKSLSIDEPFKTIMDRICFDLQDIMDRGLL 194          
The following BLAST results are available for this feature:
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNFAIP8L17.061e-1928.34TNF alpha induced protein 8 like 1 [Source:HGNC Sy... [more]
TNFAIP8L17.061e-1928.34TNF alpha induced protein 8 like 1 [Source:HGNC Sy... [more]
TNFAIP8L35.110e-1828.16TNF alpha induced protein 8 like 3 [Source:HGNC Sy... [more]
TNFAIP81.526e-1726.90TNF alpha induced protein 8 [Source:HGNC Symbol;Ac... [more]
TNFAIP81.526e-1726.90TNF alpha induced protein 8 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sigmar1.021e-829.51gene:FBgn0034894 transcript:FBtr0072096[more]
sigmar1.021e-829.51gene:FBgn0034894 transcript:FBtr0072098[more]
sigmar1.156e-828.95gene:FBgn0034894 transcript:FBtr0072097[more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnfaip8l11.309e-2028.88tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l11.309e-2028.88tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l32.705e-2028.71tumor necrosis factor, alpha-induced protein 8-lik... [more]
CR407586.15.100e-2029.73pep chromosome:GRCz11:CHR_ALT_CTG18_1_44:39521878:... [more]
tnfaip8l2a2.167e-1224.32tumor necrosis factor, alpha-induced protein 8-lik... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNFAIP8L37.749e-1928.65TNF alpha induced protein 8 like 3 [Source:NCBI ge... [more]
tnfaip88.188e-1624.62TNF alpha induced protein 8 [Source:NCBI gene;Acc:... [more]
tnfaip8l21.894e-1526.49TNF alpha induced protein 8 like 2 [Source:NCBI ge... [more]
tnfaip85.312e-1525.16TNF alpha induced protein 8 [Source:NCBI gene;Acc:... [more]
tnfaip8l27.845e-1526.49TNF alpha induced protein 8 like 2 [Source:NCBI ge... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tnfaip8l16.255e-1828.11tumor necrosis factor, alpha-induced protein 8-lik... [more]
Tnfaip8l31.282e-1728.06tumor necrosis factor, alpha-induced protein 8-lik... [more]
Tnfaip86.516e-1724.51tumor necrosis factor, alpha-induced protein 8 [So... [more]
Tnfaip82.847e-1625.26tumor necrosis factor, alpha-induced protein 8 [So... [more]
Tnfaip88.025e-1525.14tumor necrosis factor, alpha-induced protein 8 [So... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7SZE8|TP8L1_DANRE9.883e-2028.88Tumor necrosis factor alpha-induced protein 8-like... [more]
sp|A5PK29|TP8L1_BOVIN1.721e-1928.96Tumor necrosis factor alpha-induced protein 8-like... [more]
sp|Q7T3D0|TP8L3_DANRE2.042e-1928.71Tumor necrosis factor alpha-induced protein 8-like... [more]
sp|Q5ZI78|TFIP8_CHICK4.773e-1929.19Tumor necrosis factor alpha-induced protein 8 OS=G... [more]
sp|Q5ZJU8|TP8L1_CHICK1.004e-1827.32Tumor necrosis factor alpha-induced protein 8-like... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FNY17.498e-2735.14Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GAC01.007e-2635.14Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J5352.618e-2636.07Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4Z2CLV15.385e-2632.54Tumor necrosis factor, alpha-induced protein 8-lik... [more]
A0A183W8N82.932e-2532.86Uncharacterized protein OS=Trichobilharzia regenti... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tnfaip8l31.295e-2130.81TNF alpha induced protein 8 like 3 [Source:NCBI ge... [more]
tnfaip8l18.626e-1926.88tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l2b8.675e-1826.20TNF alpha induced protein 8 like 2 [Source:NCBI ge... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tnfaip8l31.513e-1625.53tumor necrosis factor, alpha-induced protein 8-lik... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372133.046e-1125.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnfaip8l37.178e-2329.21TNF alpha induced protein 8 like 3 [Source:NCBI ge... [more]
tnfaip8l15.112e-1625.13tumor necrosis factor alpha-induced protein 8-like... [more]
tnfaip8l15.112e-1625.13tumor necrosis factor alpha-induced protein 8-like... [more]
tnfaip8l2b6.507e-1625.67tumor necrosis factor, alpha-induced protein 8-lik... [more]
tnfaip8l2b6.507e-1625.67tumor necrosis factor, alpha-induced protein 8-lik... [more]
back to top
BLAST of Tumor necrosis factor alpha-induced protein 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000023256.15.867e-136100.00SMESG000023256.1[more]
SMESG000055619.13.702e-2937.70SMESG000055619.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012143 ID=SMED30012143|Name=Tumor necrosis factor alpha-induced protein 8|organism=Schmidtea mediterranea sexual|type=transcript|length=916bp
ATAACAATTCCATTTCTGGAGAATTTTGCTGTTCGTTCTCTCTACTGATC
AATCAATATCATTCATAGCAAAACAAAAGCAAATTTCACTTTTACATTTA
TCGAATTGCACATCAAACCGACAAACATGACAGATAAAAAAACTCAAAAT
TCGGAACCCGAATCAATCGAGGAAGACCATTTCAATTCCCAAACGATTAG
CATAAAAGTTCAAAAGAAATTAGCCAGCAAATTATCCACAAAAAAGCTTG
TCAAATTCTTCATCGATGAAACATCAGCCCGAGTTTTCAACAATCTCAAT
TTGCTTCTCCGAGCATTTTGCGGCTCGAAAAAAGAAGCAAACAAACTGAT
GAAAACCGTTGTGAAAATCAACGCGAAACTCGCAATCCTTTTCATCAACG
GAGTTTTATCAAATAGTGATATAGAAATATTGGCGAAATCCCGAAACGCG
TTCGCAAAAGTTGCTCAAATTTGTTTGAATATCCATCGGAAGAAGTATCG
GGAAACGGTCAATTTGGATCCACTGATCGAACAATTCGGCCAGTGCCACA
ATTCAATAATGGTGATTGCAAAGAATTATCTGACGGAAAAATCCCAACAA
AAAATCACAACATGCACGAACTTTTTCTGCGACAAAGAATTCCTACTGAC
AGTTTTCAGTGATCAGGAACCCTACAATGGTTTCATGGAGAAGATTTGTG
AAGATATTCAAGAATTAATAGACCGAGGAATGCTGTAGTTTTGTTTAACT
TTCATCTTGCGGTAAAAGTTTGGTGATTCTTTGTGAAATTTTCGTCTCGG
TTATAGATGATCCATTTAGTGAACATGTTTGCACTTCATAGTGATTGATC
TAGATCATTATTTTCGCATTAGTTTATGTAATATTTTTTCTAAATTTTTT
CTCTATCACATTTTCC
back to top

protein sequence of SMED30012143-orf-1

>SMED30012143-orf-1 ID=SMED30012143-orf-1|Name=SMED30012143-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=204bp
MTDKKTQNSEPESIEEDHFNSQTISIKVQKKLASKLSTKKLVKFFIDETS
ARVFNNLNLLLRAFCGSKKEANKLMKTVVKINAKLAILFINGVLSNSDIE
ILAKSRNAFAKVAQICLNIHRKKYRETVNLDPLIEQFGQCHNSIMVIAKN
YLTEKSQQKITTCTNFFCDKEFLLTVFSDQEPYNGFMEKICEDIQELIDR
GML*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0032007negative regulation of TOR signaling
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR038355TNFAIP8_sf
IPR008477TNFAIP8-like
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038355TNFAIP8 superfamilyGENE3DG3DSA:1.20.1440.160coord: 17..203
e-value: 3.4E-46
score: 159.2
IPR008477Tumor necrosis factor alpha-induced protein 8-likePFAMPF05527DUF758coord: 19..201
e-value: 1.2E-43
score: 149.2
IPR008477Tumor necrosis factor alpha-induced protein 8-likePANTHERPTHR12757TUMOR NECROSIS FACTOR INDUCED PROTEINcoord: 12..202