slc2a-2

Overview
Nameslc2a-2 (AKN21397.1)
Smed IDSMED30012139
Length (bp)1733
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc2a-2 (SMED30012139) t-SNE clustered cells

Violin plots show distribution of expression levels for slc2a-2 (SMED30012139) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc2a-2 (SMED30012139) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc2a-2 (SMED30012139) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012139

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30012139SMESG000081673.1 SmedASXL_008372SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30012139SMESG000081673.1 dd_Smed_v4_3190_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30012139SMESG000081673.1 dd_Smed_v4_3190_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012139SMESG000081673.1 dd_Smed_v4_3190_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012139SMESG000081673.1 dd_Smed_v4_3190_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012139SMESG000081673.1 dd_Smed_v4_3190_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30012139SMESG000081673.1 dd_Smed_v4_3190_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30012139SMESG000081673.1 dd_Smed_v4_3190_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012139SMESG000081673.1 dd_Smed_v4_3190_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30012139SMESG000081673.1 dd_Smed_v4_3190_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012139SMESG000081673.1 Contig38185newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012139SMESG000081673.1 Contig38185uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30012139SMESG000081673.1 dd_Smed_v6_3190_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30012139SMESG000081673.1 dd_Smed_v4_3190_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012139SMESG000081673.1 dd_Smed_v4_3190_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30012139SMESG000081673.1 dd_Smed_v4_3190_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
collecting ductSMED30012139SMESG000081673.1 Smed-slc2a-2smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc2a-2 vs. Ensembl Human
Match: SLC2A1 (solute carrier family 2 member 1 [Source:HGNC Symbol;Acc:HGNC:11005])

HSP 1 Score: 284.648 bits (727), Expect = 8.524e-89
Identity = 166/511 (32.49%), Postives = 273/511 (53.42%), Query Frame = 1
Query:  106 NKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPI 1638
            + KK++  L+L V     GS + +GYN  VIN P   I+ F N+T ++      Y  S  I  +T+            L++ +  +F + G+IG+FS G   +  GRRN +L+ ++   +  ++ G +    +  +L +GRF IG+  G+T G   MY+ E++P A RGA+G  HQL + +GI+I  +  +   +    LWP+  +   IPA+L   +LPFCPESPRF+ + ++     +    ++    DV   + E++EES     + K   +++F     R P++IA ++Q+ QQ+SGINAV  YS+S+   AG+ +    Y  I  G++N   T+VSL ++E+ GRRTL L     +AG  + +TI + L      +S         +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +++    W +N IV   +  + +  G Y F+ F V++++ ++F Y  +PETK RTFD++A     G    S K  + L  P+
Sbjct:    4 SSKKLTGRLMLAVGGAVLGS-LQFGYNTGVINAPQKVIEEFYNQTWVH-----RYGES--ILPTTLTT----------LWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQ--PVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQLPWMSY--------LSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPL 486          
BLAST of slc2a-2 vs. Ensembl Human
Match: SLC2A3 (solute carrier family 2 member 3 [Source:HGNC Symbol;Acc:HGNC:11007])

HSP 1 Score: 277.715 bits (709), Expect = 3.705e-86
Identity = 160/491 (32.59%), Postives = 261/491 (53.16%), Query Frame = 1
Query:  112 KKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGIS---VFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVAR 1575
            +K++P LI  + +   GS   +GYN  VIN P   IK F+NKT+ +                   N     +    L++ +  +F + G+IG+FS G   +  GRRN +L+ ++  + GG   GL     +V +L +GR  IG+  G+  G   MY+ EI+P A RGA G  +QL + +GI++  I  +   L ++ LWP+    T +PA+L    LPFCPESPRF+ + +      ++   R+   +DV   I E+++ES     + +   +++F     R P+II+ ++Q+ QQ+SGINAV  YS+ +   AG+ E    Y  I  GV+N + T+VSL L+E+ GRRTL     ++  G + F +  +       T+S+  +  + G+S   +  I+ ++  F  G GP+P  IVAE+F Q PR AA +++    W +N +V   +P+    +G Y F+ F   +I    F +  +PET+ RTF+D+ R
Sbjct:    4 QKVTPALIFAITVATIGS-FQFGYNTGVINAPEKIIKEFINKTLTDK-----------------GNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQE--PIYATIGAGVVNTIFTVVSLFLVERAGRRTL----HMIGLGGMAFCSTLM-------TVSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITR 463          
BLAST of slc2a-2 vs. Ensembl Human
Match: SLC2A4 (solute carrier family 2 member 4 [Source:HGNC Symbol;Acc:HGNC:11009])

HSP 1 Score: 276.559 bits (706), Expect = 1.766e-85
Identity = 176/520 (33.85%), Postives = 289/520 (55.58%), Query Frame = 1
Query:  109 KKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNEND 1668
            +++++  L+L VF    GS + +GYN+ VIN P   I+   N+T L     +  +S  P   +T             L+A +  +F + G+I +F  G I+  +GR+  +L+N+V  ++GG + GL    ++  +L +GRF IG  SG+T GL  MY+ EIAP   RGA+G  +QLA+ +GI+I  +L +   L T SLWP+    T +PA+L L +LPFCPESPR++++ ++     RK   R+    DV   + EL++E    + +     +Q+   +  R PLIIA ++Q+ QQ+SGINAV  YS+S+  TAG+ +    Y  I  GV+N V TLVS+ L+E+ GRRTL L     + G  + +T+ + L      +S         +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +++    W +N I+   +  + +A+G Y FL F V+++  ++F +L +PET+ RTFD ++       +++ ++   +      + +  +END
Sbjct:   17 QQRVTGTLVLAVFSAVLGS-LQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTT-------------LWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGVGQ--PAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPAMSY--------VSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTE---LEYLGPDEND 509          
BLAST of slc2a-2 vs. Ensembl Human
Match: SLC2A4 (solute carrier family 2 member 4 [Source:HGNC Symbol;Acc:HGNC:11009])

HSP 1 Score: 276.559 bits (706), Expect = 1.766e-85
Identity = 176/520 (33.85%), Postives = 289/520 (55.58%), Query Frame = 1
Query:  109 KKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNEND 1668
            +++++  L+L VF    GS + +GYN+ VIN P   I+   N+T L     +  +S  P   +T             L+A +  +F + G+I +F  G I+  +GR+  +L+N+V  ++GG + GL    ++  +L +GRF IG  SG+T GL  MY+ EIAP   RGA+G  +QLA+ +GI+I  +L +   L T SLWP+    T +PA+L L +LPFCPESPR++++ ++     RK   R+    DV   + EL++E    + +     +Q+   +  R PLIIA ++Q+ QQ+SGINAV  YS+S+  TAG+ +    Y  I  GV+N V TLVS+ L+E+ GRRTL L     + G  + +T+ + L      +S         +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +++    W +N I+   +  + +A+G Y FL F V+++  ++F +L +PET+ RTFD ++       +++ ++   +      + +  +END
Sbjct:   17 QQRVTGTLVLAVFSAVLGS-LQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTT-------------LWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGVGQ--PAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPAMSY--------VSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTE---LEYLGPDEND 509          
BLAST of slc2a-2 vs. Ensembl Human
Match: SLC2A14 (solute carrier family 2 member 14 [Source:HGNC Symbol;Acc:HGNC:18301])

HSP 1 Score: 273.478 bits (698), Expect = 1.436e-84
Identity = 160/494 (32.39%), Postives = 264/494 (53.44%), Query Frame = 1
Query:  103 QNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGIS---VFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVAR 1575
             N++ ++P LI  + +   GS   +GYN  VIN P   IK F+NKT+ +        ++ P     + N          L++ +  +F + G+IG+FS G   +  GRRN +L+ ++    GG + GL     +V +L +GR  IG+  G+  G   MY+ EI+P A RGA G  +QL + +GI++  I  +   L ++ LWPV    T +PA+L    LP CPESPRF+ + +       +   R+   +DV   I E+++ES     + +   +++F     R P+II+ ++Q+ QQ+SGINAV  YS+ +   AG+ +    Y  I+ GV+N + TL+SL L+E+ GRRTL     ++  G + F +  +       T+S+  +  + G+S   +  I+ ++  F  G GP+P  IVAE+F Q PR AA +++    W +N +V   +P+    +G Y F+ F   +I    F +  +PET+ RTF+D+ R
Sbjct:    2 DNRQNVTPALIFAITVATIGS-FQFGYNTGVINAPETIIKEFINKTLTD-------KANAPPSEVLLTN----------LWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQQ--PIYATISAGVVNTIFTLLSLFLVERAGRRTL----HMIGLGGMAFCSTLM-------TVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITR 464          
BLAST of slc2a-2 vs. Ensembl Celegans
Match: fgt-1 (Facilitated glucose transporter protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O44827])

HSP 1 Score: 239.195 bits (609), Expect = 7.137e-72
Identity = 154/495 (31.11%), Postives = 253/495 (51.11%), Query Frame = 1
Query:  109 KKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLE--KFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIY---GQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARD 1578
            + K++  L  + F+    +S  +GY++  +N P   I  ++              S   +F+  ++       +A+  ++   +VF + G+IG  S+GW+AD VGRR  L  N++  +    + GL        ++ +GR  IG+N G +  L  M+LTEI+P   RG +G+ HQL VT+ I++  I  + H L T   WP+  A T +PAVL L +L  CPESP++    +           ++   EDV   I  +QEE+  A  Q K K   +F +  L  P+ IA ++ + QQ+SGIN  + YS+ +   AG+      Y  I +G +NV+ TL+S+ L++  KFGRR      S+LLAG      +FV+     G L+I    G K     ++ F++ ++I FA G G +P   V+EIF    RG A SI+  + WAANL+V  ++  +N  +  YSF  F   +     + + ++PETK ++ + +  +
Sbjct:   21 EGKLTKCLAFSAFVITL-ASFQFGYHIGCVNAPGGLITEWI------------IGSHKDLFDKELSRE-----NADLAWSVAVSVFAVGGMIGGLSSGWLADKVGRRGALFYNNLLALAAAALMGLAKSVGAYPMVILGRLIIGLNCGFSSALVPMFLTEISPNNLRGMLGSLHQLLVTIAILVSQIFGLPHLLGTGDRWPLIFAFTVVPAVLQLALLMLCPESPKYTMAVRGQRNEAESALKKLRDTEDVSTEIEAMQEEATAAGVQEKPKMGDMF-KGALLWPMSIAIMMMLAQQLSGINVAMFYSTVIFRGAGLTGNEPFYATIGMGAVNVIMTLISVWLVDHPKFGRR------SLLLAG---LTGMFVSTLLLVGALTIQNSGGDKWASYSAIGFVLLFVISFATGPGAIPWFFVSEIFDSSARGNANSIAVMVNWAANLLVGLTFLPINNLMQQYSFFIFSGFLAFFIFYTWKFVPETKGKSIEQIQAE 487          
BLAST of slc2a-2 vs. Ensembl Celegans
Match: fgt-1 (Facilitated glucose transporter protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O44827])

HSP 1 Score: 238.81 bits (608), Expect = 1.460e-71
Identity = 151/490 (30.82%), Postives = 250/490 (51.02%), Query Frame = 1
Query:  115 KISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLE--KFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARD 1578
            K++  L  + F+    +S  +GY++  +N P   I  ++              S   +F+  ++       +A+  ++   +VF + G+IG  S+GW+AD VGRR  L  N++  +    + GL        ++ +GR  IG+N G +  L  M+LTEI+P   RG +G+ HQL VT+ I++  I  + H L T   WP+  A T +PAVL L +L  CPESP++    +           ++   EDV   I  +QEE+  A  Q K K   +F +  L  P+ IA ++ + QQ+SGIN  + YS+ +   AG+      Y  I +G +NV+ TL+S+ L++  KFGRR+LLL     +  S L L   + + N+       G K     ++ F++ ++I FA G G +P   V+EIF    RG A SI+  + WAANL+V  ++  +N  +  YSF  F   +     + + ++PETK ++ + +  +
Sbjct:   41 KLTKCLAFSAFVITL-ASFQFGYHIGCVNAPGGLITEWI------------IGSHKDLFDKELSRE-----NADLAWSVAVSVFAVGGMIGGLSSGWLADKVGRRGALFYNNLLALAAAALMGLAKSVGAYPMVILGRLIIGLNCGFSSALVPMFLTEISPNNLRGMLGSLHQLLVTIAILVSQIFGLPHLLGTGDRWPLIFAFTVVPAVLQLALLMLCPESPKYTMAVRGQRNEAESALKKLRDTEDVSTEIEAMQEEATAAGVQEKPKMGDMF-KGALLWPMSIAIMMMLAQQLSGINVAMFYSTVIFRGAGLTGNEPFYATIGMGAVNVIMTLISVWLVDHPKFGRRSLLLAGLTGMFVSTLLLVGALTIQNSG------GDKWASYSAIGFVLLFVISFATGPGAIPWFFVSEIFDSSARGNANSIAVMVNWAANLLVGLTFLPINNLMQQYSFFIFSGFLAFFIFYTWKFVPETKGKSIEQIQAE 505          
BLAST of slc2a-2 vs. Ensembl Celegans
Match: R09B5.11 (Facilitated glucose transporter homolog [Source:UniProtKB/Swiss-Prot;Acc:O44616])

HSP 1 Score: 206.453 bits (524), Expect = 2.480e-59
Identity = 126/425 (29.65%), Postives = 227/425 (53.41%), Query Frame = 1
Query:  328 DANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKS---QPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLE--KFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAF 1587
             A+F+++   ++F + G+ G+F +G++AD  GR++ LL N++  ++  +    +   +   ++  GRF +G+N GIT GL  M+LTE+AP   RG  G+ HQL +++ IV+   L +     T   WP   AC AIP  L L  +PFC ESP+++  K ++    R+   ++     VD  +  + +E+ +      QP   ++ +F + + + P+I++ L+   QQ SGI+AV  YS+ +    G+      Y  +  G + ++ T   L L++  KFGR+ L +     +  S + + I + L+NA    + Y       ++V FI+++++ FAFG GP+P    +E+F    RG A ++S    W AN +V  ++  +N  I  Y+FL F        +F + ++PETK ++   + ++LAF
Sbjct:   95 QADFIWSVAVSMFSVGGMFGSFCSGFLADKFGRKSTLLYNNILALLAAVCLSTSKLFNFYPMIVFGRFLVGLNCGITSGLVPMFLTELAPANLRGKCGSFHQLNISVAIVLSQALGLPQIFGTQVGWPYIFACVAIPTFLQLATIPFCVESPKYLISKLNDREEARRILEKLRGHTKVDEELEHMVQETMVTVEPLHQP--GYVSLF-KGDNQWPMIVSILMMFSQQFSGISAVTFYSTLIFKRNGLSGNEPMYATVGFGCIKLIATFGCLFLIDHPKFGRKRLHIAGLSGMCISSILIVITLTLSNAGYHWASY-------MNVLFILSFVVTFAFGPGPIPWFFTSELFDSATRGRAAAVSATSNWVANWMVGLTFLPINNIIHQYAFLMFTFFTFTFAIFTWKFVPETKGKSPSAIRKELAF 509          
BLAST of slc2a-2 vs. Ensembl Celegans
Match: R09B5.11 (Facilitated glucose transporter homolog [Source:UniProtKB/Swiss-Prot;Acc:O44616])

HSP 1 Score: 206.453 bits (524), Expect = 2.480e-59
Identity = 126/425 (29.65%), Postives = 227/425 (53.41%), Query Frame = 1
Query:  328 DANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKS---QPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLE--KFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAF 1587
             A+F+++   ++F + G+ G+F +G++AD  GR++ LL N++  ++  +    +   +   ++  GRF +G+N GIT GL  M+LTE+AP   RG  G+ HQL +++ IV+   L +     T   WP   AC AIP  L L  +PFC ESP+++  K ++    R+   ++     VD  +  + +E+ +      QP   ++ +F + + + P+I++ L+   QQ SGI+AV  YS+ +    G+      Y  +  G + ++ T   L L++  KFGR+ L +     +  S + + I + L+NA    + Y       ++V FI+++++ FAFG GP+P    +E+F    RG A ++S    W AN +V  ++  +N  I  Y+FL F        +F + ++PETK ++   + ++LAF
Sbjct:   95 QADFIWSVAVSMFSVGGMFGSFCSGFLADKFGRKSTLLYNNILALLAAVCLSTSKLFNFYPMIVFGRFLVGLNCGITSGLVPMFLTELAPANLRGKCGSFHQLNISVAIVLSQALGLPQIFGTQVGWPYIFACVAIPTFLQLATIPFCVESPKYLISKLNDREEARRILEKLRGHTKVDEELEHMVQETMVTVEPLHQP--GYVSLF-KGDNQWPMIVSILMMFSQQFSGISAVTFYSTLIFKRNGLSGNEPMYATVGFGCIKLIATFGCLFLIDHPKFGRKRLHIAGLSGMCISSILIVITLTLSNAGYHWASY-------MNVLFILSFVVTFAFGPGPIPWFFTSELFDSATRGRAAAVSATSNWVANWMVGLTFLPINNIIHQYAFLMFTFFTFTFAIFTWKFVPETKGKSPSAIRKELAF 509          
BLAST of slc2a-2 vs. Ensembl Celegans
Match: K08F9.1 (pep chromosome:WBcel235:V:15137273:15139888:-1 gene:WBGene00010684.1 transcript:K08F9.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K08F9.1)

HSP 1 Score: 168.318 bits (425), Expect = 1.185e-45
Identity = 136/483 (28.16%), Postives = 243/483 (50.31%), Query Frame = 1
Query:  130 LILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSL--LY-IGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKK--HNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIG-GYSFL-PFLVVVIICWVFFYLYMPETKNRT 1557
            +++   IT    S  YGYN+ + N   D    F+N+T        A      + + T+ N+ S      F+ A    V  +  + G+FS  +IA+ VGR+NGL   ++ + +G +  G+++ +  + L  LY I R  +G +  +++GL+ ++L+E +P+  RGAIG     A+ LG V+G ++ M     TD LW V  A      ++    LPF PESP ++  K    + T++   + +  + E+ D  + E+Q+E     S  KF  + +  QK LR    +  ++  +   SG+  + +++  +L   G+  + +        +++V+ +++++ +++K GRR LLL   I LAG L+   I   L     T   +G +V G I +FFI  +   FA G GP+   I AE+  Q+ R AA S +  +Q  +   ++ ++  M   +G  +S+L  F+  V +  VF Y  +PETKN++
Sbjct:    9 MLIVAVITSMAGSFHYGYNLVLTNPSQDAFLSFMNQTF-------AKRFDGGLSDHTLQNIWS------FVVA----VLFLGALAGSFSIPFIAEGVGRKNGL---YISISVGVLAGGMSIASKFIPLFELYIISRVVMGWSVSVSLGLSGIFLSEASPKQNRGAIGMMTGTAIQLGTVVGSVVAMPQIFGTDDLWWVIYATEIGIMLVFGAALPFFPESPGYLIQKGSLESATISISFYYKCEK-EEADKHVKEIQKEQ--MNSTKKFTMLDVIQQKSLRDKAFVGAVVTFVMSFSGVAVISAFAFEILVNTGLNVLQASLANDATTIVSVISSVLAIAIIDKNGRRPLLL---ISLAGILICNLIIFGLMF---TFDKFGNQVLGFILIFFICIFQFFFALGPGPLSYFINAELVGQDARSAAQSWASVVQMISQFSIITAFLPMKNQLGEAWSYLILFVAPVAVSLVFLYFSLPETKNKS 462          
BLAST of slc2a-2 vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333499)

HSP 1 Score: 293.508 bits (750), Expect = 1.065e-92
Identity = 168/471 (35.67%), Postives = 263/471 (55.84%), Query Frame = 1
Query:  175 YGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANF---LYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGG---ISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDV 1569
            +GYN  VIN P   I+ F+         +D Y                  I   F   LY+   ++F I G++G FS GW+A+  GR+ GLLLN+V  I G  + G T  + +  +L++GRF IG+N G+   L  MY++EIAP   RG +G  +QLAVT+G+++  +L +   L T+  WP+       PA+L L +LP CPESPR++ + K      RK   R+     V+  I E++ E    +S+     +++     LR PLII  ++Q+ QQ SGINAV  YS+S+  ++G+ E  +++  I IG + VV TLVS+PL+++ GRRTL L+      G +   +IF+ ++        Y Q++      +SV   + +++ FA G G +P +I AE+F Q PR +A +I+  + W AN +V   +P+M  A+  Y+FLPF V + I W+F Y  +PETKN+TF+++
Sbjct:   27 FGYNTGVINAPEKNIENFMKDVY-----KDRYGED---------------ISEEFIQQLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGSVEEDIEEMRAEERAQQSESHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYG----LGGMFIFSIFITISFLIKEFFGYVQEMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEI 473          
BLAST of slc2a-2 vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333500)

HSP 1 Score: 293.893 bits (751), Expect = 7.984e-92
Identity = 168/471 (35.67%), Postives = 263/471 (55.84%), Query Frame = 1
Query:  175 YGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANF---LYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGG---ISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDV 1569
            +GYN  VIN P   I+ F+         +D Y                  I   F   LY+   ++F I G++G FS GW+A+  GR+ GLLLN+V  I G  + G T  + +  +L++GRF IG+N G+   L  MY++EIAP   RG +G  +QLAVT+G+++  +L +   L T+  WP+       PA+L L +LP CPESPR++ + K      RK   R+     V+  I E++ E    +S+     +++     LR PLII  ++Q+ QQ SGINAV  YS+S+  ++G+ E  +++  I IG + VV TLVS+PL+++ GRRTL L+      G +   +IF+ ++        Y Q++      +SV   + +++ FA G G +P +I AE+F Q PR +A +I+  + W AN +V   +P+M  A+  Y+FLPF V + I W+F Y  +PETKN+TF+++
Sbjct:   83 FGYNTGVINAPEKNIENFMKDVY-----KDRYGED---------------ISEEFIQQLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGSVEEDIEEMRAEERAQQSESHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYG----LGGMFIFSIFITISFLIKEFFGYVQEMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEI 529          
BLAST of slc2a-2 vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333493)

HSP 1 Score: 291.197 bits (744), Expect = 8.112e-92
Identity = 166/468 (35.47%), Postives = 261/468 (55.77%), Query Frame = 1
Query:  175 YGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANF---LYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDV 1569
            +GYN  VIN P   I+ F+         +D Y                  I   F   LY+   ++F I G++G FS GW+A+  GR+ GLLLN+V  I G  + G T  + +  +L++GRF IG+N G+   L  MY++EIAP   RG +G  +QLAVT+G+++  +L +   L T+  WP+       PA+L L +LP CPESPR++ + K      RK   R+     V+  I E++ E    +S+     +++     LR PLII  ++Q+ QQ SGINAV  YS+S+  ++G+ E  +++  I IG + VV TLVS+PL+++ GRRTL L+      G +   +IF+ ++     +  +       +SV   + +++ FA G G +P +I AE+F Q PR +A +I+  + W AN +V   +P+M  A+  Y+FLPF V + I W+F Y  +PETKN+TF+++
Sbjct:   27 FGYNTGVINAPEKNIENFMKDVY-----KDRYGED---------------ISEEFIQQLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGSVEEDIEEMRAEERAQQSESHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYG----LGGMFIFSIFITISFLIKEMIDW----MSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEI 466          
BLAST of slc2a-2 vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333496)

HSP 1 Score: 290.812 bits (743), Expect = 1.153e-91
Identity = 166/468 (35.47%), Postives = 261/468 (55.77%), Query Frame = 1
Query:  175 YGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANF---LYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDV 1569
            +GYN  VIN P   I+ F+         +D Y                  I   F   LY+   ++F I G++G FS GW+A+  GR+ GLLLN+V  I G  + G T  + +  +L++GRF IG+N G+   L  MY++EIAP   RG +G  +QLAVT+G+++  +L +   L T+  WP+       PA+L L +LP CPESPR++ + K      RK   R+     V+  I E++ E    +S+     +++     LR PLII  ++Q+ QQ SGINAV  YS+S+  ++G+ E  +++  I IG + VV TLVS+PL+++ GRRTL L+      G +   +IF+ ++     +  +       +SV   + +++ FA G G +P +I AE+F Q PR +A +I+  + W AN +V   +P+M  A+  Y+FLPF V + I W+F Y  +PETKN+TF+++
Sbjct:   27 FGYNTGVINAPEKNIENFMKDVY-----KDRYGED---------------ISEEFIQQLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGSVEEDIEEMRAEERAQQSESHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYG----LGGMFIFSIFITISFLIKEMIDW----MSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEI 466          
BLAST of slc2a-2 vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333497)

HSP 1 Score: 290.812 bits (743), Expect = 1.153e-91
Identity = 166/468 (35.47%), Postives = 261/468 (55.77%), Query Frame = 1
Query:  175 YGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANF---LYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDV 1569
            +GYN  VIN P   I+ F+         +D Y                  I   F   LY+   ++F I G++G FS GW+A+  GR+ GLLLN+V  I G  + G T  + +  +L++GRF IG+N G+   L  MY++EIAP   RG +G  +QLAVT+G+++  +L +   L T+  WP+       PA+L L +LP CPESPR++ + K      RK   R+     V+  I E++ E    +S+     +++     LR PLII  ++Q+ QQ SGINAV  YS+S+  ++G+ E  +++  I IG + VV TLVS+PL+++ GRRTL L+      G +   +IF+ ++     +  +       +SV   + +++ FA G G +P +I AE+F Q PR +A +I+  + W AN +V   +P+M  A+  Y+FLPF V + I W+F Y  +PETKN+TF+++
Sbjct:   27 FGYNTGVINAPEKNIENFMKDVY-----KDRYGED---------------ISEEFIQQLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGSVEEDIEEMRAEERAQQSESHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYG----LGGMFIFSIFITISFLIKEMIDW----MSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEI 466          
BLAST of slc2a-2 vs. Ensembl Zebrafish
Match: slc2a1b (solute carrier family 2 member 1b [Source:ZFIN;Acc:ZDB-GENE-090915-1])

HSP 1 Score: 283.493 bits (724), Expect = 1.300e-88
Identity = 157/490 (32.04%), Postives = 264/490 (53.88%), Query Frame = 1
Query:  103 QNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVA 1572
            +  K+++  L+L V     GS + +GYN  VIN P   I+ F N+T             + I  +T+            L++ +  +F + G++G+FS G   +  GRRN +L+ +V   I   + G +   ++  +L IGRF +G+ SG++ G   MY+ E+AP A RGA+G  HQL + +GI++  +  M   +   ++WP     T IPA++  C+LP CPESPRF+ + ++  +  +    ++    DV   + E++EES     + K    ++F     R P++IA ++Q+ QQ+SGINA+  YS+ +   AG+ +    Y  I  GV+N   T+VSL ++E+ GRR+L L   + +AGS + +TI + L      +S         +S+  I  ++  F  G GP+P  IVAE+F Q PR +A++++    W AN IV   +  + +  G Y F+ F V ++  ++F Y  +PETK RTFD+++
Sbjct:    2 EGGKQLTLPLMLAVGTAVIGS-LQFGYNTGVINAPQKIIEAFYNETW-------TARHGDMISKTTMTT----------LWSLSVAIFSVGGIVGSFSVGLFVNRFGRRNSMLMANVLAFIAAALMGFSKMAASWEMLIIGRFVVGLYSGLSTGFVPMYVGEVAPTALRGALGTLHQLGIVVGILMAQVFGMEAIMGNATMWPFLLGFTFIPALVQCCLLPICPESPRFLLINRNEESKAKSVLKKLRGTTDVSADMQEMKEESRQMMREKKVTIPELFRSPLYRQPIVIAIMLQLSQQLSGINAIFYYSTKIFEKAGVQQ--PVYATIGAGVVNTAFTVVSLFVVERAGRRSLHLLGLLGMAGSAILMTIAIALLEKYDWMSY--------MSIVAIFAFVAFFEIGPGPIPWFIVAELFSQGPRPSAFAVAGFSNWTANFIVGMCFQYVEEVCGAYVFVIFTVFLLCFFIFTYFKVPETKGRTFDEIS 463          
BLAST of slc2a-2 vs. Ensembl Zebrafish
Match: slc2a3a (solute carrier family 2 member 3a [Source:ZFIN;Acc:ZDB-GENE-040718-390])

HSP 1 Score: 283.493 bits (724), Expect = 6.864e-88
Identity = 180/524 (34.35%), Postives = 277/524 (52.86%), Query Frame = 1
Query:  106 NKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLA-----FGTTVISKKKSQTLNRPIYDKVSTNE 1662
             KK+++  L+ ++     GS + +GYN  VIN P  +++ F N T +            PI       V S ++           +F + G+ G+FS G +A+  GRR  ++L +V  +IGG + GL    S+  ++  GR  IG+  G+  GL  MY+ E++P   RGA G  HQL V +GI+I  I  +   L +D LWP+  A T +PA+L   +LPFCPESPR++ +  +     RK   R+   EDV   + E++EES     + K    ++F     R PL IA ++Q+ QQ+SGINAV  YS+ +  +AG+ +    Y  I  GV+N V T+VSL L+E+ GRRTL L     +A S L +TI + L +          +    +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +++    W AN IV  ++P + +  G Y F+ F++ +II ++F Y  +PETK RTFD++AR  +       T+V    +      P+ +KV   E
Sbjct:    4 EKKQVTCYLLFSLSTAVIGS-LQFGYNTGVINAPEQKLRAFFNATWME-------RYGEPISPGVCTIVWSFAV----------AIFSVGGMAGSFSVGVVANKFGRRKSMILVNVLALIGGGLMGLCTLCSSFEMIIAGRLMIGLFCGLFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVVGILIAQIFGLESLLGSDKLWPILLALTILPAILQCFLLPFCPESPRYLLINLNEEEQARKALVRLRGYEDVGKDMQEMKEESAKMAMEKKVTIPELFRSAAYRQPLFIAIMLQLSQQLSGINAVFYYSTGIFKSAGVTQPI--YATIGAGVVNTVFTVVSLFLVERAGRRTLHLIGLGGMAISALAMTIALLLKDI---------EALQYLSIAAIFAFVAMFEMGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTANFIVGITFPKLEELCGPYVFIIFMIFLIIFFIFTYFKVPETKGRTFDEIARGFSGAPPPSATSVEEPGRVALPASPVKEKVPLVE 498          
BLAST of slc2a-2 vs. Ensembl Zebrafish
Match: slc2a3a (solute carrier family 2 member 3a [Source:ZFIN;Acc:ZDB-GENE-040718-390])

HSP 1 Score: 282.722 bits (722), Expect = 8.556e-88
Identity = 180/524 (34.35%), Postives = 277/524 (52.86%), Query Frame = 1
Query:  106 NKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLA-----FGTTVISKKKSQTLNRPIYDKVSTNE 1662
             KK+++  L+ ++     GS + +GYN  VIN P  +++ F N T +            PI       V S ++           +F + G+ G+FS G +A+  GRR  ++L +V  +IGG + GL    S+  ++  GR  IG+  G+  GL  MY+ E++P   RGA G  HQL V +GI+I  I  +   L +D LWP+  A T +PA+L   +LPFCPESPR++ +  +     RK   R+   EDV   + E++EES     + K    ++F     R PL IA ++Q+ QQ+SGINAV  YS+ +  +AG+ +    Y  I  GV+N V T+VSL L+E+ GRRTL L     +A S L +TI + L +          +    +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +++    W AN IV  ++P + +  G Y F+ F++ +II ++F Y  +PETK RTFD++AR  +       T+V    +      P+ +KV   E
Sbjct:    4 EKKQVTCYLLFSLSTAVIGS-LQFGYNTGVINAPEQKLRAFFNATWME-------RYGEPISPGVCTIVWSFAV----------AIFSVGGMAGSFSVGVVANKFGRRKSMILVNVLALIGGGLMGLCTLCSSFEMIIAGRLMIGLFCGLFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVVGILIAQIFGLESLLGSDKLWPILLALTILPAILQCFLLPFCPESPRYLLINLNEEEQARKALVRLRGYEDVGKDMQEMKEESAKMAMEKKVTIPELFRSAAYRQPLFIAIMLQLSQQLSGINAVFYYSTGIFKSAGVTQPI--YATIGAGVVNTVFTVVSLFLVERAGRRTLHLIGLGGMAISALAMTIALLLKDI---------EALQYLSIAAIFAFVAMFEMGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTANFIVGITFPKLEELCGPYVFIIFMIFLIIFFIFTYFKVPETKGRTFDEIARGFSGAPPPSATSVEEPGRVALPASPVKEKVPLVE 498          
BLAST of slc2a-2 vs. Ensembl Zebrafish
Match: slc2a3a (solute carrier family 2 member 3a [Source:ZFIN;Acc:ZDB-GENE-040718-390])

HSP 1 Score: 282.722 bits (722), Expect = 8.556e-88
Identity = 180/524 (34.35%), Postives = 277/524 (52.86%), Query Frame = 1
Query:  106 NKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLA-----FGTTVISKKKSQTLNRPIYDKVSTNE 1662
             KK+++  L+ ++     GS + +GYN  VIN P  +++ F N T +            PI       V S ++           +F + G+ G+FS G +A+  GRR  ++L +V  +IGG + GL    S+  ++  GR  IG+  G+  GL  MY+ E++P   RGA G  HQL V +GI+I  I  +   L +D LWP+  A T +PA+L   +LPFCPESPR++ +  +     RK   R+   EDV   + E++EES     + K    ++F     R PL IA ++Q+ QQ+SGINAV  YS+ +  +AG+ +    Y  I  GV+N V T+VSL L+E+ GRRTL L     +A S L +TI + L +          +    +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +++    W AN IV  ++P + +  G Y F+ F++ +II ++F Y  +PETK RTFD++AR  +       T+V    +      P+ +KV   E
Sbjct:    4 EKKQVTCYLLFSLSTAVIGS-LQFGYNTGVINAPEQKLRAFFNATWME-------RYGEPISPGVCTIVWSFAV----------AIFSVGGMAGSFSVGVVANKFGRRKSMILVNVLALIGGGLMGLCTLCSSFEMIIAGRLMIGLFCGLFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVVGILIAQIFGLESLLGSDKLWPILLALTILPAILQCFLLPFCPESPRYLLINLNEEEQARKALVRLRGYEDVGKDMQEMKEESAKMAMEKKVTIPELFRSAAYRQPLFIAIMLQLSQQLSGINAVFYYSTGIFKSAGVTQPI--YATIGAGVVNTVFTVVSLFLVERAGRRTLHLIGLGGMAISALAMTIALLLKDI---------EALQYLSIAAIFAFVAMFEMGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTANFIVGITFPKLEELCGPYVFIIFMIFLIIFFIFTYFKVPETKGRTFDEIARGFSGAPPPSATSVEEPGRVALPASPVKEKVPLVE 498          
BLAST of slc2a-2 vs. Ensembl Zebrafish
Match: slc2a1a (solute carrier family 2 member 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3158])

HSP 1 Score: 280.411 bits (716), Expect = 1.695e-87
Identity = 161/510 (31.57%), Postives = 267/510 (52.35%), Query Frame = 1
Query:  100 SQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLN 1629
              NKK+++P L++ V     GS + +GYN  VIN P   I+ F N+T       + Y+   P    T             L++ +  +F + G++G+FS G   +  GRRN +L+ ++   I     G +    +  +L IGRF +G+ SG++ G   MY+ EIAP + RGA+G  HQL + +GI++  I  +   + + +LWP     T IPAVL   +LPFCPESPR++ + ++     +    ++   +DV   + E+++ES     +      ++F     R P+ IA ++Q+ QQ SGINAV  YS+ +   AG+ E    Y  I  G +N   T+VSL ++E+ GRR+L L   + +A S + +TI + L      +S         +S+  I +++  F  G GP+P  IVAE+F Q PR +A++++    W AN +V   +  + +  G Y F+ F V+++I +VF Y  +PETK R+F+++      G    ++    TL 
Sbjct:    2 ESNKKEVTPQLMMAVGTAVIGS-LQFGYNTGVINAPQKIIEGFYNET-----WHNRYSEYIPPTTLTT------------LWSVSVAIFSVGGILGSFSVGLFVNRFGRRNSMLIANILAFIAAAFMGFSKLAESWEMLIIGRFIVGLYSGLSTGFVPMYVGEIAPTSLRGALGTLHQLGIVIGILMAQIFGIKEIMGSPTLWPFMLGFTFIPAVLQCALLPFCPESPRYLLINQNEEAKAKSVLKKLRGTDDVGADMQEMRDESRQMMREKTVTIPELFRSSLYRQPIFIAIMLQLSQQFSGINAVFYYSTGIFEKAGVSE--PVYATIGAGAVNTAFTVVSLFIVERVGRRSLHLVGLMGMAVSSVLMTIAMALLTKVEWMSY--------VSIVAIFSFVAFFEIGPGPIPWFIVAELFSQGPRPSAFAVAGFSNWFANFLVGMCFQYVEELTGPYVFIIFTVLLLIFFVFTYFKVPETKGRSFEEITASFRTGADKYNRDDLNTLG 483          
BLAST of slc2a-2 vs. Ensembl Xenopus
Match: slc2a5 (solute carrier family 2 member 5 [Source:NCBI gene;Acc:493549])

HSP 1 Score: 278.1 bits (710), Expect = 4.687e-86
Identity = 170/529 (32.14%), Postives = 278/529 (52.55%), Query Frame = 1
Query:  100 SQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDA--NFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGT---TVISKKKSQTLNRPIYDKVSTNENDT 1671
             + K +++  LIL   +  FGSS  YGYN+A +N P+  +K             D YNS+N      +  V S   DA    L++ T +++ + G  G+   G +   +GR+  LL N++F II  I+ G +V   T  ++   R F+G+ +G++  +  MY+ E++P+  RGAIG   QL +T+GI++  I  + + L     WP+  A T IPAVL L  LPF PESPR+  L K N    +K   R+   EDVD  I E+ +E    K++ +     + T + LR  LI   ++ + QQ+SGINAV  Y+ S+  +AG+ E   QY  +  G +NV+ TL ++ +++ +GRR LLL        S + LTI +        +          +S+  I+ Y+IG A G  P+P +I  E+FRQ  R AA+ I+ ++ W +N I+   +  +   +G Y F+ F  + +  ++F Y+ +PETK +TF +V++ +A        +  K+ Q LN P  +++   E +T
Sbjct:   11 DERKGRLTATLILVTLVATFGSSFQYGYNVASVNSPSPFMK-------------DFYNSTN------IERVGSPLEDAFLTLLWSLTVSLYPLGGFFGSLLVGPLVSKLGRKGTLLFNNIFSIIPAILMGTSVVAKTFEVIIASRLFVGVCAGLSSNVVPMYVGEMSPKNLRGAIGIMPQLMITVGILMAQIFGIRYILGNTEGWPILLALTGIPAVLELAFLPFFPESPRYTLLHKGNEDKAKKALQRLRGWEDVDSEIKEMYQEDQSEKAEGQLSVRNLCTFRPLRWQLISIIVMNMGQQLSGINAVYYYADSIYKSAGVKEETIQYVTVATGSVNVLMTLAAVFIVDSWGRRVLLLSGFGTCCISCVVLTIALVYQTTVSWMPY--------LSIACIIIYVIGHAIGPSPIPYVITTEMFRQASRPAAFMIAGSVHWLSNFIIGLIFEFLMNGLGAYCFILFAAICLATFIFIYIVVPETKGKTFLEVSQLMAKRNGLEETVDSKEFQDLNPP-SNEIQQEEKNT 511          
BLAST of slc2a-2 vs. Ensembl Xenopus
Match: slc2a5 (solute carrier family 2 member 5 [Source:NCBI gene;Acc:493549])

HSP 1 Score: 276.559 bits (706), Expect = 1.665e-85
Identity = 174/542 (32.10%), Postives = 280/542 (51.66%), Query Frame = 1
Query:   97 DSQNKKKISPI------------LILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDA--NFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGT---TVISKKKSQTLNRPIYDKVSTNENDT 1671
             + N KK+ PI            LIL   +  FGSS  YGYN+A +N P+  +K             D YNS+N      +  V S   DA    L++ T +++ + G  G+   G +   +GR+  LL N++F II  I+ G +V   T  ++   R F+G+ +G++  +  MY+ E++P+  RGAIG   QL +T+GI++  I  + + L     WP+  A T IPAVL L  LPF PESPR+  L K N    +K   R+   EDVD  I E+ +E    K++ +     + T + LR  LI   ++ + QQ+SGINAV  Y+ S+  +AG+ E   QY  +  G +NV+ TL ++ +++ +GRR LLL        S + LTI +        +          +S+  I+ Y+IG A G  P+P +I  E+FRQ  R AA+ I+ ++ W +N I+   +  +   +G Y F+ F  + +  ++F Y+ +PETK +TF +V++ +A        +  K+ Q LN P  +++   E +T
Sbjct:    1 KTTNNKKLRPITNCLRILRLTATLILVTLVATFGSSFQYGYNVASVNSPSPFMK-------------DFYNSTN------IERVGSPLEDAFLTLLWSLTVSLYPLGGFFGSLLVGPLVSKLGRKGTLLFNNIFSIIPAILMGTSVVAKTFEVIIASRLFVGVCAGLSSNVVPMYVGEMSPKNLRGAIGIMPQLMITVGILMAQIFGIRYILGNTEGWPILLALTGIPAVLELAFLPFFPESPRYTLLHKGNEDKAKKALQRLRGWEDVDSEIKEMYQEDQSEKAEGQLSVRNLCTFRPLRWQLISIIVMNMGQQLSGINAVYYYADSIYKSAGVKEETIQYVTVATGSVNVLMTLAAVFIVDSWGRRVLLLSGFGTCCISCVVLTIALVYQTTVSWMPY--------LSIACIIIYVIGHAIGPSPIPYVITTEMFRQASRPAAFMIAGSVHWLSNFIIGLIFEFLMNGLGAYCFILFAAICLATFIFIYIVVPETKGKTFLEVSQLMAKRNGLEETVDSKEFQDLNPP-SNEIQQEEKNT 514          
BLAST of slc2a-2 vs. Ensembl Xenopus
Match: ENSXETT00000012702.1 (solute carrier family 2 member 3 [Source:NCBI gene;Acc:100497763])

HSP 1 Score: 269.626 bits (688), Expect = 3.535e-83
Identity = 172/510 (33.73%), Postives = 271/510 (53.14%), Query Frame = 1
Query:  100 SQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLN 1629
              NK +I+  L+  V +   GS + +GYN  VIN P   IK F N T         Y              E        L++ +  +F + G++G+ S G+ A+  GRRN +LL +V  I+GG+  G +    +  +L IGRF IGI  G+  GL  MY+ E+AP + RGA+G  +QL + +GI++  I  +   L +++LWP+    T   +++   +LPFCPESPR++ + K       +   ++    DV   + E+++ES    ++     ++IF   + R P+ IA ++Q+ QQ+SGINAV  YS+S+   AG+P     Y  I  GV+N V T+VSL ++E+ GRRTL L     +A   L +TI + L       S         +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +IS    W AN +V   +P   K  G Y FL F+V++I+ +++ +  +PET+ RTF+D+A++  F     S+ KS ++ 
Sbjct:    2 ESNKGRITCSLVFAVCVAAIGS-LQFGYNTGVINAPEKIIKSFYNGTY-----EHRYGK------------EISESLLTSLWSLSVAIFSVGGMVGSLSVGFFANRFGRRNAMLLVNVAAIVGGVFMGFSKLAWSPEMLIIGRFIIGIFCGLCTGLVPMYIGELAPTSLRGALGTLNQLGIVVGILVAQIFGLEFILGSETLWPLLLGLTVFLSIIQCVLLPFCPESPRYLLIVKKEDEKAERILRKLRGTTDVASDVQEMKDESARTAAEKSVSILEIFRSSQYRQPITIAIILQLSQQLSGINAVFYYSTSIFEDAGVPN--PVYATIGAGVVNTVFTVVSLLIVERAGRRTLQLTGLGGMAVGALIMTIALKLKEQDQAWSY--------VSIVAIYCFVALFEIGPGPIPWFIVAELFSQGPRPAAMAISGCSNWTANFLVGMLFPYAAKGCGPYVFLIFMVLLILFFIYTFFKVPETRGRTFEDIAQE--FEMPERSRTKSDSVQ 481          
BLAST of slc2a-2 vs. Ensembl Xenopus
Match: ENSXETT00000028816.1 (solute carrier family 2 member 3 [Source:NCBI gene;Acc:100497763])

HSP 1 Score: 268.085 bits (684), Expect = 1.910e-82
Identity = 170/509 (33.40%), Postives = 269/509 (52.85%), Query Frame = 1
Query:  100 SQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTL 1626
            S +   I+  L+  V +   GS + +GYN  VIN P   IK F N T         Y              E        L++ +  +F + G++G+ S G+ A+  GRRN +LL +V  I+GG+  G +    +  +L IGRF IGI  G+  GL  MY+ E+AP + RGA+G  +QL + +GI++  I  +   L +++LWP+    T   +++   +LPFCPESPR++ + K       +   ++    DV   + E+++ES    ++     ++IF   + R P+ IA ++Q+ QQ+SGINAV  YS+S+   AG+P     Y  I  GV+N V T+VSL ++E+ GRRTL L     +A   L +TI + L       S         +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +IS    W AN +V   +P   K  G Y FL F+V++I+ +++ +  +PET+ RTF+D+A++        +K  S++L
Sbjct:   13 STDGDTITCSLVFAVCVAAIGS-LQFGYNTGVINAPEKIIKSFYNGTY-----EHRYGK------------EISESLLTSLWSLSVAIFSVGGMVGSLSVGFFANRFGRRNAMLLVNVAAIVGGVFMGFSKLAWSPEMLIIGRFIIGIFCGLCTGLVPMYIGELAPTSLRGALGTLNQLGIVVGILVAQIFGLEFILGSETLWPLLLGLTVFLSIIQCVLLPFCPESPRYLLIVKKEDEKAERILRKLRGTTDVASDVQEMKDESARTAAEKSVSILEIFRSSQYRQPITIAIILQLSQQLSGINAVFYYSTSIFEDAGVPN--PVYATIGAGVVNTVFTVVSLLIVERAGRRTLQLTGLGGMAVGALIMTIALKLKEQDQAWSY--------VSIVAIYCFVALFEIGPGPIPWFIVAELFSQGPRPAAMAISGCSNWTANFLVGMLFPYAAKGCGPYVFLIFMVLLILFFIYTFFKVPETRGRTFEDIAQEFEMPERSRTKSDSESL 493          
BLAST of slc2a-2 vs. Ensembl Xenopus
Match: ENSXETT00000012655.1 (solute carrier family 2 member 3 [Source:NCBI gene;Acc:100497763])

HSP 1 Score: 267.314 bits (682), Expect = 3.438e-82
Identity = 170/510 (33.33%), Postives = 271/510 (53.14%), Query Frame = 1
Query:  100 SQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLN 1629
             + + +I+  L+  V +   GS + +GYN  VIN P   IK F N T         Y              E        L++ +  +F + G++G+ S G+ A+  GRRN +LL +V  I+GG+  G +    +  +L IGRF IGI  G+  GL  MY+ E+AP + RGA+G  +QL + +GI++  I  +   L +++LWP+    T   +++   +LPFCPESPR++ + K       +   ++    DV   + E+++ES    ++     ++IF   + R P+ IA ++Q+ QQ+SGINAV  YS+S+   AG+P     Y  I  GV+N V T+VSL ++E+ GRRTL L     +A   L +TI + L       S         +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +IS    W AN +V   +P   K  G Y FL F+V++I+ +++ +  +PET+ RTF+D+A++  F     S+ KS ++ 
Sbjct:    9 QEQEGRITCSLVFAVCVAAIGS-LQFGYNTGVINAPEKIIKSFYNGTY-----EHRYGK------------EISESLLTSLWSLSVAIFSVGGMVGSLSVGFFANRFGRRNAMLLVNVAAIVGGVFMGFSKLAWSPEMLIIGRFIIGIFCGLCTGLVPMYIGELAPTSLRGALGTLNQLGIVVGILVAQIFGLEFILGSETLWPLLLGLTVFLSIIQCVLLPFCPESPRYLLIVKKEDEKAERILRKLRGTTDVASDVQEMKDESARTAAEKSVSILEIFRSSQYRQPITIAIILQLSQQLSGINAVFYYSTSIFEDAGVPN--PVYATIGAGVVNTVFTVVSLLIVERAGRRTLQLTGLGGMAVGALIMTIALKLKEQDQAWSY--------VSIVAIYCFVALFEIGPGPIPWFIVAELFSQGPRPAAMAISGCSNWTANFLVGMLFPYAAKGCGPYVFLIFMVLLILFFIYTFFKVPETRGRTFEDIAQE--FEMPERSRTKSDSVQ 488          
BLAST of slc2a-2 vs. Ensembl Mouse
Match: Slc2a1 (solute carrier family 2 (facilitated glucose transporter), member 1 [Source:MGI Symbol;Acc:MGI:95755])

HSP 1 Score: 284.263 bits (726), Expect = 7.088e-89
Identity = 164/511 (32.09%), Postives = 271/511 (53.03%), Query Frame = 1
Query:  106 NKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPI 1638
            + KK++  L+L V     GS + +GYN  VIN P   I+ F N+T         +    PI ++T+            L++ +  +F + G+IG+FS G   +  GRRN +L+ ++   +  ++ G +    +  +L +GRF IG+  G+T G   MY+ E++P A RGA+G  HQL + +GI+I  +  +   +    LWP+  +   IPA+L   +LPFCPESPRF+ + ++     +    ++    DV   + E++EE      + K   +++F     R P++IA ++Q+ QQ+SGINAV  YS+S+   AG+ +    Y  I  G++N   T+VSL ++E+ GRRTL L     +AG  + +TI + L      +S         +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +++    W +N IV   +  + +  G Y F+ F V++++ ++F Y  +PETK RTFD++A     G    S K  + L  P+
Sbjct:    4 SSKKVTGRLMLAVGGAVLGS-LQFGYNTGVINAPQKVIEEFYNQTW-------NHRYGEPIPSTTLTT----------LWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVAAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNADLWPLLLSVIFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEEGRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQ--PVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLERLPWMSY--------LSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPL 486          
BLAST of slc2a-2 vs. Ensembl Mouse
Match: Slc2a4 (solute carrier family 2 (facilitated glucose transporter), member 4 [Source:MGI Symbol;Acc:MGI:95758])

HSP 1 Score: 278.1 bits (710), Expect = 2.957e-86
Identity = 175/520 (33.65%), Postives = 285/520 (54.81%), Query Frame = 1
Query:  109 KKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNEND 1668
            +++++  L+L VF    GS + +GYN+ VIN P   I+   N T L    R      + I   T+            L+A +  +F + G+I +F  G I+  +GR+  +L N+V  ++GG + GL    ++  +L +GRF IG  SG+T GL  MY+ EIAP   RGA+G  +QLA+ +GI++  +L +   L T +LWP+  A T +PA+L L +LPFCPESPR++++ ++     RK   R+    DV   + EL++E    + +     +Q+   +  R PLIIA ++Q+ QQ+SGINAV  YS+S+  +AG+ +    Y  I  GV+N V TLVS+ L+E+ GRRTL L     + G  + +T+ + L      +S         +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +++    W  N IV   +  +  A+G Y FL F V+++  ++F +L +PET+ RTFD ++       +++ ++   +      + +  +END
Sbjct:   17 RQRVTGTLVLAVFSAVLGS-LQFGYNIGVINAPQKVIEQSYNATWLG---RQGPGGPDSIPQGTLTT----------LWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLANNVLAVLGGALMGLANAAASYEILILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILVAQVLGLESMLGTATLWPLLLALTVLPALLQLILLPFCPESPRYLYIIRNLEGPARKSLKRLTGWADVSDALAELKDEKRKLERERPMSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFESAGVGQ--PAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPAMSY--------VSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTCNFIVGMGFQYVADAMGPYVFLLFAVLLLGFFIFTFLKVPETRGRTFDQISAAFRRTPSLLEQEVKPSTE---LEYLGPDEND 509          
BLAST of slc2a-2 vs. Ensembl Mouse
Match: Slc2a3 (solute carrier family 2 (facilitated glucose transporter), member 3 [Source:MGI Symbol;Acc:MGI:95757])

HSP 1 Score: 266.544 bits (680), Expect = 3.973e-82
Identity = 164/487 (33.68%), Postives = 256/487 (52.57%), Query Frame = 1
Query:  115 KISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVAR 1575
            K++P L+  V +   GS   +GYN  VIN P   +K FLN T+                   + ++ S  +    L++    +F + G+IG+FS G   +  GRRN +LL ++  II G + G      +V +L +GR  IGI  G+  G   MY+ E++P A RGA G  +QL + +GI++  I  +   L ++ LWP     T IPA+L    LPFCPESPRF+ + K       +   R+    DV   I E+++ES     + +   +++F       PL+I+ ++Q+ QQ+SGINAV  YS+ +   AG+ E    Y  I  GV+N + T+VSL L+E+ GRRTL +     +A   +F+TI + L +    +S         + +  I+ Y+  F  G GP+P  IVAE+F Q PR AA +++    W +N +V   +P+    +G Y F+ F   +I   +F +  +PETK RTF+D+AR
Sbjct:    5 KVTPSLVFAVTVATIGS-FQFGYNTGVINAPETILKDFLNYTL----------------EERLEDLPSEGL-LTALWSLCVAIFSVGGMIGSFSVGLFVNRFGRRNSMLLVNLLAIIAGCLMGFAKIAESVEMLILGRLLIGIFCGLCTGFVPMYIGEVSPTALRGAFGTLNQLGIVVGILVAQIFGLDFILGSEELWPGLLGLTIIPAILQSAALPFCPESPRFLLINKKEEDQATEILQRLWGTSDVVQEIQEMKDESVRMSQEKQVTVLELFRSPNYVQPLLISIVLQLSQQLSGINAVFYYSTGIFKDAGVQE--PIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAVCSVFMTISLLLKDDYEAMSF--------VCIVAILIYVAFFEIGPGPIPWFIVAELFSQGPRPAAIAVAGCCNWTSNFLVGMLFPSAAAYLGAYVFIIFAAFLIFFLIFTFFKVPETKGRTFEDIAR 463          
BLAST of slc2a-2 vs. Ensembl Mouse
Match: Slc2a7 (solute carrier family 2 (facilitated glucose transporter), member 7 [Source:MGI Symbol;Acc:MGI:3650865])

HSP 1 Score: 259.61 bits (662), Expect = 5.078e-79
Identity = 163/526 (30.99%), Postives = 275/526 (52.28%), Query Frame = 1
Query:  103 QNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDAN---FLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRIN-QLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTV-ISKKKSQTLNRPIYDKVSTNEN 1665
             ++ ++ P L+LT     FGS   YGYN+AVIN P        +K   +      +      +N T        +D +    L++ T ++F + G++G+   G + +  GR+  LL+N+VF I   ++ G++       L+ + R  +GI +GI      MYL E+AP+  RGA+G   ++ V +G+++  I ++   L   + WP+  A T +PAV+ L  LPF PESPR+  ++K +    R+   R+  Q  +V+  + E++ E    +++ +   + +FT + LR  LI   ++   QQ+SGINAV  Y+  +  +AG+    SQY  +  GV+N+V TLVS  ++E+ GRR LLL    +   + L LT+ + L + +  LS         +S+  + +YI+G + G  PVP+++  EI  Q  R AA+++  A+ W  N IV  ++P++  AIG YSFL F  V I+   + Y+ +PETK RTF ++    A    V   ++K     +P    + T E 
Sbjct:   14 HSEARLQPTLVLTTLSAAFGSVFQYGYNIAVINTP--------HKVGTSNRWGPVFQVLKSFYNDTHFERHGTFMDESTLLLLWSCTVSMFPLGGLLGSLVVGLMVNKWGRKGTLLINNVFAITSAVLMGVSKVARAFELIILSRVLVGICAGIAYSTLPMYLGELAPQNLRGALGTMTEVFVIIGVLLAQIFSLQAILGNATGWPILLALTGVPAVIQLLSLPFFPESPRYTLIEKGDEETARQALRRLRGQNYNVEAEMEEMRTEERTEQAEGRLSVLNLFTFRPLRWQLISIVVLMAGQQLSGINAVNYYADVIYTSAGVDPTQSQYVTLGSGVINLVMTLVSAVIIERLGRRILLLSGYAICCSACLVLTVALLLQSTAPELSY--------LSIVCVFSYIVGHSIGPSPVPSVVRTEIVLQSSRTAAFTVDGAVHWLTNFIVGLTFPSIQVAIGAYSFLVFAGVCILTAAYIYVVIPETKGRTFVEINCAFAKRNGVEFPEEKEVATAKPHTPSLPTKET 523          
BLAST of slc2a-2 vs. Ensembl Mouse
Match: Slc2a4 (solute carrier family 2 (facilitated glucose transporter), member 4 [Source:MGI Symbol;Acc:MGI:95758])

HSP 1 Score: 254.603 bits (649), Expect = 1.059e-77
Identity = 160/461 (34.71%), Postives = 251/461 (54.45%), Query Frame = 1
Query:  109 KKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPF 1491
            +++++  L+L VF    GS + +GYN+ VIN P   I+   N T L    R      + I   T+            L+A +  +F + G+I +F  G I+  +GR+  +L N+V  ++GG + GL    ++  +L +GRF IG  SG+T GL  MY+ EIAP   RGA+G  +QLA+ +GI++  +L +   L T +LWP+  A T +PA+L L +LPFCPESPR++++ ++     RK   R+    DV   + EL++E    + +     +Q+   +  R PLIIA ++Q+ QQ+SGINAV  YS+S+  +AG+ +    Y  I  GV+N V TLVS+ L+E+ GRRTL L     + G  + +T+ + L      +S         +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +++    W  N IV   +  +  A+G   F  F
Sbjct:   17 RQRVTGTLVLAVFSAVLGS-LQFGYNIGVINAPQKVIEQSYNATWLG---RQGPGGPDSIPQGTLTT----------LWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLANNVLAVLGGALMGLANAAASYEILILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILVAQVLGLESMLGTATLWPLLLALTVLPALLQLILLPFCPESPRYLYIIRNLEGPARKSLKRLTGWADVSDALAELKDEKRKLERERPMSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFESAGVGQ--PAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPAMSY--------VSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTCNFIVGMGFQYV--AVGSLPFAQF 451          
BLAST of slc2a-2 vs. UniProt/SwissProt
Match: sp|P46896|GTR1_CHICK (Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=2 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 2.120e-90
Identity = 167/509 (32.81%), Postives = 272/509 (53.44%), Query Frame = 1
Query:  103 QNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLN 1629
            ++  K++  L+L V     GS + +GYN  VIN P   I+ F N T L       Y    PI  +T+            L++ +  +F + G+IG+FS G   +  GRRN +L++++   +  ++ G +    +  +L +GRF IG+ SG+T G   MY+ E++P A RGA+G  HQL + LGI+I  +  +   +  DSLWP+      +PA+L   ILPF PESPRF+ + ++     +    ++    DV   + E++EES     + K   +++F     R P++IA ++Q+ QQ+SGINAV  YS+S+   +G+ +    Y  I  GV+N   T+VSL ++E+ GRRTL L     +AG  + +TI + L +    +S         +S+  I  ++  F  G GP+P  IVAE+F Q PR AA++++    W +N IV   +  + +  G Y F+ F V++++ ++F Y  +PETK RTFD++A     G    S K     +
Sbjct:    2 ESGSKMTARLMLAVGGAVLGS-LQFGYNTGVINRPQKVIEDFYNHTWL-------YRYEEPISPATLTT----------LWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMSNILAFLAAVLMGFSKMALSFEMLILGRFIIGLYSGLTTGFVPMYVGEVSPTALRGALGTFHQLGIVLGILIAQVFGLDLIMGNDSLWPLLLGFIFVPALLQCIILPFAPESPRFLLINRNEENKAKSVLKKLRGTTDVSSDLQEMKEESRQMMREKKVTIMELFRSPMYRQPILIAIVLQLSQQLSGINAVFYYSTSIFEKSGVEQ--PVYATIGSGVVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALTLLDQMPWMSY--------LSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAFAVAGLSNWTSNFIVGMGFQYIAQLCGSYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIAYRFRQGGASQSDKTPDEFH 482          
BLAST of slc2a-2 vs. UniProt/SwissProt
Match: sp|P28568|GTR3_CHICK (Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A3 PE=2 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 6.185e-89
Identity = 178/523 (34.03%), Postives = 270/523 (51.63%), Query Frame = 1
Query:  106 NKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTE 1674
            +KKKI+  LI  V +   GS + +GYN  VIN P   I+ F N+T+     R     S  +  S              L++ +  +F + G+IG+FS     +  GRRN +LL +V    GG +  L+     V +L IGRF IG+  G+  G   MY++E++P + RGA G  +QL + +GI++  I  +   + T++LWP+    T +PAVL    L FCPESPRF+ + K      +    ++   +DV   I E++EES     + K   +++F     R P+II+  +Q+ QQ+SGINAV  YS+ +   AGI +    Y  I  GV+N V T+VSL L+E+ GRRTL L     +A     +TI + L           +K    IS+     ++  F  G GP+P  IVAE+F Q PR AA +++    W +N +V   +P   K  G Y FL FLV ++I ++F Y  +PETK RTF+D++R         S         P+ + +++ E D E
Sbjct:    3 DKKKITASLIYAVSVAAIGS-LQFGYNTGVINAPEKIIQAFYNRTLSQ---RSGETISPELLTS--------------LWSLSVAIFSVGGMIGSFSVSLFFNRFGRRNSMLLVNVLAFAGGALMALSKIAKAVEMLIIGRFIIGLFCGLCTGFVPMYISEVSPTSLRGAFGTLNQLGIVVGILVAQIFGLEGIMGTEALWPLLLGFTIVPAVLQCVALLFCPESPRFLLINKMEEEKAQTVLQKLRGTQDVSQDISEMKEESAKMSQEKKATVLELFRSPNYRQPIIISITLQLSQQLSGINAVFYYSTGIFERAGITQ--PVYATIGAGVVNTVFTVVSLFLVERAGRRTLHLVGLGGMAVCAAVMTIALALK----------EKWIRYISIVATFGFVALFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGMLFPYAEKLCGPYVFLIFLVFLLIFFIFTYFKVPETKGRTFEDISRGFEEQVETSSPSSPPIEKNPMVE-MNSIEPDKE 494          
BLAST of slc2a-2 vs. UniProt/SwissProt
Match: sp|P20303|GTR1_PIG (Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa OX=9823 GN=SLC2A1 PE=2 SV=2)

HSP 1 Score: 286.574 bits (732), Expect = 7.456e-89
Identity = 168/511 (32.88%), Postives = 274/511 (53.62%), Query Frame = 1
Query:  106 NKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPI 1638
            + KK++  L+L V     GS + +GYN  VIN P   I+ F N+T L+      Y  S  I  +T+            L++ +  +F + G+IG+FS G   +  GRRN +L+ ++   I  ++ G +    +  +L +GRF IG+  G+T G   MY+ E++P A RGA+G  HQL + +GI+I  +  +   +  + LWP+  +   IPA+L   +LPFCPESPRF+ + ++     +    ++    DV   + E++EES     + K   +++F     R P++IA ++Q+ QQ+SGINAV  YS+S+   AG+ +    Y  I  G++N   T+VSL ++E+ GRRTL L     +AG  + +TI + L      +S         +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +++    W +N IV   +  + +  G Y F+ F V++++ ++F Y  +PETK RTFD++A     G    S K  + L  P+
Sbjct:    4 SSKKLTGRLMLAVGGAVLGS-LQFGYNTGVINAPQKVIEEFYNQTWLH-----RYGES--ISPATLTT----------LWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFISAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNEELWPLLLSVIFIPALLQCVLLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEESRQMMREKKVTILELFRSAAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQ--PVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLEQLPWMSY--------LSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPL 486          
BLAST of slc2a-2 vs. UniProt/SwissProt
Match: sp|Q27994|GLUT4_BOVIN (Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus OX=9913 GN=SLC2A4 PE=2 SV=2)

HSP 1 Score: 286.96 bits (733), Expect = 7.629e-89
Identity = 169/488 (34.63%), Postives = 269/488 (55.12%), Query Frame = 1
Query:  109 KKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVA 1572
            +++++  L+L VF    GS + +GYN+ VIN P   I+   N+T L    R        I   T+            L+A +  +F + G+I +F  G I+  +GR+  +L N+   ++GG + GL    ++  +L +GRFFIG  SG+T GL  MY+ EIAP   RGA+G  +QLA+  GI+I  +L +   L T +LWP+    T +PA+L + +LP CPESPR++++ ++     RK   R+    DV   + EL+EE    + +     +Q+      R PL+IA ++Q+ QQ+SGINAV  YS+S+  +AG+ +    Y  I  GV+N V TLVS+ L+E+ GRRTL L     + G  + +T+ + L      +S         +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +++    W  N I+   +  +  A+G Y FL F V+++  ++F +L +PET+ RTFD ++
Sbjct:   17 RQRVTGTLVLAVFSAVLGS-LQFGYNIGVINAPQKVIEQSYNETWLG---RQGPEGPGSIPPGTLTT----------LWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLFNNALAVLGGTLMGLAKAAASYEMLILGRFFIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVTGILIAQVLGLESMLGTATLWPLLLGITVLPALLQMVLLPLCPESPRYLYIIRNLEGPARKSLKRLTGWADVSEVLAELKEEKRKLERERPLSLLQLLGSHTHRQPLVIAIVLQLSQQLSGINAVFYYSTSIFESAGVEK--PAYATIGAGVVNTVFTLVSVFLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPAMSY--------VSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTCNFIIGMGFQYVADAMGPYVFLLFAVLLLGFFIFTFLKVPETRGRTFDQIS 480          
BLAST of slc2a-2 vs. UniProt/SwissProt
Match: sp|P11166|GTR1_HUMAN (Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2)

HSP 1 Score: 284.648 bits (727), Expect = 4.094e-88
Identity = 166/511 (32.49%), Postives = 273/511 (53.42%), Query Frame = 1
Query:  106 NKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPI 1638
            + KK++  L+L V     GS + +GYN  VIN P   I+ F N+T ++      Y  S  I  +T+            L++ +  +F + G+IG+FS G   +  GRRN +L+ ++   +  ++ G +    +  +L +GRF IG+  G+T G   MY+ E++P A RGA+G  HQL + +GI+I  +  +   +    LWP+  +   IPA+L   +LPFCPESPRF+ + ++     +    ++    DV   + E++EES     + K   +++F     R P++IA ++Q+ QQ+SGINAV  YS+S+   AG+ +    Y  I  G++N   T+VSL ++E+ GRRTL L     +AG  + +TI + L      +S         +S+  I  ++  F  G GP+P  IVAE+F Q PR AA +++    W +N IV   +  + +  G Y F+ F V++++ ++F Y  +PETK RTFD++A     G    S K  + L  P+
Sbjct:    4 SSKKLTGRLMLAVGGAVLGS-LQFGYNTGVINAPQKVIEEFYNQTWVH-----RYGES--ILPTTLTT----------LWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQ--PVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQLPWMSY--------LSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPL 486          
BLAST of slc2a-2 vs. TrEMBL
Match: A0A0H3YF13 (Slc2a-2 OS=Schmidtea mediterranea OX=79327 GN=slc2a-2 PE=2 SV=1)

HSP 1 Score: 1092.03 bits (2823), Expect = 0.000e+0
Identity = 537/537 (100.00%), Postives = 537/537 (100.00%), Query Frame = 1
Query:   73 MTNEHLVIDSQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTETVA 1683
            MTNEHLVIDSQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTETVA
Sbjct:    1 MTNEHLVIDSQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTETVA 537          
BLAST of slc2a-2 vs. TrEMBL
Match: A0A0H3YJW9 (Slc2a-3 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc2a-3 PE=2 SV=1)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 303/417 (72.66%), Postives = 362/417 (86.81%), Query Frame = 1
Query:  211 DRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNK 1461
            ++IKCFLN +IL VPC++A+   +  +N +V N    SIDA+FLYAQT TVFV+AGVIGAF+T W+ADL+GRRNGLL NH FVIIG IINGLTVKT   +LL+IGRFFIGINSGITIGLASMYLTEIAP  YRGAIGACHQLAVTLGIV+ Y+LTMT TLNT+ LWPVACACTAIPA++SL +LPFCPESPRFIFLK+    L RKEF R+N++EDVD F+ EL+EE++I+K+QP+FK  Q+FTQK+L++P++IAC IQVMQQ+SGINAVISYSSSML TAGIPEI+ QYCV+ IG+LNVVCTL+SLPLLEK GRRTLLLWPS++LA SLLFLT+ VNL +  G LS+Y Q++ GG+SVFFIMTY IGFA GLGPVPALIV+EIFRQEPRGAAYSISQ+IQWA +++VL +YP+MN 
Sbjct:    5 NKIKCFLNISILKVPCKEAFKQISINYNISVVNFTKSSIDADFLYAQTGTVFVVAGVIGAFATCWVADLLGRRNGLLFNHSFVIIGAIINGLTVKTGIAALLFIGRFFIGINSGITIGLASMYLTEIAPTRYRGAIGACHQLAVTLGIVVSYLLTMTQTLNTEILWPVACACTAIPAIISLFVLPFCPESPRFIFLKRSKEDLARKEFVRLNKIEDVDSFLRELREEAEISKNQPQFKMAQLFTQKDLKLPVMIACFIQVMQQLSGINAVISYSSSMLETAGIPEIFGQYCVLGIGILNVVCTLLSLPLLEKCGRRTLLLWPSVVLAISLLFLTVTVNLVSIPGYLSVYNQRIVGGVSVFFIMTYTIGFALGLGPVPALIVSEIFRQEPRGAAYSISQSIQWAMSILVLCAYPSMNN 421          
BLAST of slc2a-2 vs. TrEMBL
Match: A0A504YXM3 (Solute carrier family 2 facilitated glucose transporter member 3 OS=Fasciola gigantica OX=46835 GN=FGIG_01453 PE=3 SV=1)

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 312/524 (59.54%), Postives = 403/524 (76.91%), Query Frame = 1
Query:  112 KKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLS-IYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTETV 1680
            +K++  L+LTVF+TCFGSS L GYN+ ++NLPA  IK FL+KTIL    +D   +            E   ++ +FLYAQ ST FV+AG +GAFS GWIA+L+GRRNGL+LNHVF I+GGI+ G  V      LL++GRF +GIN GITIG+AS+YLTE+APR  RGAIGAC+QLAVT+GIV+ YI T+++TLNT +LWPV+ A  A+PA +SL +LPFCPESPRF+F+KK+N    RK F R+N  E+V+ F+GEL+EE ++AK+QP FKF Q+FTQ++LRMP++IACLIQV+QQ+SGINAVI+YSS+ML TAGIP+ Y+Q+CV  IGVLNV+ T+VSLPLLE+ GRRTLLLWP++ LA SLL LTI VNLA    TLS     +  G +S   I+ YI GFA GLGPVPALIV+EIFRQ PR AAYS+SQ++QW +NL+VL SYP++N+AIGGYSFLPFLVVV++CW+FF+L+MPET+ RTFD+VARDLAFG  V+ K+ +   +R +       E +   V
Sbjct:    6 QKLTFTLLLTVFMTCFGSSFLIGYNLGILNLPAPFIKAFLSKTILK---KDIVEAEK----------EKKFVNPSFLYAQVSTTFVVAGALGAFSCGWIAELLGRRNGLILNHVFAILGGILCGPCVIAEQAWLLFVGRFVLGINCGITIGIASIYLTEVAPRELRGAIGACNQLAVTIGIVVAYIATLSYTLNTKTLWPVSVALGAVPAFISLLVLPFCPESPRFLFVKKNNEAEARKAFARLNVQENVETFLGELREEMEVAKNQPAFKFTQLFTQRDLRMPVLIACLIQVLQQLSGINAVITYSSTMLRTAGIPDEYNQFCVTAIGVLNVIVTIVSLPLLERAGRRTLLLWPTVALAISLLLLTITVNLAT---TLSDAKAAQALGIVSALLILVYICGFALGLGPVPALIVSEIFRQGPRAAAYSLSQSLQWLSNLLVLCSYPSINEAIGGYSFLPFLVVVVVCWIFFFLFMPETRQRTFDEVARDLAFGNIVVGKRTATLEDRNMTVFTKQGERNVSNV 513          
BLAST of slc2a-2 vs. TrEMBL
Match: A0A4E0RGV2 (Solute carrier family 2 facilitated glucose transporter member 3 OS=Fasciola hepatica OX=6192 GN=D915_003952 PE=3 SV=1)

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 312/524 (59.54%), Postives = 403/524 (76.91%), Query Frame = 1
Query:  112 KKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLS-IYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTETV 1680
            +K++  L+LTVF+TCFGSS L GYN+ ++NLPA  IK FL+KTIL    +D   +            E   ++ +FLYAQ ST FV+AG +GAFS GWIA+L+GRRNGL+LNHVF I+GGI+ G  V      LL++GRF +GIN GITIG+AS+YLTE+APR  RGAIGAC+QLAVT+GIV+ YI T+++TLNT +LWPV+ A  A+PA +SL +LPFCPESPRF+F+KK+N    RK F R+N  E+V+ F+GEL+EE ++AK+QP+FKF Q+FTQ++LRMP++IACLIQV+QQ+SGINAVI+YSS+ML TAGIP+ Y+Q+CV  IGVLNV+ T+VSLPLLE+ GRRTLLLWP++ LA SLL LTI VNLA    TLS     +  G +S   I+ YI GFA GLGPVPALIV+EIFRQ PR AAYS+SQ++QW +NL+VL SYP++N+AIGGYSFLPFLVVV++CW FF+L+MPET+ RTFD+VARDLAFG  V+ K+ +   +R +       E +   V
Sbjct:    7 QKLTFTLLLTVFMTCFGSSFLIGYNLGILNLPAPFIKAFLSKTILK---KDIVEAEK----------EKKFVNPSFLYAQVSTTFVVAGALGAFSCGWIAELLGRRNGLILNHVFAILGGILCGPCVIAEQAWLLFVGRFVLGINCGITIGIASIYLTEVAPRELRGAIGACNQLAVTIGIVVAYIATLSYTLNTQTLWPVSVALGAVPAFISLLVLPFCPESPRFLFMKKNNEAEARKAFARLNVQENVETFLGELREEMEVAKNQPEFKFTQLFTQRDLRMPVLIACLIQVLQQLSGINAVITYSSTMLRTAGIPDEYNQFCVTAIGVLNVIVTIVSLPLLERAGRRTLLLWPTVALAISLLLLTITVNLAT---TLSDAKAAQALGIVSALLILVYICGFALGLGPVPALIVSEIFRQGPRAAAYSLSQSLQWLSNLLVLCSYPSINEAIGGYSFLPFLVVVVVCWTFFFLFMPETRQRTFDEVARDLAFGNIVVGKRTATLEDRNMTVFTKQGERNVSNV 514          
BLAST of slc2a-2 vs. TrEMBL
Match: G7YT59 (Solute carrier family 2 OS=Clonorchis sinensis OX=79923 GN=SLC2A3 PE=3 SV=1)

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 305/520 (58.65%), Postives = 400/520 (76.92%), Query Frame = 1
Query:  130 LILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNR--PIYDKVSTNENDTETVA 1683
            L LTVF+TCFGSS + GYN+A+INLP   IK FL + ILN                  N+  SG +DA FLYAQ ST FV+AG IGAFS+GW+A+L+GRRNGLLLNHVF IIGGII G TV  +  +LLY+GRF +G+NSGIT+G+A M LTE+APR  RGAIGAC+QLA+TLGI   Y++T++H LNT++LWP+AC+   +PA++SL  LPFCPESPR++F+KK++ T  R  F RIN  E V+ F+GEL+EE ++AK+QP+FKF Q+FTQK+LRMP++I C+IQV+QQ+SGINAVI+YS+SM+ TAG+P  Y +YCV+  G+LNV+ T+V+LPLLE+ GRRTLLLWP+++LA SLLF+TI V LA      S+  Q+  G +S   ++ Y   FA GLGPVP+LIV+EIFRQ PR AAYS+SQ+IQW +NL+VLFSYP+++K + GYSFLPFLV+VI CW+FF+L+MPET+NRTFD+VARDLAFG  V+ K+ +   +R   ++ K   N N+TE VA
Sbjct:   33 LALTVFLTCFGSSFIIGYNIAIINLPGTFIKKFLQEKILN------------------NSTGSGIVDAEFLYAQASTAFVVAGAIGAFSSGWVAELIGRRNGLLLNHVFAIIGGIIIGPTVYAAQPALLYLGRFIVGLNSGITMGIAPMLLTEVAPRELRGAIGACNQLAITLGIAFSYVVTLSHALNTETLWPIACSLVGVPALISLLTLPFCPESPRWLFVKKNDETAARLAFARINSKESVETFLGELREEMEVAKNQPEFKFTQLFTQKDLRMPILIGCIIQVLQQLSGINAVITYSASMMQTAGVPSQYIEYCVLANGILNVLMTVVALPLLERAGRRTLLLWPTLVLAASLLFMTITVTLAKKHPDASV--QQAMGILSAVLVLVYTAAFALGLGPVPSLIVSEIFRQGPRAAAYSLSQSIQWLSNLLVLFSYPSIDKRLEGYSFLPFLVIVICCWIFFFLFMPETRNRTFDEVARDLAFGNIVVGKRSATLEDRTMAVFQKDERNPNNTELVA 532          
BLAST of slc2a-2 vs. Ensembl Cavefish
Match: slc2a3a (solute carrier family 2, facilitated glucose transporter member 1-like [Source:NCBI gene;Acc:103021572])

HSP 1 Score: 303.138 bits (775), Expect = 1.608e-95
Identity = 175/496 (35.28%), Postives = 272/496 (54.84%), Query Frame = 1
Query:  106 NKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDAN---FLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLA 1584
             KK+++  L+ ++     GS + +GYN  VIN P  +++ F N+T +            P             IDA     +++    +F + G++G+FS G +AD  GRR  + + ++  +IGG + GL    S+  ++  GR  IG+  G+  GL  MY+ E++P   RGA G  HQL V +GI+I  I  +   L +D LWP+  A T IPAVL   +LPFCPESPR++ +  +     RK   R+   EDV   + E++EES     + K    ++F     R PL++A ++Q+ QQ+SGINAV  YS+ +  +AG+ +    Y  I  G++N V T+VSL L+E+ GRRTL L     +A S L +TI + L +   +LS         +S+  +  ++  F  G GP+P  IVAE+F Q PR AA +++    W AN IV  S+P + K  G Y F+ F+  +I+ ++F Y  +PETK RTFD++AR+ +
Sbjct:    6 EKKQVTCYLLFSLGTAVIGS-LQFGYNTGVINAPEQKLQAFFNETWVR-------RYGKP-------------IDAGVCTLVWSLAVAIFSVGGMVGSFSVGVVADKFGRRRSMFIVNILAVIGGSLMGLCTLCSSFEMVIAGRLVIGLFCGLFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVVGILISQIFGLEFLLGSDKLWPLLLALTVIPAVLQCLLLPFCPESPRYLLINLNKEEEARKALVRLRGFEDVSKDMQEMKEESVKMNMEKKVTIPELFRTATYRQPLLVAVVLQLSQQLSGINAVFYYSTGIFESAGVTQPI--YATIGAGIVNTVFTVVSLFLVERAGRRTLHLIGLGGMAISALLMTIALLLKHIE-SLSY--------LSIAAVFAFVAMFEMGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTANFIVGISFPKLEKLCGPYVFIIFMAFLILFFIFTYFRVPETKGRTFDEIAREFS 469          
BLAST of slc2a-2 vs. Ensembl Cavefish
Match: slc2a3a (solute carrier family 2, facilitated glucose transporter member 1-like [Source:NCBI gene;Acc:103021572])

HSP 1 Score: 295.819 bits (756), Expect = 1.119e-93
Identity = 170/470 (36.17%), Postives = 262/470 (55.74%), Query Frame = 1
Query:  175 YGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLA 1584
            +GYN  VIN P +++K F N+T +            PI        ++G      +++    +F + G++G+FS G +AD  GRR  + + ++  +IGG + GL    S+  ++  GR  IG+  G+  GL  MY+ E++P   RGA G  HQL V +GI+I  I  +   L +D LWP+  A T IPAVL   +LPFCPESPR++ +  +     RK   R+   EDV   + E++EES     + K    ++F     R PL++A ++Q+ QQ+SGINAV  YS+ +  +AG+ +    Y  I  G++N V T+VSL L+E+ GRRTL L     +A S L +TI + L +   +LS         +S+  +  ++  F  G GP+P  IVAE+F Q PR AA +++    W AN IV  S+P + K  G Y F+ F+  +I+ ++F Y  +PETK RTFD++AR+ +
Sbjct:    3 FGYNTGVINAP-EQVKAFFNETWVR-------RYGKPI--------DAGV--CTLVWSLAVAIFSVGGMVGSFSVGVVADKFGRRRSMFIVNILAVIGGSLMGLCTLCSSFEMVIAGRLVIGLFCGLFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVVGILISQIFGLEFLLGSDKLWPLLLALTVIPAVLQCLLLPFCPESPRYLLINLNKEEEARKALVRLRGFEDVSKDMQEMKEESVKMNMEKKVTIPELFRTATYRQPLLVAVVLQLSQQLSGINAVFYYSTGIFESAGVTQ--PIYATIGAGIVNTVFTVVSLFLVERAGRRTLHLIGLGGMAISALLMTIALLLKHIE-SLSY--------LSIAAVFAFVAMFEMGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTANFIVGISFPKLEKLCGPYVFIIFMAFLILFFIFTYFRVPETKGRTFDEIAREFS 443          
BLAST of slc2a-2 vs. Ensembl Cavefish
Match: slc2a1a (solute carrier family 2, facilitated glucose transporter member 1-like [Source:NCBI gene;Acc:103042991])

HSP 1 Score: 289.656 bits (740), Expect = 7.379e-91
Identity = 169/504 (33.53%), Postives = 273/504 (54.17%), Query Frame = 1
Query:   70 SMTNEHLVI---DSQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVA 1572
             MTN  L+    +++N K ++  L++ V     GS + +GYN  VIN P   I+ F N+T  N      Y+   P  + T             L+A + ++F + G+ G+FS G   + +GRRN +L+ +V   I   + G +   ++  +L IGR  +G+ SG++ G   MY+ EIAP   RGA+G  HQL + +GI++  +  +   +   ++WP     T IPA++   +LPFCPESPRF+ + ++     +    ++   +DV   I E++EES     + K    ++F     R PLIIA ++Q+ QQ SGINAV  YS+S+   AG+   Y  Y  I  G++N V T+VSL ++E+ GRR+L L   + +A S + +T+ + L      LS         +S+  I  ++  F  G GP+P  IVAE+F Q PR +A++++    W AN IV   +  + +  G Y F+ F V+++I +VF Y  +PETK RTFD+++
Sbjct:    7 QMTNNLLIFLISETKNYKHVTVQLMVAVGTAVIGS-LQFGYNTGVINAPQTTIESFYNETWFN-----RYSEYIPESSRTA------------LWALSVSIFSVGGIFGSFSVGLFVNRLGRRNSMLIANVLAFIAAGLMGFSKLAASWEMLIIGRLIVGLYSGLSTGFVPMYVGEIAPTTLRGALGTLHQLGIVIGILMAQVFGIDSIMGNATMWPFLLGFTFIPALIQCALLPFCPESPRFLLINQNEENKAKTVLKKLRGTDDVGADIQEMKEESRQMMREKKVTIPELFRSPLYRQPLIIAIMLQLSQQFSGINAVFYYSTSIFKKAGV--TYPVYATIGAGIVNTVFTVVSLFVVERAGRRSLHLVGLMGMAVSAVVMTVAMALTEKYQGLSY--------VSIVAIFIFVAFFEIGPGPIPWFIVAELFSQGPRPSAFAVAGFSNWTANFIVGMCFQYVEQLTGPYVFIIFTVLLLIFFVFTYFKVPETKGRTFDEIS 482          
BLAST of slc2a-2 vs. Ensembl Cavefish
Match: slc2a1b (solute carrier family 2, facilitated glucose transporter member 1-like [Source:NCBI gene;Acc:103036684])

HSP 1 Score: 286.96 bits (733), Expect = 4.240e-90
Identity = 163/510 (31.96%), Postives = 274/510 (53.73%), Query Frame = 1
Query:  103 QNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNR 1632
            + +KK++  L+L V     GS + +GYN  VIN P   I+ F N+T       D Y    PI ++ + +          L++ +  +F + G+ G+FS G   +  GRRN +LL +V   +   + G +   S+  +L  GRF +G+ SG++ G   MY+ E+AP A RGA+G  HQL + +GI++  +  +   +   ++WP     T IPA+    +LP CPESPR++ + ++  +  +    ++    DV   + E++EES     + K    ++      R PL+IA ++Q+ QQ+SGINAV  +S+++   AG+ +    Y  I  GV+N   T+VSL L+E+ GRR+L L   + +AGS + +TI + L N    +S         +S+  I  ++  F  G GP+P  IVAE+F Q PR +A++++    W AN IV   +  + +  G Y F+ F +++++ +VF Y  +PETK RTFD++A   +       +K ++ LN 
Sbjct:    2 EGEKKLTLQLMLAVGTAVIGS-LQFGYNTGVINAPQKIIESFYNETWF-----DRYQ--EPITDTALTS----------LWSLSVAIFSVGGIFGSFSVGLFVNRFGRRNSMLLANVLAFLAAALMGFSKMGSSWEMLITGRFVVGLYSGLSTGFVPMYVGEVAPTALRGALGTLHQLGIVVGILVAQVFGLDVIMGNATMWPFLLGFTFIPALAQCILLPMCPESPRYLLINRNEESKAKAALKKLRGTSDVSADMQEMKEESRQMMREKKVTIPELLRSSIYRQPLVIAVMLQLSQQLSGINAVFYFSTAIFEKAGVEQ--PVYATIGAGVVNTAFTVVSLFLVERAGRRSLHLIGLLGMAGSAILMTIALALLNQLEWMSY--------VSIVAIFAFVAFFEIGPGPIPWFIVAELFSQGPRPSAFAVAGFSNWTANFIVGMCFQYVERLCGPYVFIIFTILLVVFFVFTYFKVPETKGRTFDEIAAGFSQRAAGGVEKNTEELNH 483          
BLAST of slc2a-2 vs. Ensembl Cavefish
Match: slc2a1a (solute carrier family 2, facilitated glucose transporter member 1-like [Source:NCBI gene;Acc:103042991])

HSP 1 Score: 285.419 bits (729), Expect = 1.961e-89
Identity = 164/491 (33.40%), Postives = 266/491 (54.18%), Query Frame = 1
Query:  100 SQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVA 1572
              ++K ++  L++ V     GS + +GYN  VIN P   I+ F N+T  N      Y+   P  + T             L+A + ++F + G+ G+FS G   + +GRRN +L+ +V   I   + G +   ++  +L IGR  +G+ SG++ G   MY+ EIAP   RGA+G  HQL + +GI++  +  +   +   ++WP     T IPA++   +LPFCPESPRF+ + ++     +    ++   +DV   I E++EES     + K    ++F     R PLIIA ++Q+ QQ SGINAV  YS+S+   AG+   Y  Y  I  G++N V T+VSL ++E+ GRR+L L   + +A S + +T+ + L      LS         +S+  I  ++  F  G GP+P  IVAE+F Q PR +A++++    W AN IV   +  + +  G Y F+ F V+++I +VF Y  +PETK RTFD+++
Sbjct:    2 ESDRKHVTVQLMVAVGTAVIGS-LQFGYNTGVINAPQTTIESFYNETWFN-----RYSEYIPESSRTA------------LWALSVSIFSVGGIFGSFSVGLFVNRLGRRNSMLIANVLAFIAAGLMGFSKLAASWEMLIIGRLIVGLYSGLSTGFVPMYVGEIAPTTLRGALGTLHQLGIVIGILMAQVFGIDSIMGNATMWPFLLGFTFIPALIQCALLPFCPESPRFLLINQNEENKAKTVLKKLRGTDDVGADIQEMKEESRQMMREKKVTIPELFRSPLYRQPLIIAIMLQLSQQFSGINAVFYYSTSIFKKAGV--TYPVYATIGAGIVNTVFTVVSLFVVERAGRRSLHLVGLMGMAVSAVVMTVAMALTEKYQGLSY--------VSIVAIFIFVAFFEIGPGPIPWFIVAELFSQGPRPSAFAVAGFSNWTANFIVGMCFQYVEQLTGPYVFIIFTVLLLIFFVFTYFKVPETKGRTFDEIS 464          
BLAST of slc2a-2 vs. Ensembl Sea Lamprey
Match: SLC2A9 (solute carrier family 2 member 9 [Source:HGNC Symbol;Acc:HGNC:13446])

HSP 1 Score: 205.297 bits (521), Expect = 5.752e-60
Identity = 130/454 (28.63%), Postives = 233/454 (51.32%), Query Frame = 1
Query:  289 FNSTVNNVESGSIDAN---FLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDL----AFGTTVISKKKSQTLN 1629
            FN+T  +  S S+  N    L++ T  +  I G++GA    ++    GR+  LLLN+   I+  ++  L     +  +L++GRF +GI++GI++ +  MYL EI+P+  RG+ G    + + LG+  G +L +   L  +S W +      +P ++ L  LPF PESPR++ L++ +V    K   R+   +DV   + E+Q E              +  ++ +R  +I   +     Q+ G+NA+  Y+SS+   AGI    + Y +I+ G   V+  L+S   +EK GRR+LL+     +A     LT+ +NL ++   +S         +S+  ++  I  F  G G +P ++  E+F Q  R AA++I+  + W +N I+   +P +  A+  YSFL F  V +   +F Y  +PETK RTF +++R          ++++ +K +++N
Sbjct:    6 FNTTWVDRWSTSLSDNSVTLLWSFTIAIMSIGGLVGALIMRFMVQRFGRKGTLLLNNALAILAALLMSLCFLAGSWEMLFLGRFVVGIDAGISLSVLPMYLAEISPKNLRGSTGQVSAIFICLGVFTGQVLNLKEVLGQESHWSILFGILVVPPLVQLATLPFMPESPRYLLLERQDVKAAEKALQRLLGRQDVQREMVEIQAEGIAQAHISVMSLWGLLRERAVRWQVITVAITMACYQLCGVNAIWFYASSIFRQAGIDPAITPYIIISTGGTEVLAALLSGLAIEKLGRRSLLIVGFGAMAVIFGVLTVALNLQDSYHWMSY--------LSIACVLAVIASFCIGPGGIPFVLTGELFEQSYRPAAFTIAGIVSWLSNFILSLVFPFIQTALDAYSFLVFAAVCLGAAIFLYFVLPETKKRTFMEISRSFDKLNKVQASILALEKRESVN 451          
BLAST of slc2a-2 vs. Ensembl Sea Lamprey
Match: slc2a11a (solute carrier family 2 member 11a [Source:ZFIN;Acc:ZDB-GENE-080723-20])

HSP 1 Score: 175.252 bits (443), Expect = 1.042e-48
Identity = 139/496 (28.02%), Postives = 239/496 (48.19%), Query Frame = 1
Query:  124 PILILTVFI--TCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPE----IYSQYCVITIGVLNVVCTLVSLP-LLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFS----YPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARD 1578
            P+L L V +  T  G S  YG+N++VI+ P   I+ F+N T     C   Y +     +  V            L++   +VF + G +GA   G +A  +GR+  LL N+ F ++  ++ G++   ++  L+ IGR  IGIN G+ + L  M+L E AP+  RG +     L +  GIV G I+ +   +  + +WP   A T +PA++ L +LP  PESPRF+ + + +     K    +    DV   + E++ E    + Q K   + +      R  LI   ++   QQ+ G++       S +    +      ++  +    + V+  V T       +E+ GRR LL+   ++++   + +T+ ++L +      +    VFG         YI+ F  G G V  ++ AE+F QE R AAY I+ +  W    I LFS    +P M K +G + FL FLV  + C ++ Y  +PET+N++F ++A++
Sbjct:   17 PVLRLCVLVAATGIGGSFQYGFNISVISAPTTHIQRFINTT-----CEQRYGAG---LDQHV---------LTLLWSTVVSVFTLGGCLGALLAGPLAIRLGRKGALLFNNGFAVLAAVLMGVSRPATSFELIIIGRLLIGINCGVGLSLQPMFLGESAPQHLRGIMAMGGILFLPFGIVSGQIMGLRELMGEEEMWPFLLALTVVPALVQLAVLPLLPESPRFLLIDRDDRKRCLKALQWLRGAGDVTDEMAEMRAEHAKLQGQKKKMPLDLLRDPSQRWQLITVVVMGAGQQLCGLDVXPPPPCSAMTIVVVRSFEVALHPVFVGGGVYVVEPVRTKTQRGYFIERAGRRPLLIGGYMMMSVVCVVMTVSLHLQSVEWMPYLSATCVFG---------YILSFGIGPGGVTGMMAAELFTQEARPAAYMINGSCNW----IFLFSIGMVFPFMVKELGSFCFLVFLVDCVCCALYIYFILPETRNKSFLEIAQE 482          
BLAST of slc2a-2 vs. Ensembl Sea Lamprey
Match: slc2a11b (solute carrier family 2 member 11b [Source:NCBI gene;Acc:564970])

HSP 1 Score: 114.775 bits (286), Expect = 7.530e-29
Identity = 81/292 (27.74%), Postives = 145/292 (49.66%), Query Frame = 1
Query:  697 DSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVA 1572
              LW V  A   +PA+  L +LPF PESP ++ + +      R+E + +    D ++     ++E     S+       +   +  R  LI   L+ V QQ+SG+NA+  YS+ +   A IPE    Y  +  G   ++  +    L++  GRR LLL   +L+  SL    I V+LA    ++ +        +SV     YI+ F  G G +  ++ AE+F Q+ R AA+ IS ++ W +  ++   +P + + +G Y F+ F+V  ++  +   + +PETK+R+F +++
Sbjct:    3 QQLWAVVLALPVLPALTQLLVLPFFPESPCYLLIDRGQPQQARQELSPLEHRLDEELLAMRAEQEQ---MSEGPRSVWDVMRNRGTRWQLITVLLLNVTQQLSGLNAIYFYSTYVFKEAKIPEEKIPYVTLGTGAAEIITAMSCGMLVDGLGRRPLLLCGYVLM--SLCCAAITVSLALQERSIWM------PYLSVALTFAYILSFGIGPGGIMGILPAELFMQDSRSAAFVISGSVNWFSFFLIGLLFPFLVEGMGPYCFVFFMVDCVMGSIIVCILLPETKDRSFVEIS 283          
BLAST of slc2a-2 vs. Ensembl Sea Lamprey
Match: slc2a10 (solute carrier family 2 member 10 [Source:NCBI gene;Acc:560546])

HSP 1 Score: 56.9954 bits (136), Expect = 3.852e-9
Identity = 66/278 (23.74%), Postives = 126/278 (45.32%), Query Frame = 1
Query:  400 GWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSL--------WPVACACTAIPAVLSLCILPFC-PESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKE-LRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIP-EIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSL 1200
            G + D +GRR+ +  +   ++ G     L    S  +LL  GR  +G+    +     +Y+ E+A    RGA+ + ++L VT G++  Y   +                 W     C  +PA+  + +L  C P SP  + L+        +   RI   +DV   I  L+   ++ K   ++  + +  +K+ +R  ++I   +   QQ++G   V+ Y++S+   AG   E       + +G++ V  T V++ ++++ GRR  LL  S+ +A SL
Sbjct:   64 GPLLDRLGRRSAVACSGALLVTGSAF--LACAPSYAALLG-GRAVVGVAIAASSVATCVYVAEVAHPRRRGALVSAYELGVTGGVLAAYAANLVLGRGPGGTVGGVAPWRWMFGLCC--VPALAQVMLLVACLPASPSSL-LRCGQAEAAERTLRRILGQQDVSAEIDALRSSLEMEK---QYSVLDLLRRKDSMRTRMLIGGGLVAFQQLTGQPTVLFYAASVFRAAGYRGEASVLLASVGLGLVKVAATSVAVAVVDRVGRRRSLLAGSVAMALSL 332          
BLAST of slc2a-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002434.1 (pep scaffold:Pmarinus_7.0:GL479978:1522:11010:-1 gene:ENSPMAG00000002223.1 transcript:ENSPMAT00000002434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 2.020e-6
Identity = 27/97 (27.84%), Postives = 54/97 (55.67%), Query Frame = 1
Query:  931 QIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQ-YCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIF 1218
            ++      R  L++ C +Q+ QQ++GIN V+ YS+++L  AG+ +  +  +        N + + + + L+E+ GRR L L   I +AG+++ L + 
Sbjct:    6 KMIKHPPTRRALVVGCGLQMFQQLAGINTVMYYSATILQMAGVADDSTAIWLASATAFTNFIFSALGVWLVERVGRRQLSL---ISMAGAIVSLALL 99          
BLAST of slc2a-2 vs. Ensembl Yeast
Match: YBR241C_mRNA (Putative transporter, member of the sugar porter family; green fluorescent protein (GFP)-fusion protein localizes to the vacuolar membrane; YBR241C is not an essential gene; YBR241C has a paralog, VPS73, that arose from the whole genome duplication [Source:SGD;Acc:S000000445])

HSP 1 Score: 137.117 bits (344), Expect = 2.405e-35
Identity = 123/495 (24.85%), Postives = 229/495 (46.26%), Query Frame = 1
Query:  103 QNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCF-LNKTILNVPCRDAYNSSNPIFNS-TVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFI----FLKKHNVTLTRKEFTRINQ----LEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRT 1557
            + K  I+  LIL   + C GS + YGY++A +N P + + C        N+   D +   + +     + + + G+I         +++F I G+ G++  G  A+  GR+   +      ++  ++  L    S + LL+ GRF +G++ G  I +  +++ EIAP  +RGA+G+ +Q+++ LGI++   L + +  + +  W +     ++ AV ++       ESPR++    F+ +    L +       Q    ++D     G  ++     ++       Q  T    + P  +   I   QQ  GIN++I Y   ++    +P+ YS      I +LNVV TL +  +++  GRR LLL  + ++    L +++ + L+ +           F  ++  F+  YI  FA GLGP+P LI+ E+   +    A S      W A  IV + +P  +  +GGY F  F  +  +   + Y  +PETK +T
Sbjct:   15 ETKPLITGHLILGTIVACLGS-IQYGYHIAELNAPQEFLSCSRFEAPDENISYDDTWVGQHGLKQCIALTDSQYGAI---------TSIFSIGGLFGSYYAGNWANRYGRKYVSMGASAMCMVSSLL--LFFSNSYLQLLF-GRFLVGMSCGTAIVITPLFINEIAPVEWRGAMGSMNQVSINLGILLTQTLALKYADSYNWRWLLFSG--SVIAVANILAWLKVDESPRWLVSHGFVSEAETALFKLRPGTYQQAKQEIQDWQRSHGHNRDPESSEETHSGPTLWQYVTDPSYKKPRTVILAILSCQQFCGINSIIFYGVKVIGKI-LPD-YSIQVNFAISILNVVVTLAASAIIDHVGRRPLLLASTTVMTAMSLLISVGLTLSVS-----------FLLVTATFV--YIAAFAIGLGPIPFLIIGELSYPQDAATAQSFGTVCNWLATFIVGYLFPIGHGLMGGYVFAIFAAIAAMFATYVYKRVPETKGKT 479          
BLAST of slc2a-2 vs. Ensembl Yeast
Match: HXT14 (Protein with similarity to hexose transporter family members; expression is induced in low glucose and repressed in high glucose; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000005262])

HSP 1 Score: 126.716 bits (317), Expect = 1.406e-31
Identity = 118/430 (27.44%), Postives = 202/430 (46.98%), Query Frame = 1
Query:  358 TVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMT-----HTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEE-----------SDIAKSQPKFK---FIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMT--YIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIG---GYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVAR 1575
            ++F I+  +GA +   I D +GR+ G+    V   IG  I  L+        L +GR   GI  G+T  L  M+L+E +P   RG++ + +QL VT GI++G IL             +  W +      I A++    L + PESP+++   K++V   +  F R+N +   D  + E  ++           ++ +K Q   K   F  I  + +L + LII  +I   QQ+SGIN    Y +S+    GI + Y     I +  +N + T++ +  +EK+G +T LL+ S     +LLF  +         T+  +G++      V  I+T  +I  FA  LGPV  ++V+E+F    R  + +I   I W  N ++    P +   I    GY F   L+ +II   F ++ +PET+ +   ++ +
Sbjct:  123 SIFNISCGVGALTLSKIGDWIGRKGGIWFALVVYCIGITIQILSY--GRWYFLTLGRAVTGIGVGVTTVLVPMFLSENSPLKIRGSMVSTYQLIVTFGILMGNILNFICERCYKDPTQNIAWQLPLFLGYIWAIIIGMSLVYVPESPQYLAKIKNDVPSAKYSFARMNGIPATDSMVIEFIDDLLENNYNNEETNNESKKQSLVKRNTFEFIMGKPKLWLRLIIGMMIMAFQQLSGINYFFYYGTSVFKGVGIKDPY--ITSIILSSVNFLSTILGIYYVEKWGHKTCLLYGST----NLLFYMM------TYATVGTFGRETDFSNIVLIIVTCCFIFWFAITLGPVTFVLVSELFPLRTRAISMAICTFINWMFNFLISLLTPMIVSKIDFKLGYIFAACLLALII---FSWILVPETRKKNEQEINK 535          
BLAST of slc2a-2 vs. Ensembl Yeast
Match: HXT13 (Putative transmembrane polyol transporter; supports growth on and uptake of mannitol and sorbitol with moderate affinity when overexpressed in a strain deleted for hexose family members; minor hexose transport activity when overexpressed in a similar strain; induced by non-fermentable carbon sources; induced in low glucose, repressed in high glucose; HXT13 has a paralog, HXT17, that arose from a segmental duplication [Source:SGD;Acc:S000000795])

HSP 1 Score: 125.176 bits (313), Expect = 7.372e-31
Identity = 120/468 (25.64%), Postives = 218/468 (46.58%), Query Frame = 1
Query:  358 TVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYI-LTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRF-IFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIA----KSQPKFKFIQIFTQK-ELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQ-----KVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIG---GYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTETVA*NIVVRFHKTN 1716
             +F I   IG      +AD +GRR  +++  +  ++G II             ++G+   G+ +G    L  M L+EIAP   RG + + +QL +T GI +GY  +  T   +  + W V      + A++ +  +   PESPR+ I  ++H     R    +IN++   D ++ +  +E +      +   +  + ++F+ K ++   LI   L+Q   Q++G N    Y +++  + G+ + +     I +G +N   T++++ +++K GRR  LL+ +   AG +  + IF ++      L  +GQ     K  G   + F   YI  FA    PV  ++VAE F  + +  A SIS A  W    ++ F  P +  +I    GY F+  LV + + +VFF+L  PET   + +++      G   I   KS +   P    +S+ E+ TE       ++F K +
Sbjct:  113 AMFSIGCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQ--ISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWALIIIIGMLLVPESPRYLIECERHEEA--RASIAKINKVSPEDPWVLKQADEINAGVLAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFET--SIVLGTVNFFSTIIAVMVVDKIGRRKCLLFGA---AGMMACMVIFASIGVK--CLYPHGQDGPSSKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFL-YVFFFL--PETIGLSLEEIQLLYEEG---IKPWKSASWVPPSRRGISSEESKTEKKDWKKFLKFSKNS 563          
BLAST of slc2a-2 vs. Ensembl Yeast
Match: HXT3 (Low affinity glucose transporter of the major facilitator superfamily; expression is induced in low or high glucose conditions; HXT3 has a paralog, HXT5, that arose from the whole genome duplication [Source:SGD;Acc:S000002753])

HSP 1 Score: 122.865 bits (307), Expect = 3.899e-30
Identity = 108/420 (25.71%), Postives = 198/420 (47.14%), Query Frame = 1
Query:  358 TVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTM-THTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGE----LQEESDIAKSQPKFKFIQIFTQK-ELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSI-LLAGSLLFLTIFVN--LANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFG 1590
            ++F I   IG      + D+ GR+ GL++  V  II   I       +     +IGR   G+  G    L+ M ++E+AP+  RG + +C+QL +TLGI +GY     T   +    W V        A+  +  + F PESPR++ ++   +   R   +++N++     FI +    ++   + A++     + ++FT K  +    ++  +IQ +QQ++G N    Y +++ N  G+ + +     I  GV+N   T  SL  +++FGRR  LL+ +I ++   +++ ++ V     N  G  S  G    G   + F   YI  FA    P+  ++++E F    +  A SI+ A  W    ++ F  P +  AI  Y    F+  ++  + + + ++PETK  T ++V    A G
Sbjct:  117 SIFNIGCAIGGIILAKLGDMYGRKMGLIVVVVIYII--GIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKEMRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYL-VEAGQIDEARASLSKVNKVAPDHPFIQQELEVIEASVEEARAAGSASWGELFTGKPAMFKRTMMGIMIQSLQQLTGDNYFFYYGTTVFNAVGMSDSFET--SIVFGVVNFFSTCCSLYTVDRFGRRNCLLYGAIGMVCCYVVYASVGVTRLWPNGEGNGSSKGA---GNCMIVFACFYIFCFATTWAPIAYVVISETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNDMYAEG 528          
BLAST of slc2a-2 vs. Ensembl Yeast
Match: HXT5 (Hexose transporter with moderate affinity for glucose; induced in the presence of non-fermentable carbon sources, induced by a decrease in growth rate, contains an extended N-terminal domain relative to other HXTs; HXT5 has a paralog, HXT3, that arose from the whole genome duplication [Source:SGD;Acc:S000001138])

HSP 1 Score: 122.865 bits (307), Expect = 4.549e-30
Identity = 106/413 (25.67%), Postives = 189/413 (45.76%), Query Frame = 1
Query:  358 TVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTM-THTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQ-LEDVDIFIGELQ------EESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSI-LLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDV 1569
            ++F I   IG      + D+ GR+ GL+   V VI    I             +IGR   G+  G    LA M ++E++P+  RG + +C+QL +T GI +GY     T   +    W V        ++  +  + F PESPR++ ++   +   ++   R N+  ED  +   E++      E   +A S    + +    Q   R   ++  +IQ +QQ++G N    Y +++    G+ + +     I +GV+N V T  SL  +++FGRR  LLW  + ++   +++ ++ V     +G       K  G   + F   YI  FA    PV  ++++E +    RG A SI+ A  W    ++ F  P +  AI  Y    F+  ++  + + + ++PETK  T ++V
Sbjct:  141 SIFNIGCAIGGIVLSKLGDMYGRKIGLMT--VVVIYSIGIIIQIASIDKWYQYFIGRIISGLGVGGITVLAPMLISEVSPKQLRGTLVSCYQLMITFGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWSIFMIVGMTFVPESPRYL-VEVGKIEEAKRSLARANKTTEDSPLVTLEMENYQSSIEAERLAGSASWGELVTGKPQMFRRT--LMGMMIQSLQQLTGDNYFFYYGTTIFQAVGLEDSFET--AIVLGVVNFVSTFFSLYTVDRFGRRNCLLWGCVGMICCYVVYASVGVTRLWPNGQDQP-SSKGAGNCMIVFACFYIFCFATTWAPVAYVLISESYPLRVRGKAMSIASACNWIWGFLISFFTPFITSAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEV 545          
BLAST of slc2a-2 vs. Ensembl Nematostella
Match: EDO35120 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMF8])

HSP 1 Score: 269.24 bits (687), Expect = 1.314e-83
Identity = 159/506 (31.42%), Postives = 261/506 (51.58%), Query Frame = 1
Query:   97 DSQNKK-----KISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIF-VNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTT 1596
            D ++ K     K++  L     +   GSS  +GYN + IN P   IK +                    F S  N        ++F ++    +F I G+IGA +    A+  GR+  LL N+   I+G ++  L+    T  LL +GRF IGIN G+   +A +YL+E+AP   RG++G  +Q  +  G+++G+I  +   L T   W      + +PAV  L  LP+CP SPR++ ++        +   ++   +DV   I E++ E D   +      +Q+F +++L+MPL+I C++ + QQ+ GINAV+ YS+S+    G+PE  S+     IGV+ +V T +++ L+E  GRRTL+L   I L G  LF T+  +     S T   Y       ++V   +T ++ F  G G +P  I AE+F Q PR AA +++  + WA N I+  ++P+M  A+  Y+F+ F+ +V I W F + ++PETK RT +D+      G +
Sbjct:   15 DEESSKRVKGGKLTFWLAYATLVCILGSSFQFGYNTSCINAPEQDIKTY--------------------FRSIGNY-------SDFEWSIAVAIFAIGGMIGALAGPLFANRFGRKRSLLANNGLAIVGALLMFLSYFAKTSPLLTVGRFVIGINCGMNTAIAPIYLSELAPIHLRGSLGTLNQFGIVSGLLVGFIFGLKQVLGTSKGWQYLLGFSILPAVFQLVTLPWCPNSPRYLLIELDQELQAVEALRKLRATDDVTEDINEMKIERDREATTEHVSVLQLFVRRDLQMPLLIGCVMMMAQQLGGINAVLYYSTSIFEKVGVPE--SRVATTGIGVVALVFTAIAVRLVEVLGRRTLML---IGLGGMFLFYTVMTIAFCFESSTGMKY-------VAVVATLTLVVFFMIGPGAIPWFITAEMFSQGPRPAACAVAATVNWATNFIIGIAFPSMQVALYPYTFIVFMALVAIFWTFTFFFVPETKGRTIEDITDHFRGGDS 481          
BLAST of slc2a-2 vs. Ensembl Nematostella
Match: EDO42667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0Y9])

HSP 1 Score: 251.136 bits (640), Expect = 3.149e-77
Identity = 153/485 (31.55%), Postives = 246/485 (50.72%), Query Frame = 1
Query:  130 LILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFG-GISVFFIMTYIIGFAFGL-GPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARD 1578
            LI    +   GSS  +GYN A IN P +               R++       F +    +      A + ++    +F   G++GA     +++++GR+  LL N+    IG I   ++    +  LL IGR FIGIN+G+   +  +YL+EI+P   RG++G  +Q  +  GI++GYI  +   L + S WP     + +PA++ +  LPFCP SPR++ LK++           +    DV   I E++ E + +  +P      +F  K LRMPL+I  ++Q+ QQ+SGIN+VI YS+++L+ A IP   S+Y  + +G+++      S  L+E  GRRTL+LW                      G   +YG    G  + V   M  +    F   GP+P  I AEIF Q PR AA +++  + W +N I+   +P++ KA+  Y+F+ FLV+V+  W+F Y  +PETK R+ DD+ R 
Sbjct:    4 LIYATAVAVLGSSFQFGYNSACINSPVE--------------VRESRPDIKKYFKTQHKPL------ATYDWSIIVGIFPFGGMLGALVGPTLSNIIGRKRCLLYNNFIAAIGSISMIVSYYVVSSPLLIIGRIFIGINAGLNTAVVPIYLSEISPIQLRGSLGTLNQFGICFGILLGYIFGLKEVLGSGSKWPWLIGFSIVPAIIQMMTLPFCPRSPRYLLLKRNKEADAVHALQILRGTNDVSEDIAEMRIEQEQSLREPHVSVTSLFRLKHLRMPLLIGVVMQMSQQLSGINSVIYYSTTILDEAHIPG--SRYATLGVGIISPDKDR-SGGLVEVLGRRTLMLW-------------------GLGGMCIMYGVITLGFSLKVRSCMESLPWVLFSYTGPIPWFITAEIFSQGPRPAACTVAAVVNWLSNFIIGIGFPSLQKALDPYTFIVFLVLVLGFWLFTYFLVPETKGRSIDDITRQ 446          
BLAST of slc2a-2 vs. Ensembl Nematostella
Match: EDO32615 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUJ6])

HSP 1 Score: 142.895 bits (359), Expect = 4.039e-37
Identity = 112/412 (27.18%), Postives = 195/412 (47.33%), Query Frame = 1
Query:  370 IAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASM----YLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLE-DVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAI---GGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDL 1581
            I  ++G    G++ DL+GR+  L+L  V    G ++ G        ++L  GRF     SG+ +G+AS+    Y++E A  + RGA+G+ +QL +T GI+I Y +           W  +    + PA L + ++ F PE+ R++  KK   T  RK    +   + D+D  + E++   D    +   K    F    L  P +I+  +   QQ SGINA + Y +++   AG  +       I IG +  V + +SL L+++ GRR LL+   + ++ S     ++  +    G   +        +SV  +  YI+GFA G GP   LI++EIF    RG A  I+    W  + +V  ++  +   +   G + F    V   +  +F Y ++PETK +T +++  + 
Sbjct:   51 IGAMLGGPIQGFLIDLIGRKFALILTSVPFCSGWLLIGFG---KNAAMLNAGRFM----SGLGVGMASLNVPVYISETASFSNRGAMGSINQLGITAGILISYAIGYAFD------WRWSAVAGSFPAALLVVLMAFMPETARWLIAKKKE-TRARKTLLWLRGPDYDIDKELCEIKASIDTQNQRFSLK---EFKNPSLLRPFLISMSLHFFQQFSGINAFMFYCATIFQKAGFKD--PTGVPILIGAVQFVASAISLALIDRGGRRFLLIVAGVGMSISCFTCAVYFFITVNFGMTEV----DIAWLSVTSVAVYIVGFALGWGPCTWLIMSEIFPVRARGTATGIATFFNWFCSFVVTKTFSALIDGLTEAGTFCFFGAFVFASV--LFVYFFVPETKGKTLEEIQTEF 437          
BLAST of slc2a-2 vs. Ensembl Nematostella
Match: EDO42861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E6])

HSP 1 Score: 137.887 bits (346), Expect = 2.826e-35
Identity = 130/452 (28.76%), Postives = 220/452 (48.67%), Query Frame = 1
Query:  355 STVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIG-ELQEESDIAKSQPKFKFIQI-----FTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSIL-LAGSLLFLTIFVNL----------ANASGTLSIYGQKVFGGISVFFIMTYIIG---FAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAI---------GGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQT 1623
            S++  +  ++GA   GW  +  GR+  ++   V   +G +   L    ++  +LYIGRF  G+  G+      +Y+ EI+  + RG +G+ +QLAVT+G+++ Y  +M   L    L   AC+    PA+L + ++ F PE+PR+        +L+ K   R + L+ +  F G E   E +  + +      Q      F +  +  PL I+  +   QQ  GINA++  S+S+ + AG  +  S+   + IG +  V T ++  +++K GR+ LLLW + L +  SL+ L  +  L             +   SI+     G IS   I + ++    FA   GPVP L+++EIF  + RG A SIS    W+    V  ++ N+  AI         GG SFL FL V+        +++PETK +T + + R L  GT V  +++ Q+
Sbjct:   48 SSLVTLGAILGAPLGGWTLEYFGRKGTIMACAVPFEVGWM---LIAYANSHYMLYIGRFITGLAVGMVSLTVPVYIAEISSPSLRGMLGSVNQLAVTMGLLLAY--SMGVVLKWRWL---ACSGAIFPALL-VVLMFFVPETPRW--------SLSHKR--RRDALDAMMWFRGPEADVEEECYRIEATMDNTQSMSCAEFCRPAIMKPLFISIALMFFQQFCGINAILFNSASIFHQAGFQD--SKAVSVIIGAVQFVGTGIACLVVDKAGRK-LLLWTTALGMTVSLIALGFYFELYIPTTQEQPTPTPALLESIHHSIPAGKISWLAITSIVVFNLVFALAWGPVPWLVMSEIFPLQARGIASSISTLCNWSLAFAVTKTFVNIEDAITIQGTYWFYGGLSFLGFLFVL--------MFVPETKGKTLEQIER-LFDGTLVTPREEIQS 468          
BLAST of slc2a-2 vs. Ensembl Nematostella
Match: EDO42862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E7])

HSP 1 Score: 112.079 bits (279), Expect = 1.628e-26
Identity = 97/353 (27.48%), Postives = 167/353 (47.31%), Query Frame = 1
Query:  400 GWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFC-PESPR-FIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGG------------ISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQW 1416
            G+I D  GR+  L+L+ V   +G +   L       +++Y GRF  G+  G+       Y+ EI+    RGA+G+ HQL++T G+++ YI  +           +A A   IP V  L +L FC PE+PR F+   +    L   E+ R     D++    E++   D   +  K  F + F +  +R PLI+   + V QQ+ G   V+   +S+  +AG     S+   I +G       +++  +++K GRR LL+  ++L+  S + L  +  L       S++   V  G            +++  I+ + + F+   GPVP L+++EIF    RG A SI+ +  W
Sbjct:  102 GFIVDRFGRKATLMLSAVPSELGWL---LIAFAQNHAMMYAGRFIAGLGIGLIAVAVPTYIAEISSAKLRGALGSVHQLSITAGLLLAYIFGVFFKWRA-----IALAGAIIPGV--LVVLMFCVPETPRWFLGHNERGAALKSLEWFR-GPNGDIEQECFEIECTLD---THEKLTFSE-FLRPAIRNPLIVGVGLMVFQQLCGAIVVVFNCASIFKSAGFDN--SKAVSILLGASQFGANIIACLIMDKIGRRILLMSMALLMCISHIGLGTYFELIIIPSNSSLHNSTVHSGLIHSIPSSYISWLAITCIIVFNVAFSLAWGPVPWLVMSEIFPLRARGVAGSIATSAAW 437          
BLAST of slc2a-2 vs. Ensembl Medaka
Match: slc2a3b (solute carrier family 2, facilitated glucose transporter member 3 [Source:NCBI gene;Acc:101167147])

HSP 1 Score: 330.487 bits (846), Expect = 1.400e-106
Identity = 187/529 (35.35%), Postives = 292/529 (55.20%), Query Frame = 1
Query:   97 DSQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTETVA 1683
            D + KKK++P L+  V     GS + +GYN  VIN P  +++ F           D Y    P    T+  V S ++           +F + G+IG+FS G + ++ GR+  +++ ++  ++GG + GL+  T +  ++ +GRFFIG+  G+  GL  MY+ EI+P A RGA G  HQL V +GI++  I  +   L +D LWP+  A T +PAVL   +LPFCPESPR++ +  +     RK   R+   EDVD  I E++EE      + K   +++F     R P+IIA ++Q+ QQ+SGINAV  YS+ +  TAG+ +    Y  I  GV+N V T+VSL L+E+ GRRTL L     +A S L +TI ++L   + +LS         +++  +  ++  F  G GP+P  IVAE+F Q PR AA ++S    W AN +V   +P + +  G Y FL F+V++I+ ++F YL +PETK RTFDD+A+  +          ++  + P+ D V  +  D +  A
Sbjct:    6 DDKPKKKVTPYLLYCVSTAVIGS-LQFGYNTGVINAPEQKLRQFFQNV-----STDRYG--EPFSQGTITTVWSFAV----------AIFSVGGMIGSFSVGTMVNIFGRKKSMMITNILALVGGGLMGLSSLTKSFEVVIVGRFFIGVFCGLCTGLTPMYVGEISPTALRGAFGTLHQLGVVIGILVAQIFGLEFLLGSDELWPLLLALTILPAVLQSIMLPFCPESPRYLLIVLNKEEEARKALVRLRGCEDVDDDIQEMKEEGMKMAMEKKVTILELFRSPNYRQPIIIAIILQLSQQLSGINAVFYYSTGIFQTAGVTQ--PIYATIGAGVVNTVFTVVSLFLIERAGRRTLHLIGLAGMAISALVMTISLSLVKTNESLSY--------LAIVAVFGFVASFEMGPGPIPWFIVAELFSQGPRPAAMAVSGCSNWTANFLVGLGFPKLEELCGPYVFLIFMVLLILFFIFTYLRVPETKGRTFDDIAQGFS----------AKPAHSPVPDSVVISSPDNKEPA 496          
BLAST of slc2a-2 vs. Ensembl Medaka
Match: slc2a3a (solute carrier family 2, facilitated glucose transporter member 1 [Source:NCBI gene;Acc:101173640])

HSP 1 Score: 283.493 bits (724), Expect = 7.113e-89
Identity = 168/490 (34.29%), Postives = 255/490 (52.04%), Query Frame = 1
Query:  166 SMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRP 1635
            S+ +GYN  VIN P  +++ F N T +            PI       V S ++           +F + G++G+ S G +A+  GRR  + + +   +IGG++ G +   S+  ++  GR  IG+  G   GL  MY+ E++P   RGA G  HQL V LGI+I  I  +   L ++ LWP+  A T  PAVL   +LPFCPESPRF+          RK   R+   EDV   + E++EES     + K    ++F     R PL+IA ++Q+ QQ+SGINAV  YS+ +  +AG+ +    Y  I  G++N + T+VSL L+EK GRRTL L     +A   L +TI + L +               +++  IM ++  F  G GP+P  IVAE+F Q PR AA +++    W AN +V  S+P + +  G + FL F   +I+ ++F Y+ +PETK RTF++++R   F     S K  Q    P
Sbjct:    8 SLQFGYNTGVINAPEQKLRSFFNNTWVE-------RYGEPISPGVCTIVWSIAV----------AIFSVGGMVGSVSVGVLANRFGRRRSMFIVNSLAVIGGLLMGFSTVCSSYEMVIAGRLVIGLFCGFFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVLGILIAQIFGLEALLGSEKLWPLLLALTVAPAVLQCILLPFCPESPRFLLCNLKLEEQARKVLVRLRGTEDVSKDLQEMKEESAKMAQEKKVTIPELFRLASYRQPLLIAVMLQLSQQLSGINAVFYYSTGIFQSAGVKQ--PIYATIGAGIVNTIFTVVSLFLVEKAGRRTLHLLGLGGMAIGALVMTISLLLKDI---------PAMSYVAIIAIMFFVAMFELGPGPIPWFIVAELFSQGPRPAAMAVAGCCNWTANFLVGMSFPKLEEWCGPWVFLIFTAFLILFFIFTYIKVPETKGRTFEEISR--VFSGAPFSPKGPQNTEMP 467          
BLAST of slc2a-2 vs. Ensembl Medaka
Match: slc2a3a (solute carrier family 2, facilitated glucose transporter member 1 [Source:NCBI gene;Acc:101173640])

HSP 1 Score: 285.034 bits (728), Expect = 1.008e-88
Identity = 167/490 (34.08%), Postives = 260/490 (53.06%), Query Frame = 1
Query:  106 NKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVAR 1575
             KK+++  L+ ++     GS + +GYN  VIN P  +++ F N T +            PI       V S ++           +F + G++G+ S G +A+  GRR  + + +   +IGG++ G +   S+  ++  GR  IG+  G   GL  MY+ E++P   RGA G  HQL V LGI+I  I  +   L ++ LWP+  A T  PAVL   +LPFCPESPRF+          RK   R+   EDV   + E++EES     + K    ++F     R PL+IA ++Q+ QQ+SGINAV  YS+ +  +AG+ +    Y  I  G++N + T+VSL L+EK GRRTL L     +A   L +TI + L +               +++  IM ++  F  G GP+P  IVAE+F Q PR AA +++    W AN +V  S+P + +  G + FL F   +I+ ++F Y+ +PETK RTF++++R
Sbjct:    4 QKKQVTGYLLFSMGTAVIGS-LQFGYNTGVINAPEQKLRSFFNNTWVE-------RYGEPISPGVCTIVWSIAV----------AIFSVGGMVGSVSVGVLANRFGRRRSMFIVNSLAVIGGLLMGFSTVCSSYEMVIAGRLVIGLFCGFFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVLGILIAQIFGLEALLGSEKLWPLLLALTVAPAVLQCILLPFCPESPRFLLCNLKLEEQARKVLVRLRGTEDVSKDLQEMKEESAKMAQEKKVTIPELFRLASYRQPLLIAVMLQLSQQLSGINAVFYYSTGIFQSAGVKQ--PIYATIGAGIVNTIFTVVSLFLVEKAGRRTLHLLGLGGMAIGALVMTISLLLKDIPA---------MSYVAIIAIMFFVAMFELGPGPIPWFIVAELFSQGPRPAAMAVAGCCNWTANFLVGMSFPKLEEWCGPWVFLIFTAFLILFFIFTYIKVPETKGRTFEEISR 464          
BLAST of slc2a-2 vs. Ensembl Medaka
Match: slc2a3a (solute carrier family 2, facilitated glucose transporter member 1 [Source:NCBI gene;Acc:101173640])

HSP 1 Score: 285.034 bits (728), Expect = 1.008e-88
Identity = 167/490 (34.08%), Postives = 260/490 (53.06%), Query Frame = 1
Query:  106 NKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVAR 1575
             KK+++  L+ ++     GS + +GYN  VIN P  +++ F N T +            PI       V S ++           +F + G++G+ S G +A+  GRR  + + +   +IGG++ G +   S+  ++  GR  IG+  G   GL  MY+ E++P   RGA G  HQL V LGI+I  I  +   L ++ LWP+  A T  PAVL   +LPFCPESPRF+          RK   R+   EDV   + E++EES     + K    ++F     R PL+IA ++Q+ QQ+SGINAV  YS+ +  +AG+ +    Y  I  G++N + T+VSL L+EK GRRTL L     +A   L +TI + L +               +++  IM ++  F  G GP+P  IVAE+F Q PR AA +++    W AN +V  S+P + +  G + FL F   +I+ ++F Y+ +PETK RTF++++R
Sbjct:    4 QKKQVTGYLLFSMGTAVIGS-LQFGYNTGVINAPEQKLRSFFNNTWVE-------RYGEPISPGVCTIVWSIAV----------AIFSVGGMVGSVSVGVLANRFGRRRSMFIVNSLAVIGGLLMGFSTVCSSYEMVIAGRLVIGLFCGFFTGLTPMYVGEVSPTPLRGAFGTLHQLGVVLGILIAQIFGLEALLGSEKLWPLLLALTVAPAVLQCILLPFCPESPRFLLCNLKLEEQARKVLVRLRGTEDVSKDLQEMKEESAKMAQEKKVTIPELFRLASYRQPLLIAVMLQLSQQLSGINAVFYYSTGIFQSAGVKQ--PIYATIGAGIVNTIFTVVSLFLVEKAGRRTLHLLGLGGMAIGALVMTISLLLKDIPA---------MSYVAIIAIMFFVAMFELGPGPIPWFIVAELFSQGPRPAAMAVAGCCNWTANFLVGMSFPKLEEWCGPWVFLIFTAFLILFFIFTYIKVPETKGRTFEEISR 464          
BLAST of slc2a-2 vs. Ensembl Medaka
Match: slc2a1b (solute carrier family 2, facilitated glucose transporter member 1 [Source:NCBI gene;Acc:101159343])

HSP 1 Score: 281.952 bits (720), Expect = 4.517e-88
Identity = 160/487 (32.85%), Postives = 266/487 (54.62%), Query Frame = 1
Query:  112 KKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVA 1572
            KKI+  L+++V     GS + +GYN  VIN P   I+ F+N T L            PI   ++  + S S+          ++F + G++G+FS G   +  GRRN +L+ ++   I   + G +    +  +L +GRF +G+ SG++ G   MY+ E++P A RGA+G  HQL + +GI++  +  +   +  D LWP+  A   IPA++   +LP CP+SPR++ + K+  +  +    ++    DV   + E++EES     + K   +++F     R P+ IA ++Q+ QQ+SGINAV  YS+ +   AG+ +    Y  I  GV+N   T+VSL ++E+ GRR+L L   + +AG+ + LTI + L +    +S         +S+  I  ++  F  G GP+P  IVAE+F Q PR +A +++    W AN IV   +  + +  G Y F+ F V++++ +VF Y  +PETK RTFDD+A
Sbjct:    5 KKITFPLLMSVGTAVLGS-LQFGYNTGVINAPQKIIENFINNTWLE-------RYQEPITKVSLTAIWSLSV----------SIFSVGGIVGSFSVGLFLNRFGRRNSMLMANILAFIASALMGFSKMAKSWEMLIVGRFVVGLYSGLSTGFVPMYVGEVSPTALRGALGTLHQLGIVIGILMAQVFGLEVIMGNDQLWPLLLAFIFIPAIVQCILLPLCPKSPRYLLINKNEESKAKAVLKKLRGTNDVSSDMQEMKEESRQMMREKKVTILELFRSPLYREPIFIAVMLQLSQQLSGINAVFYYSTLIFEKAGVQQ--PVYATIGAGVVNTAFTVVSLFVVERAGRRSLHLLGLLGMAGAAVLLTIALALLDQLEWMSY--------VSIVAIFAFVAFFEIGPGPIPWFIVAELFSQGPRPSAMAVAGFSNWTANFIVGMGFQYVQELCGPYVFIIFAVLLLLFFVFTYFKVPETKGRTFDDIA 463          
BLAST of slc2a-2 vs. Planmine SMEST
Match: SMESG000081673.1 (SMESG000081673.1)

HSP 1 Score: 1090.1 bits (2818), Expect = 0.000e+0
Identity = 535/537 (99.63%), Postives = 537/537 (100.00%), Query Frame = 1
Query:   73 MTNEHLVIDSQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTETVA 1683
            MTNEHLVIDSQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGS+DANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGT+SIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTETVA
Sbjct:    1 MTNEHLVIDSQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSVDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTVSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTETVA 537          
BLAST of slc2a-2 vs. Planmine SMEST
Match: SMESG000081662.1 (SMESG000081662.1)

HSP 1 Score: 922.539 bits (2383), Expect = 0.000e+0
Identity = 440/538 (81.78%), Postives = 496/538 (92.19%), Query Frame = 1
Query:   70 SMTNEHLVIDSQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTV-NNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTETV 1680
             M +EHLV +S  + KISP LILTVF+TCFGSS+LYGYNMAVINLPADRIKCFLN+T+LNVPC+DAY++ +  FNS++ + V+SGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLL+NH+FVIIG IINGLTVKT   SLL++GRFFIGINSG+T+GLASMYLTEIAPRAYRGAIGACHQLAVT+GIVIGY+LTMTHTLNT+SLWP+ACACTAIPA+LSL +LP CPESPRFIFLK+    L RKEF R+N++EDVD+F+GEL+EE +IAK+QPKFKF Q+FTQK+LRMPLIIACLIQVMQQ+SGINAVISYSSSML+TAGIPE+YSQYCVITIG+LNV+CTL SLPLLEKFGRR LLLWPSILLA SLLFLTI VNL NA G LS+  QK+ GGISVFFIMTYIIGFAFGLGPVPALIV EIFRQEPRGAAYS+SQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVV++CWVFF+L+MPETKNRTFDDVARDLAFGTTVI KKK+Q LNRPIY KV+T+EN ++ +
Sbjct:    7 KMGDEHLVPNSH-QGKISPTLILTVFLTCFGSSLLYGYNMAVINLPADRIKCFLNETVLNVPCKDAYDTLSKTFNSSIISGVKSGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLMNHIFVIIGAIINGLTVKTKIASLLFVGRFFIGINSGVTVGLASMYLTEIAPRAYRGAIGACHQLAVTVGIVIGYLLTMTHTLNTESLWPIACACTAIPAILSLILLPLCPESPRFIFLKQFKEDLARKEFIRLNRMEDVDVFLGELREEVEIAKNQPKFKFFQLFTQKDLRMPLIIACLIQVMQQLSGINAVISYSSSMLSTAGIPEVYSQYCVITIGILNVICTLSSLPLLEKFGRRILLLWPSILLAVSLLFLTITVNLVNAPGLLSLSNQKIVGGISVFFIMTYIIGFAFGLGPVPALIVGEIFRQEPRGAAYSVSQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVLVCWVFFFLFMPETKNRTFDDVARDLAFGTTVIGKKKTQELNRPIYKKVATDENKSDDI 543          
BLAST of slc2a-2 vs. Planmine SMEST
Match: SMESG000081662.1 (SMESG000081662.1)

HSP 1 Score: 922.154 bits (2382), Expect = 0.000e+0
Identity = 440/537 (81.94%), Postives = 497/537 (92.55%), Query Frame = 1
Query:   73 MTNEHLVIDSQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTV-NNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTETV 1680
            M +EHLV +S ++ KISP LILTVF+TCFGSS+LYGYNMAVINLPADRIKCFLN+T+LNVPC+DAY++ +  FNS++ + V+SGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLL+NH+FVIIG IINGLTVKT   SLL++GRFFIGINSG+T+GLASMYLTEIAPRAYRGAIGACHQLAVT+GIVIGY+LTMTHTLNT+SLWP+ACACTAIPA+LSL +LP CPESPRFIFLK+    L RKEF R+N++EDVD+F+GEL+EE +IAK+QPKFKF Q+FTQK+LRMPLIIACLIQVMQQ+SGINAVISYSSSML+TAGIPE+YSQYCVITIG+LNV+CTL SLPLLEKFGRR LLLWPSILLA SLLFLTI VNL NA G LS+  QK+ GGISVFFIMTYIIGFAFGLGPVPALIV EIFRQEPRGAAYS+SQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVV++CWVFF+L+MPETKNRTFDDVARDLAFGTTVI KKK+Q LNRPIY KV+T+EN ++ +
Sbjct:    1 MGDEHLVPNS-HQGKISPTLILTVFLTCFGSSLLYGYNMAVINLPADRIKCFLNETVLNVPCKDAYDTLSKTFNSSIISGVKSGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLMNHIFVIIGAIINGLTVKTKIASLLFVGRFFIGINSGVTVGLASMYLTEIAPRAYRGAIGACHQLAVTVGIVIGYLLTMTHTLNTESLWPIACACTAIPAILSLILLPLCPESPRFIFLKQFKEDLARKEFIRLNRMEDVDVFLGELREEVEIAKNQPKFKFFQLFTQKDLRMPLIIACLIQVMQQLSGINAVISYSSSMLSTAGIPEVYSQYCVITIGILNVICTLSSLPLLEKFGRRILLLWPSILLAVSLLFLTITVNLVNAPGLLSLSNQKIVGGISVFFIMTYIIGFAFGLGPVPALIVGEIFRQEPRGAAYSVSQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVLVCWVFFFLFMPETKNRTFDDVARDLAFGTTVIGKKKTQELNRPIYKKVATDENKSDDI 536          
BLAST of slc2a-2 vs. Planmine SMEST
Match: SMESG000081585.1 (SMESG000081585.1)

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 383/515 (74.37%), Postives = 448/515 (86.99%), Query Frame = 1
Query:   94 IDSQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPI 1638
            +D  N+K +SPILILTVFITCFGSSMLYGYNMAVINLPAD+IKCFLN +IL VPC++A+   +  +N +V N    SIDA+FLYAQT TVFV+AGVIGAF+T W+ADL+GRRNGLL NH FVIIG IINGLTVKT   +LL+IGRFFIGINSGITIGLASMYLTEIAP  YRGAIGACHQLAVTLGIV+ Y+LTMT TLNT+ LWPVACACTAIPA++SL +LPFCPESPRFIFLK+    L RKEF R+N++EDVD F+ EL+EE++I+K+QP+FK  Q+FTQK+L++P++IAC IQVMQQ+SGINAVISYSSSML TAGIPEI+ QYCV+ IG+LNVVCTL+SLPLLEK GRRTLLLWPS++LA SLLFLT+ VNL +  G LS+Y Q++ GG+SVFFIMTY IGFA GLGPVPALIV+EIFRQEPRGAAYSISQ+IQWA +++VL +YP+MNKAIGGYSFLPFL+VVII W+FF+LYMPETKNRTFD+VARDL F T V   KKSQ L  PI
Sbjct:    4 VDQNNQKNVSPILILTVFITCFGSSMLYGYNMAVINLPADKIKCFLNISILKVPCKEAFKQISINYNISVVNFTKSSIDADFLYAQTGTVFVVAGVIGAFATCWVADLLGRRNGLLFNHSFVIIGAIINGLTVKTGIAALLFIGRFFIGINSGITIGLASMYLTEIAPTRYRGAIGACHQLAVTLGIVVSYLLTMTQTLNTEILWPVACACTAIPAIISLFVLPFCPESPRFIFLKRSKEDLARKEFVRLNKIEDVDSFLRELREEAEISKNQPQFKMAQLFTQKDLKLPVMIACFIQVMQQLSGINAVISYSSSMLETAGIPEIFGQYCVLGIGILNVVCTLLSLPLLEKCGRRTLLLWPSVVLAISLLFLTVTVNLVSIPGYLSVYNQRIVGGVSVFFIMTYTIGFALGLGPVPALIVSEIFRQEPRGAAYSISQSIQWAMSILVLCAYPSMNKAIGGYSFLPFLIVVIIGWIFFFLYMPETKNRTFDEVARDLTFVTPVTFLKKSQGLIYPI 518          
BLAST of slc2a-2 vs. Planmine SMEST
Match: SMESG000081585.1 (SMESG000081585.1)

HSP 1 Score: 759.214 bits (1959), Expect = 0.000e+0
Identity = 364/490 (74.29%), Postives = 426/490 (86.94%), Query Frame = 1
Query:  169 MLYGYNMAVINLPADRIKCFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVIAGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYIGRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYILTMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLTRKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLIIACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTLVSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVFGGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAANLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVARDLAFGTTVISKKKSQTLNRPI 1638
            MLYGYNMAVINLPAD+IKCFLN +IL VPC++A+   +  +N +V N    SIDA+FLYAQT TVFV+AGVIGAF+T W+ADL+GRRNGLL NH FVIIG IINGLTVKT   +LL+IGRFFIGINSGITIGLASMYLTEIAP  YRGAIGACHQLAVTLGIV+ Y+LTMT TLNT+ LWPVACACTAIPA++SL +LPFCPESPRFIFLK+    L RKEF R+N++EDVD F+ EL+EE++I+K+QP+FK  Q+FTQK+L++P++IAC IQVMQQ+SGINAVISYSSSML TAGIPEI+ QYCV+ IG+LNVVCTL+SLPLLEK GRRTLLLWPS++LA SLLFLT+ VNL +  G LS+Y Q++ GG+SVFFIMTY IGFA GLGPVPALIV+EIFRQEPRGAAYSISQ+IQWA +++VL +YP+MNKAIGGYSFLPFL+VVII W+FF+LYMPETKNRTFD+VARDL F T V   KKSQ L  PI
Sbjct:    1 MLYGYNMAVINLPADKIKCFLNISILKVPCKEAFKQISINYNISVVNFTKSSIDADFLYAQTGTVFVVAGVIGAFATCWVADLLGRRNGLLFNHSFVIIGAIINGLTVKTGIAALLFIGRFFIGINSGITIGLASMYLTEIAPTRYRGAIGACHQLAVTLGIVVSYLLTMTQTLNTEILWPVACACTAIPAIISLFVLPFCPESPRFIFLKRSKEDLARKEFVRLNKIEDVDSFLRELREEAEISKNQPQFKMAQLFTQKDLKLPVMIACFIQVMQQLSGINAVISYSSSMLETAGIPEIFGQYCVLGIGILNVVCTLLSLPLLEKCGRRTLLLWPSVVLAISLLFLTVTVNLVSIPGYLSVYNQRIVGGVSVFFIMTYTIGFALGLGPVPALIVSEIFRQEPRGAAYSISQSIQWAMSILVLCAYPSMNKAIGGYSFLPFLIVVIIGWIFFFLYMPETKNRTFDEVARDLTFVTPVTFLKKSQGLIYPI 490          
The following BLAST results are available for this feature:
BLAST of slc2a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC2A18.524e-8932.49solute carrier family 2 member 1 [Source:HGNC Symb... [more]
SLC2A33.705e-8632.59solute carrier family 2 member 3 [Source:HGNC Symb... [more]
SLC2A41.766e-8533.85solute carrier family 2 member 4 [Source:HGNC Symb... [more]
SLC2A41.766e-8533.85solute carrier family 2 member 4 [Source:HGNC Symb... [more]
SLC2A141.436e-8432.39solute carrier family 2 member 14 [Source:HGNC Sym... [more]
back to top
BLAST of slc2a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgt-17.137e-7231.11Facilitated glucose transporter protein 1 [Source... [more]
fgt-11.460e-7130.82Facilitated glucose transporter protein 1 [Source... [more]
R09B5.112.480e-5929.65Facilitated glucose transporter homolog [Source:U... [more]
R09B5.112.480e-5929.65Facilitated glucose transporter homolog [Source:U... [more]
K08F9.11.185e-4528.16pep chromosome:WBcel235:V:15137273:15139888:-1 gen... [more]
back to top
BLAST of slc2a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glut11.065e-9235.67gene:FBgn0264574 transcript:FBtr0333499[more]
Glut17.984e-9235.67gene:FBgn0264574 transcript:FBtr0333500[more]
Glut18.112e-9235.47gene:FBgn0264574 transcript:FBtr0333493[more]
Glut11.153e-9135.47gene:FBgn0264574 transcript:FBtr0333496[more]
Glut11.153e-9135.47gene:FBgn0264574 transcript:FBtr0333497[more]
back to top
BLAST of slc2a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a1b1.300e-8832.04solute carrier family 2 member 1b [Source:ZFIN;Acc... [more]
slc2a3a6.864e-8834.35solute carrier family 2 member 3a [Source:ZFIN;Acc... [more]
slc2a3a8.556e-8834.35solute carrier family 2 member 3a [Source:ZFIN;Acc... [more]
slc2a3a8.556e-8834.35solute carrier family 2 member 3a [Source:ZFIN;Acc... [more]
slc2a1a1.695e-8731.57solute carrier family 2 member 1a [Source:ZFIN;Acc... [more]
back to top
BLAST of slc2a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a54.687e-8632.14solute carrier family 2 member 5 [Source:NCBI gene... [more]
slc2a51.665e-8532.10solute carrier family 2 member 5 [Source:NCBI gene... [more]
ENSXETT00000012702.13.535e-8333.73solute carrier family 2 member 3 [Source:NCBI gene... [more]
ENSXETT00000028816.11.910e-8233.40solute carrier family 2 member 3 [Source:NCBI gene... [more]
ENSXETT00000012655.13.438e-8233.33solute carrier family 2 member 3 [Source:NCBI gene... [more]
back to top
BLAST of slc2a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc2a17.088e-8932.09solute carrier family 2 (facilitated glucose trans... [more]
Slc2a42.957e-8633.65solute carrier family 2 (facilitated glucose trans... [more]
Slc2a33.973e-8233.68solute carrier family 2 (facilitated glucose trans... [more]
Slc2a75.078e-7930.99solute carrier family 2 (facilitated glucose trans... [more]
Slc2a41.059e-7734.71solute carrier family 2 (facilitated glucose trans... [more]
back to top
BLAST of slc2a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P46896|GTR1_CHICK2.120e-9032.81Solute carrier family 2, facilitated glucose trans... [more]
sp|P28568|GTR3_CHICK6.185e-8934.03Solute carrier family 2, facilitated glucose trans... [more]
sp|P20303|GTR1_PIG7.456e-8932.88Solute carrier family 2, facilitated glucose trans... [more]
sp|Q27994|GLUT4_BOVIN7.629e-8934.63Solute carrier family 2, facilitated glucose trans... [more]
sp|P11166|GTR1_HUMAN4.094e-8832.49Solute carrier family 2, facilitated glucose trans... [more]
back to top
BLAST of slc2a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF130.000e+0100.00Slc2a-2 OS=Schmidtea mediterranea OX=79327 GN=slc2... [more]
A0A0H3YJW90.000e+072.66Slc2a-3 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
A0A504YXM30.000e+059.54Solute carrier family 2 facilitated glucose transp... [more]
A0A4E0RGV20.000e+059.54Solute carrier family 2 facilitated glucose transp... [more]
G7YT590.000e+058.65Solute carrier family 2 OS=Clonorchis sinensis OX=... [more]
back to top
BLAST of slc2a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a3a1.608e-9535.28solute carrier family 2, facilitated glucose trans... [more]
slc2a3a1.119e-9336.17solute carrier family 2, facilitated glucose trans... [more]
slc2a1a7.379e-9133.53solute carrier family 2, facilitated glucose trans... [more]
slc2a1b4.240e-9031.96solute carrier family 2, facilitated glucose trans... [more]
slc2a1a1.961e-8933.40solute carrier family 2, facilitated glucose trans... [more]
back to top
BLAST of slc2a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC2A95.752e-6028.63solute carrier family 2 member 9 [Source:HGNC Symb... [more]
slc2a11a1.042e-4828.02solute carrier family 2 member 11a [Source:ZFIN;Ac... [more]
slc2a11b7.530e-2927.74solute carrier family 2 member 11b [Source:NCBI ge... [more]
slc2a103.852e-923.74solute carrier family 2 member 10 [Source:NCBI gen... [more]
ENSPMAT00000002434.12.020e-627.84pep scaffold:Pmarinus_7.0:GL479978:1522:11010:-1 g... [more]
back to top
BLAST of slc2a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YBR241C_mRNA2.405e-3524.85Putative transporter, member of the sugar porter f... [more]
HXT141.406e-3127.44Protein with similarity to hexose transporter fami... [more]
HXT137.372e-3125.64Putative transmembrane polyol transporter; support... [more]
HXT33.899e-3025.71Low affinity glucose transporter of the major faci... [more]
HXT54.549e-3025.67Hexose transporter with moderate affinity for gluc... [more]
back to top
BLAST of slc2a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO351201.314e-8331.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426673.149e-7731.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326154.039e-3727.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428612.826e-3528.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428621.628e-2627.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc2a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a3b1.400e-10635.35solute carrier family 2, facilitated glucose trans... [more]
slc2a3a7.113e-8934.29solute carrier family 2, facilitated glucose trans... [more]
slc2a3a1.008e-8834.08solute carrier family 2, facilitated glucose trans... [more]
slc2a3a1.008e-8834.08solute carrier family 2, facilitated glucose trans... [more]
slc2a1b4.517e-8832.85solute carrier family 2, facilitated glucose trans... [more]
back to top
BLAST of slc2a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081673.10.000e+099.63SMESG000081673.1[more]
SMESG000081662.10.000e+081.78SMESG000081662.1[more]
SMESG000081662.10.000e+081.94SMESG000081662.1[more]
SMESG000081585.10.000e+074.37SMESG000081585.1[more]
SMESG000081585.10.000e+074.29SMESG000081585.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012139
GenBankAKN21397.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012139 ID=SMED30012139|Name=slc2a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1733bp
CACACTTTCAAGCACAGTTAGTGCAAGATATAAAGTGAATTTGGTCTATG
ATTTATTGTAAAATAGCTTTCAATGACTAATGAACACCTTGTGATAGATA
GTCAAAATAAAAAAAAAATCTCCCCGATACTTATTTTGACGGTGTTTATA
ACATGCTTTGGTTCATCTATGCTTTATGGATACAACATGGCCGTCATAAA
TCTTCCAGCAGACAGAATAAAATGTTTTCTTAACAAAACAATTCTTAATG
TTCCATGCAGAGATGCATATAATAGTTCCAATCCAATCTTCAACAGTACT
GTGAATAACGTAGAATCAGGATCCATTGACGCAAATTTTCTTTATGCACA
AACTAGTACAGTTTTCGTTATTGCCGGGGTGATTGGAGCGTTTTCGACTG
GATGGATTGCAGATTTGGTTGGAAGACGAAATGGATTATTGTTGAACCAC
GTGTTTGTAATAATTGGAGGTATTATCAATGGACTAACTGTAAAAACCTC
AACAGTTTCTTTGTTATACATTGGAAGATTTTTCATTGGTATTAATTCTG
GAATAACTATAGGTCTAGCGTCGATGTATCTCACAGAAATCGCACCCAGA
GCATATCGAGGCGCCATCGGAGCATGCCATCAGTTGGCAGTTACTCTTGG
AATAGTTATAGGATACATTTTGACTATGACACATACTCTTAACACCGATT
CATTATGGCCAGTTGCGTGCGCTTGTACAGCAATTCCAGCTGTTTTATCT
CTGTGCATTTTACCATTCTGTCCCGAAAGTCCAAGATTTATCTTCTTAAA
GAAACACAACGTAACTCTCACTAGAAAAGAGTTTACAAGAATCAACCAGC
TGGAAGACGTAGACATATTTATTGGGGAACTTCAGGAGGAATCCGATATA
GCGAAATCACAACCGAAGTTTAAATTTATTCAAATATTCACACAAAAGGA
ATTGAGAATGCCTCTGATTATTGCCTGCCTTATACAAGTGATGCAACAAA
TTTCGGGAATAAATGCTGTTATTTCATATTCAAGCTCAATGCTAAACACG
GCCGGAATTCCTGAAATTTATAGCCAATATTGTGTTATAACCATTGGAGT
TCTCAATGTGGTTTGTACTTTGGTTTCTCTACCTTTACTTGAAAAATTCG
GTCGACGAACATTATTATTATGGCCATCAATTTTGTTGGCGGGTTCATTA
CTATTTCTAACCATCTTTGTCAATTTGGCGAATGCATCTGGAACTTTGTC
GATATATGGTCAGAAAGTCTTTGGTGGAATTTCGGTTTTCTTCATTATGA
CATATATCATTGGATTTGCTTTCGGACTTGGTCCAGTTCCTGCTTTGATT
GTTGCGGAAATTTTCCGCCAAGAGCCTCGTGGAGCAGCTTACTCAATCAG
TCAAGCAATTCAATGGGCGGCTAATCTCATTGTTCTATTCAGTTACCCCA
ATATGAATAAAGCCATAGGAGGTTATTCGTTTCTCCCGTTTCTTGTTGTC
GTCATCATCTGTTGGGTATTCTTTTACCTGTATATGCCAGAAACTAAAAA
CCGGACGTTTGACGATGTTGCTCGAGACTTGGCATTCGGTACGACGGTGA
TTAGCAAGAAGAAGTCTCAGACTCTGAATCGGCCGATATACGATAAAGTC
TCTACAAATGAAAATGATACAGAAACTGTAGCCTAGAATATTGTAGTTAG
ATTTCATAAAACAAATTTGAAATATAGTTTTGG
back to top

protein sequence of SMED30012139-orf-1

>SMED30012139-orf-1 ID=SMED30012139-orf-1|Name=SMED30012139-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=538bp
MTNEHLVIDSQNKKKISPILILTVFITCFGSSMLYGYNMAVINLPADRIK
CFLNKTILNVPCRDAYNSSNPIFNSTVNNVESGSIDANFLYAQTSTVFVI
AGVIGAFSTGWIADLVGRRNGLLLNHVFVIIGGIINGLTVKTSTVSLLYI
GRFFIGINSGITIGLASMYLTEIAPRAYRGAIGACHQLAVTLGIVIGYIL
TMTHTLNTDSLWPVACACTAIPAVLSLCILPFCPESPRFIFLKKHNVTLT
RKEFTRINQLEDVDIFIGELQEESDIAKSQPKFKFIQIFTQKELRMPLII
ACLIQVMQQISGINAVISYSSSMLNTAGIPEIYSQYCVITIGVLNVVCTL
VSLPLLEKFGRRTLLLWPSILLAGSLLFLTIFVNLANASGTLSIYGQKVF
GGISVFFIMTYIIGFAFGLGPVPALIVAEIFRQEPRGAAYSISQAIQWAA
NLIVLFSYPNMNKAIGGYSFLPFLVVVIICWVFFYLYMPETKNRTFDDVA
RDLAFGTTVISKKKSQTLNRPIYDKVSTNENDTETVA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000047collecting duct
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR003663Sugar/inositol_transpt
IPR005828MFS_sugar_transport-like
IPR005829Sugar_transporter_CS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
GO:0008643carbohydrate transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0022891substrate-specific transmembrane transporter activity
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003663Sugar/inositol transporterPRINTSPR00171SUGRTRNSPORTcoord: 308..318
score: 51.06
coord: 149..168
score: 31.04
coord: 428..440
score: 37.95
coord: 405..426
score: 30.91
coord: 32..42
score: 34.92
IPR003663Sugar/inositol transporterTIGRFAMTIGR00879TIGR00879coord: 18..498
e-value: 3.4E-87
score: 291.1
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 7..504
e-value: 2.6E-119
score: 401.0
NoneNo IPR availablePANTHERPTHR23503FAMILY NOT NAMEDcoord: 22..503
NoneNo IPR availableCDDcd17431MFS_GLUT_Class1coord: 22..494
e-value: 1.22206E-114
score: 345.089
NoneNo IPR availableTMHMMTMhelixcoord: 121..138
NoneNo IPR availableTMHMMTMhelixcoord: 399..421
NoneNo IPR availableTMHMMTMhelixcoord: 90..112
NoneNo IPR availableTMHMMTMhelixcoord: 211..233
NoneNo IPR availableTMHMMTMhelixcoord: 182..201
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 465..487
NoneNo IPR availableTMHMMTMhelixcoord: 148..170
NoneNo IPR availableTMHMMTMhelixcoord: 364..386
NoneNo IPR availableTMHMMTMhelixcoord: 332..354
IPR005828Major facilitator, sugar transporter-likePFAMPF00083Sugar_trcoord: 24..502
e-value: 2.5E-102
score: 343.1
IPR005829Sugar transporter, conserved sitePROSITEPS00217SUGAR_TRANSPORT_2coord: 154..179
IPR005829Sugar transporter, conserved sitePROSITEPS00216SUGAR_TRANSPORT_1coord: 352..369
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 24..492
score: 36.729
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 19..499