16 kDa calcium-binding protein

Overview
Name16 kDa calcium-binding protein
Smed IDSMED30012133
Length (bp)759
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 16 kDa calcium-binding protein (SMED30012133) t-SNE clustered cells

Violin plots show distribution of expression levels for 16 kDa calcium-binding protein (SMED30012133) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 16 kDa calcium-binding protein (SMED30012133) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 16 kDa calcium-binding protein (SMED30012133) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012133

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30012133h1SMcG0000087 SmedASXL_006323SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30012133h1SMcG0000087 SmedASXL_006323SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30012133h1SMcG0000087 dd_Smed_v4_5204_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012133h1SMcG0000087 dd_Smed_v4_5204_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
eyeSMED30012133h1SMcG0000088 Contig34604uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30012133h1SMcG0000088 Contig34604newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30012133h1SMcG0000087 Contig34604uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30012133h1SMcG0000087 Contig34604newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30012133h1SMcG0000088 Contig34604uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30012133h1SMcG0000088 Contig34604newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30012133h1SMcG0000087 Contig34604uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30012133h1SMcG0000087 Contig34604newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30012133h1SMcG0000087 dd_Smed_v6_5204_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012133h1SMcG0000087 dd_Smed_v6_5204_0dd_Smed_v6PMID:29674432
Plass et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30012133h1SMcG0000087 dd_Smed_v6_5204_0dd_Smed_v6PMID:29674432
Plass et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30012133h1SMcG0000087 dd_Smed_v6_5204_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012133h1SMcG0000087 dd_Smed_v6_5204_0dd_Smed_v6PMID:29674432
Plass et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30012133h1SMcG0000087 dd_Smed_v6_5204_0dd_Smed_v6PMID:29674432
Plass et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30012133h1SMcG0000087 dd_Smed_v4_5204_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30012133h1SMcG0000087 dd_Smed_v4_5204_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 16 kDa calcium-binding protein vs. Ensembl Human
Match: CALML5 (calmodulin like 5 [Source:HGNC Symbol;Acc:HGNC:18180])

HSP 1 Score: 49.2914 bits (116), Expect = 6.236e-7
Identity = 25/76 (32.89%), Postives = 43/76 (56.58%), Query Frame = 3
Query:  231 LYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSN--NFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLKNHK 452
            L PE E +Y   +  F++ D DG+G ++++E+G  LK+   N  +  L+  +   DS+ DGE+ + EFL   K  +
Sbjct:    5 LTPEEEAQY---KKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKAR 77          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Celegans
Match: C50C3.5 (Uncharacterized calcium-binding protein C50C3.5 [Source:UniProtKB/Swiss-Prot;Acc:P34368])

HSP 1 Score: 46.595 bits (109), Expect = 3.799e-6
Identity = 24/71 (33.80%), Postives = 41/71 (57.75%), Query Frame = 3
Query:  273 VFNSFDRDGSGKLSSEEVGLILKSNNFD--KKTLQNWLRNRDSNNDGEMDYDEFLDFLKNHK*LF*LESDI 479
            +F   D DGSG +SS EV  +L     D   K +Q  +R+ D + DG++D++EFL  + +   L  +++D+
Sbjct:   55 IFQLMDDDGSGTISSSEVAKMLNELGIDVSPKVVQAVMRSSDVSGDGQIDFEEFLAAVTSKIKLSTVKADV 125          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Celegans
Match: cal-1 (Calmodulin-like protein [Source:UniProtKB/Swiss-Prot;Acc:P04630])

HSP 1 Score: 45.4394 bits (106), Expect = 5.536e-6
Identity = 25/101 (24.75%), Postives = 50/101 (49.50%), Query Frame = 3
Query:  153 IKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVG--LILKSNNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLKNH 449
            I   +   D + +G+I   E+   +      E    M R+ F  FD+DG+G ++++E    ++     F ++ +   ++  D + DGE+DY+EF+  + N 
Sbjct:   62 ILEMINEVDIDGNGQIEFPEFCVMMKRMM-KETDSEMIREAFRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIKEVDVDGDGEIDYEEFVKMMSNQ 161          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Celegans
Match: cal-1 (Calmodulin-like protein [Source:UniProtKB/Swiss-Prot;Acc:P04630])

HSP 1 Score: 45.4394 bits (106), Expect = 8.210e-6
Identity = 25/101 (24.75%), Postives = 50/101 (49.50%), Query Frame = 3
Query:  153 IKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVG--LILKSNNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLKNH 449
            I   +   D + +G+I   E+   +      E    M R+ F  FD+DG+G ++++E    ++     F ++ +   ++  D + DGE+DY+EF+  + N 
Sbjct:   81 ILEMINEVDIDGNGQIEFPEFCVMMKRMM-KETDSEMIREAFRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIKEVDVDGDGEIDYEEFVKMMSNQ 180          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Celegans
Match: cmd-1 (Calmodulin [Source:UniProtKB/Swiss-Prot;Acc:O16305])

HSP 1 Score: 44.669 bits (104), Expect = 9.018e-6
Identity = 19/68 (27.94%), Postives = 42/68 (61.76%), Query Frame = 3
Query:  243 NERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKS--NNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
             E +   +++ F+ FD+DG G ++++E+G +++S   N  +  LQ+ +   D++ +G +D+ EFL  +
Sbjct:    6 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMM 73          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Zebrafish
Match: FO704871.1 (calcium-binding protein 7-like [Source:NCBI gene;Acc:100329495])

HSP 1 Score: 50.0618 bits (118), Expect = 4.356e-7
Identity = 27/78 (34.62%), Postives = 50/78 (64.10%), Query Frame = 3
Query:  213 YKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNF--DKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
            Y+A +NL PE+E      R+ F  FDRDG+G +S +E+G+ ++S  +  ++  L+  ++  D + DG++D++EF+  L
Sbjct:   24 YRAPVNL-PEDE--VEEIREAFKVFDRDGNGFISKQELGMAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLL 98          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Zebrafish
Match: cabp7b (calcium binding protein 7b [Source:ZFIN;Acc:ZDB-GENE-060526-366])

HSP 1 Score: 48.521 bits (114), Expect = 1.678e-6
Identity = 26/78 (33.33%), Postives = 50/78 (64.10%), Query Frame = 3
Query:  213 YKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNF--DKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
            Y+A ++L PE+E      R+ F  FDRDG+G +S +E+G+ ++S  +  ++  L+  ++  D + DG++D++EF+  L
Sbjct:   24 YRAPVSL-PEDE--VEEIREAFKVFDRDGNGFISKQELGVAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVALL 98          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Zebrafish
Match: cabp7b (calcium binding protein 7b [Source:ZFIN;Acc:ZDB-GENE-060526-366])

HSP 1 Score: 48.521 bits (114), Expect = 1.793e-6
Identity = 26/78 (33.33%), Postives = 50/78 (64.10%), Query Frame = 3
Query:  213 YKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNF--DKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
            Y+A ++L PE+E      R+ F  FDRDG+G +S +E+G+ ++S  +  ++  L+  ++  D + DG++D++EF+  L
Sbjct:   24 YRAPVSL-PEDE--VEEIREAFKVFDRDGNGFISKQELGVAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVALL 98          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Zebrafish
Match: calm2a (calmodulin 2a (phosphorylase kinase, delta) [Source:ZFIN;Acc:ZDB-GENE-030804-3])

HSP 1 Score: 45.4394 bits (106), Expect = 2.710e-6
Identity = 19/68 (27.94%), Postives = 42/68 (61.76%), Query Frame = 3
Query:  243 NERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKS--NNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
             E +   +++ F+ FD+DG G ++++E+G +++S   N  +  LQ+ +   D++ +G +D+ EFL  +
Sbjct:    6 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMM 73          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Xenopus
Match: CALM2 (calmodulin 1 (phosphorylase kinase, delta) [Source:NCBI gene;Acc:100496298])

HSP 1 Score: 45.8246 bits (107), Expect = 7.695e-6
Identity = 19/62 (30.65%), Postives = 41/62 (66.13%), Query Frame = 3
Query:  261 MWRDVFNSFDRDGSGKLSSEEVGLILKS--NNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
            M+++ F+ FD+DG G ++++E+G +++S   N  +  LQ+ +   D++ +G +D+ EFL  +
Sbjct:    1 MFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMM 62          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Mouse
Match: Calm4 (calmodulin 4 [Source:MGI Symbol;Acc:MGI:1931464])

HSP 1 Score: 46.2098 bits (108), Expect = 4.815e-6
Identity = 26/95 (27.37%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  153 IKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEV--GLILKSNNFDKKTLQNWLRNRDSNNDGEMDYDEFL 431
            +K  +   D + DGKI+  E+   +  Y +  R   + R VFN  D++G G ++ +E+   L     +  ++ L++ +R  D + DG++ Y+EF+
Sbjct:   49 LKALISKLDTDGDGKISFEEFLTAIEKYKKGHRAGEL-RAVFNVLDQNGDGYITVDELKESLSKLGESLSQEELEDMIRVADVDQDGKVKYEEFV 142          
BLAST of 16 kDa calcium-binding protein vs. UniProt/SwissProt
Match: sp|Q07167|SM16_SCHMA (16 kDa calcium-binding protein OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.016e-21
Identity = 54/140 (38.57%), Postives = 82/140 (58.57%), Query Frame = 3
Query:   33 MVSNEQLIAKFKEMDRNGDNXXXXXXXXXXXXXXGFDKNFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSN--NFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLKN 446
            M   +Q    F  +D++ +  L+ EEI+  L++ G   N     +K  D N DGKI+L EY   L   P  E+    WR+VF S D+DGSGK+S +E+   LK++  + D+ +L+NW+   D N DGE+DYDEFL +++ 
Sbjct:    1 MSEEKQWTEVFHAIDKDKNGFLTREEIAQCLKEVGVCPNVADKIIKETDMNSDGKISLEEYLNALRKLPPREKCVARWREVFQSIDKDGSGKVSIKELDEFLKTSGMDIDQNSLRNWMTQNDKNKDGELDYDEFLAYVRQ 140          
BLAST of 16 kDa calcium-binding protein vs. UniProt/SwissProt
Match: sp|Q9LX27|CML4_ARATH (Calmodulin-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=CML4 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 1.144e-7
Identity = 46/135 (34.07%), Postives = 77/135 (57.04%), Query Frame = 3
Query:   63 FKEMDRNGDNXXXXXXXXXXXXXXGF---DKNFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNFDK-KTLQNW---LRNRDSNNDGEMDYDEFLDFLKN 446
            F+  D+NGD  ++ EE++ SLE  G    DK+ I+  ++  DAN DG + +NE+++      E +   +M RD FN FD+DG G ++ EE+  ++ S    + KTL+     +   D + DG ++Y EFL  +K+
Sbjct:   56 FQMFDKNGDGRITKEELNDSLENLGIFMPDKDLIQ-MIQKMDANGDGCVDINEFESLYGSIVEEKEEGDM-RDAFNVFDQDGDGFITVEELNSVMTSLGLKQGKTLECCKEMIMQVDEDGDGRVNYKEFLQMMKS 188          
BLAST of 16 kDa calcium-binding protein vs. UniProt/SwissProt
Match: sp|Q9ZSA3|CDPKM_ARATH (Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana OX=3702 GN=CPK22 PE=3 SV=2)

HSP 1 Score: 52.373 bits (124), Expect = 1.532e-6
Identity = 29/99 (29.29%), Postives = 55/99 (55.56%), Query Frame = 3
Query:  153 IKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNF-DKKTLQNWLRNRDSNNDGEMDYDEFLDFLKN 446
            +K  ++  D + +G I   E+ +        ER  ++++  F  FD+DGSG ++ EEV + +K +   D+   ++ +   D NNDG++DY+EF   ++N
Sbjct:  387 VKQLMEAADVDGNGTIDYIEFISATMHRHRLERDEHLYK-AFQYFDKDGSGHITKEEVEIAMKEHGMGDEANAKDLISEFDKNNDGKIDYEEFCTMMRN 484          
BLAST of 16 kDa calcium-binding protein vs. UniProt/SwissProt
Match: sp|Q9NZT1|CALL5_HUMAN (Calmodulin-like protein 5 OS=Homo sapiens OX=9606 GN=CALML5 PE=1 SV=2)

HSP 1 Score: 49.2914 bits (116), Expect = 2.995e-6
Identity = 25/76 (32.89%), Postives = 43/76 (56.58%), Query Frame = 3
Query:  231 LYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSN--NFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLKNHK 452
            L PE E +Y   +  F++ D DG+G ++++E+G  LK+   N  +  L+  +   DS+ DGE+ + EFL   K  +
Sbjct:    5 LTPEEEAQY---KKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKAR 77          
BLAST of 16 kDa calcium-binding protein vs. UniProt/SwissProt
Match: sp|P60204|CALM_EMENI (Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=camA PE=3 SV=2)

HSP 1 Score: 48.1358 bits (113), Expect = 7.429e-6
Identity = 20/68 (29.41%), Postives = 45/68 (66.18%), Query Frame = 3
Query:  243 NERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKS--NNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
             E + + +++ F+ FD+DG G+++++E+G +++S   N  +  LQ+ +   D++N+G +D+ EFL  +
Sbjct:    6 TEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMM 73          
BLAST of 16 kDa calcium-binding protein vs. TrEMBL
Match: A0A0R3UPZ2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS9933 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 5.362e-26
Identity = 58/136 (42.65%), Postives = 88/136 (64.71%), Query Frame = 3
Query:   45 EQLIAKFKEMDRNGDNXXXXXXXXXXXXXXGFDKNFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNFDKKT--LQNWLRNRDSNNDGEMDYDEFLDFLKN 446
            E  + KF+EMD +    L+ +E+ + L  SGFDK FIK F++ FDA+ DG IT +EY   + + P+ E++   WR VF+  D+D SG++S +E+  +LK   F  K   L++W+R +D NNDGEMD+ EF+ F+ N
Sbjct:    6 EHFLRKFREMDVDKSGVLTKDEVKTCLLASGFDKKFIKQFIRKFDADGDGNITEDEYLRVVCILPKKEQKLAFWRSVFDDIDKDKSGRISCQELHHLLKDMGFPVKVSELKDWIRGQDKNNDGEMDFQEFVAFMSN 141          
BLAST of 16 kDa calcium-binding protein vs. TrEMBL
Match: A0A5K3FQZ9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.046e-25
Identity = 58/136 (42.65%), Postives = 88/136 (64.71%), Query Frame = 3
Query:   45 EQLIAKFKEMDRNGDNXXXXXXXXXXXXXXGFDKNFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNFDKKT--LQNWLRNRDSNNDGEMDYDEFLDFLKN 446
            E  + KF+EMD +    L+ +E+ + L  SGFDK FIK F++ FDA+ DG IT +EY   + + P+ E++   WR VF+  D+D SG++S +E+  +LK   F  K   L++W+R +D NNDGEMD+ EF+ F+ N
Sbjct:   39 EHFLRKFREMDVDKSGVLTKDEVKTCLLASGFDKKFIKQFIRKFDADGDGNITEDEYLRVVCILPKKEQKLAFWRSVFDDIDKDKSGRISCQELHHLLKDMGFPVKVSELKDWIRGQDKNNDGEMDFQEFVAFMSN 174          
BLAST of 16 kDa calcium-binding protein vs. TrEMBL
Match: A0A1I8FZX3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032719g1 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.823e-24
Identity = 56/145 (38.62%), Postives = 95/145 (65.52%), Query Frame = 3
Query:   33 MVSNEQLIAKFKEMDRNGDNXXXXXXXX-XXXXXXGFDKNFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILK----SNNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLKNHK 452
            M + E++ + F+ MD NGD  LS +E++   ++K GF+ +F++ FL  FD+N DGK+TLNE   KL L P  E  Y+ W+ VF+SFD+DGSG + ++E+  +L+    +  +++   +NW+R  DS+ DG + Y EFL++++  +
Sbjct:    1 MSTIEEMESIFRAMDANGDGVLSEQELTDYLVKKKGFNADFVQTFLANFDSNNDGKVTLNECLEKLGLIPPQEVEYSAWKTVFDSFDKDGSGFIEADELPKVLEEIGSTTKYNRSNFENWIREHDSDADGRVSYSEFLNWVRGPR 145          
BLAST of 16 kDa calcium-binding protein vs. TrEMBL
Match: A0A183A6I0 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2565 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.895e-24
Identity = 55/133 (41.35%), Postives = 84/133 (63.16%), Query Frame = 3
Query:   48 QLIAKFKEMDRNGDNXXXXXXXXXXXXXXGFDKNFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNFDKKT--LQNWLRNRDSNNDGEMDYDEFLDFL 440
            +L+ KFK+MD++G   LS +E+   +   GFD  FI +F+K FD + DG ITL EY+  LN+ P +E+   MWR+VF+  D D SGK+S  E+ +++K   +D     L+ WL  +D + DGE+  +EFL F+
Sbjct:    8 RLLEKFKQMDKDGSGSLSRKEVKRCMRACGFDDCFINDFIKTFDLDGDGNITLAEYERVLNIVPAHEKELAMWRNVFHEVDTDHSGKISVSELEVLMKDMGYDCHASDLKCWLSAQDLDKDGELSLNEFLSFI 140          
BLAST of 16 kDa calcium-binding protein vs. TrEMBL
Match: A0A3P7LGX1 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS6968 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.066e-23
Identity = 60/133 (45.11%), Postives = 81/133 (60.90%), Query Frame = 3
Query:   48 QLIAKFKEMDRNGDNXXXXXXXXXXXXXXGFDKNFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNFDKKT--LQNWLRNRDSNNDGEMDYDEFLDFL 440
              + KF+EMD + +  LS EE+ S L  SGFDK FIK FL  FDAN DG IT  EY   +   P+ E+    W+ VF+  D+D SGK+S  E+  +LK  NFD K   LQ W+R  D ++DGE+D+ EF+  +
Sbjct:    7 HFLRKFREMDIDKNGILSKEEVKSCLRASGFDKKFIKKFLAVFDANGDGNITEEEYLRVVCTVPQREKAEAFWKSVFDDVDKDKSGKISCPELMTLLKDMNFDCKLCELQEWVRRHDHDSDGEIDFQEFMTMM 139          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Cavefish
Match: CABP7 (calcium-binding protein 7-like [Source:NCBI gene;Acc:103036526])

HSP 1 Score: 50.0618 bits (118), Expect = 3.798e-7
Identity = 27/78 (34.62%), Postives = 50/78 (64.10%), Query Frame = 3
Query:  213 YKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNF--DKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
            Y+A +NL PE+E      R+ F  FDRDG+G +S +E+G+ ++S  +  ++  L+  ++  D + DG++D++EF+  L
Sbjct:   24 YRAPVNL-PEDE--VEEIREAFKVFDRDGNGFISKQELGMAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLL 98          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Sea Lamprey
Match: CALML3 (calmodulin like 3 [Source:HGNC Symbol;Acc:HGNC:1452])

HSP 1 Score: 44.669 bits (104), Expect = 2.538e-6
Identity = 19/68 (27.94%), Postives = 42/68 (61.76%), Query Frame = 3
Query:  243 NERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKS--NNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
             E +   +++ F+ FD+DG G ++++E+G +++S   N  +  LQ+ +   D++ +G +D+ EFL  +
Sbjct:    6 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMM 73          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Sea Lamprey
Match: CALM3 (calmodulin 3 [Source:HGNC Symbol;Acc:HGNC:1449])

HSP 1 Score: 44.669 bits (104), Expect = 2.562e-6
Identity = 19/68 (27.94%), Postives = 42/68 (61.76%), Query Frame = 3
Query:  243 NERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKS--NNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
             E +   +++ F+ FD+DG G ++++E+G +++S   N  +  LQ+ +   D++ +G +D+ EFL  +
Sbjct:    6 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMM 73          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006008.1 (pep scaffold:Pmarinus_7.0:GL476713:142259:146509:-1 gene:ENSPMAG00000005430.1 transcript:ENSPMAT00000006008.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.5134 bits (101), Expect = 6.535e-6
Identity = 19/68 (27.94%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  243 NERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKS--NNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
             E +   +++ F+ FD+DG G ++ +E+G +++S   N  +  LQ+ +   D++ +G +D+ EFL  +
Sbjct:    6 TEEQIAEFKEAFSLFDKDGDGTITVKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMM 73          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Nematostella
Match: EDO30674 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T043])

HSP 1 Score: 51.2174 bits (121), Expect = 3.225e-8
Identity = 24/68 (35.29%), Postives = 45/68 (66.18%), Query Frame = 3
Query:  252 RYNMWRDVFNSFDRDGSGKLSSEEVGLILKS--NNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLKNH 449
            + N  ++ F+ FD+DGSG +S+EE+ +++KS   N   + LQ  ++  D++ +GE+D++EFL  +K  
Sbjct:   17 QRNELQEAFSLFDKDGSGTISNEELEVVMKSLGQNPSDEELQQMIQEVDADGNGEVDFEEFLAMMKKQ 84          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Nematostella
Match: EDO31593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI0])

HSP 1 Score: 46.9802 bits (110), Expect = 2.336e-6
Identity = 27/99 (27.27%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  153 IKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNFD--KKTLQNWLRNRDSNNDGEMDYDEFLDFLK 443
            +K  +K  D +  G I L E+   +    +N+   +  R+ F+ FD+DG+G +S++E+  +L    F+  +K     ++  D + DG ++Y+EF+  +K
Sbjct:  182 LKAMIKQADKDGSGDIDLPEFIELMASKSKNDTTESDLREAFSLFDKDGNGLISAQEMKFVLTCMGFNITEKEAVELVKQADIDGDGHINYEEFIRTMK 280          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Nematostella
Match: EDO48778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIA0])

HSP 1 Score: 45.0542 bits (105), Expect = 3.932e-6
Identity = 22/71 (30.99%), Postives = 43/71 (60.56%), Query Frame = 3
Query:  243 NERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKS--NNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLKNH 449
             E + + +RD F  FD+DG+G +++ E+G I++S   N  +  LQ+ +   D + +G +D+ EF++ + N 
Sbjct:    8 TEEQIDEYRDAFKFFDKDGNGHITTRELGAIMRSLGQNPTENELQDMVNEVDYDGNGVVDFHEFVNMMINQ 78          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Nematostella
Match: EDO28154 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T798])

HSP 1 Score: 45.0542 bits (105), Expect = 4.098e-6
Identity = 18/70 (25.71%), Postives = 42/70 (60.00%), Query Frame = 3
Query:  243 NERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNFDKK--TLQNWLRNRDSNNDGEMDYDEFLDFLKN 446
             E +   +++ F SFD++G G++ +EE+G++++S     K   L+  ++  D +  G++D  EF++ + +
Sbjct:   10 TEEQIREFKNAFMSFDKNGDGRIDAEELGIVMRSIGLHPKDEELKAMIKQADKDGSGDIDLPEFIELMAS 79          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Nematostella
Match: EDO46518 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPI8])

HSP 1 Score: 44.669 bits (104), Expect = 4.935e-6
Identity = 19/68 (27.94%), Postives = 42/68 (61.76%), Query Frame = 3
Query:  243 NERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKS--NNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
             E +   +++ F+ FD+DG G ++++E+G +++S   N  +  LQ+ +   D++ +G +D+ EFL  +
Sbjct:    6 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMM 73          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Medaka
Match: ENSORLT00000001047.2 (calcium-binding protein 7 [Source:NCBI gene;Acc:101163331])

HSP 1 Score: 49.2914 bits (116), Expect = 6.867e-7
Identity = 27/78 (34.62%), Postives = 49/78 (62.82%), Query Frame = 3
Query:  213 YKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNF--DKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
            Y A +NL PE+E      R+ F  FDRDG+G +S +E+G+ ++S  +  ++  L+  ++  D + DG++D++EF+  L
Sbjct:   24 YSAPVNL-PEDE--VEEIREAFKVFDRDGNGFISKQELGMAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLL 98          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Medaka
Match: tnnc1b (troponin C, slow skeletal and cardiac muscles [Source:NCBI gene;Acc:101171215])

HSP 1 Score: 46.595 bits (109), Expect = 3.804e-6
Identity = 25/72 (34.72%), Postives = 44/72 (61.11%), Query Frame = 3
Query:  237 PENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSN--NFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLKN 446
            PE E       ++F  FD++G G +  EE+  +L+S   +  +  ++  +++ D NNDG++DYDEFL+F+K 
Sbjct:   86 PEEE-----LAELFRMFDKNGDGYIDLEELKTMLESTGESITEDDIEELMKDGDKNNDGKIDYDEFLEFMKG 152          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Medaka
Match: tnnc1b (troponin C, slow skeletal and cardiac muscles [Source:NCBI gene;Acc:101171215])

HSP 1 Score: 46.2098 bits (108), Expect = 5.044e-6
Identity = 25/71 (35.21%), Postives = 44/71 (61.97%), Query Frame = 3
Query:  237 PENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSN--NFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLK 443
            PE E       ++F  FD++G G +  EE+  +L+S   +  +  ++  +++ D NNDG++DYDEFL+F+K
Sbjct:   93 PEEE-----LAELFRMFDKNGDGYIDLEELKTMLESTGESITEDDIEELMKDGDKNNDGKIDYDEFLEFMK 158          
BLAST of 16 kDa calcium-binding protein vs. Ensembl Medaka
Match: ENSORLT00000031360.1 (guanylyl cyclase-activating protein 2 [Source:NCBI gene;Acc:101158587])

HSP 1 Score: 45.8246 bits (107), Expect = 8.330e-6
Identity = 33/111 (29.73%), Postives = 52/111 (46.85%), Query Frame = 3
Query:  141 DKNFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNM-WRDVFNSFDRDGSGKLSSEEVGLILKSNNFDKK------------TLQNWLRNRDSNNDGEMDYDEFLD 434
            +  ++K   + FD N+DGKI   EY A +NL    +    + W   F  +DRDG+G LS +EVG ++   N  KK                  +  D N D ++  +EF++
Sbjct:   51 ESAYMKIVFQSFDTNKDGKIDFMEYVAAVNLILRGKLEDKLKWS--FKVYDRDGNGSLSRQEVGHVVHIINNIKKHEDPNLTESADDICDRMFQLLDKNRDSQISLEEFIE 159          
BLAST of 16 kDa calcium-binding protein vs. Planmine SMEST
Match: SMESG000000553.1 (SMESG000000553.1)

HSP 1 Score: 246.128 bits (627), Expect = 1.872e-83
Identity = 139/140 (99.29%), Postives = 139/140 (99.29%), Query Frame = 3
Query:   33 MVSNEQLIAKFKEMDRNGDNXXXXXXXXXXXXXXGFDKNFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLKNHK 452
            MVSNEQLIAKFKEMDRNGDNELSVEEISSSLEKSGFDK FIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLKNHK
Sbjct:    1 MVSNEQLIAKFKEMDRNGDNELSVEEISSSLEKSGFDKTFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLKNHK 140          
BLAST of 16 kDa calcium-binding protein vs. Planmine SMEST
Match: SMESG000066843.1 (SMESG000066843.1)

HSP 1 Score: 119.013 bits (297), Expect = 1.209e-33
Identity = 63/136 (46.32%), Postives = 98/136 (72.06%), Query Frame = 3
Query:   33 MVSNEQLIAKFKEMDRNGDNXXXXXXXXXXXXXXGFDKNFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKSNNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
            M +NEQL+ +F +MD + +NELS EE++  L K+GF   +IK F++ FDAN+DGKI+ +E+  ++     +ER+  MW  VF SFD D SGKLS++E+  +LK NN+DK+TL+ ++++ D + DGE++Y EF +FL
Sbjct:    1 MATNEQLLEQFAKMDTDHNNELSTEEVTCFLSKNGFAAEYIKKFMETFDANKDGKISKSEFTKRICNQTPHERKIEMWEAVFKSFDTDCSGKLSAKELQAVLKGNNYDKETLEKFIKSHDKDGDGELNYKEFFEFL 136          
BLAST of 16 kDa calcium-binding protein vs. Planmine SMEST
Match: SMESG000016862.1 (SMESG000016862.1)

HSP 1 Score: 75.485 bits (184), Expect = 2.975e-17
Identity = 47/103 (45.63%), Postives = 67/103 (65.05%), Query Frame = 3
Query:   33 MVSNEQLIAKFKEMDRNGDNXXXXXXXXXXXXXXG-FDKNFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLIL 338
            M  NE+LI KF EMD + + EL+  E+   L++ G F K  ++  +K FD N DGKITL+EYK KLN+     +R+ +W++VF+SFD D SG L  EE+  I+
Sbjct:    1 MSLNERLIEKFTEMDLDQNGELTPNEVKYILQQDGKFSKESVEEIIKEFDINSDGKITLDEYKEKLNIVDPVGKRFEIWKNVFDSFDLDHSGGLELEEIQKII 103          
BLAST of 16 kDa calcium-binding protein vs. Planmine SMEST
Match: SMESG000057759.1 (SMESG000057759.1)

HSP 1 Score: 69.707 bits (169), Expect = 7.811e-15
Identity = 47/140 (33.57%), Postives = 77/140 (55.00%), Query Frame = 3
Query:   33 MVSNEQLIAKFKEMDRNGDNXXXXXXXXXXXXXXGFDKNFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEV-GLILKSNN---FDKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
            M + E+ +  F ++D++    + + E+   L K GF   FIK F+  FD N+DGKIT  E+   L   P   R Y  W  +F   D D +G ++  E+  +I +S+N     KK L ++++  D +NDG ++Y+EFL F+
Sbjct:    1 METEEEFLQIFYDIDKDKSGAIELNEVEIYLRKHGFQSEFIKLFIDTFDLNKDGKITFKEFINSLKKMPLKHRNYTEWFSLFKRLDEDSNGYITIGELFNIIQESDNKHSIKKKQLSDFVQKNDLDNDGLLNYNEFLKFI 140          
BLAST of 16 kDa calcium-binding protein vs. Planmine SMEST
Match: SMESG000065184.1 (SMESG000065184.1)

HSP 1 Score: 45.8246 bits (107), Expect = 5.426e-6
Identity = 41/144 (28.47%), Postives = 74/144 (51.39%), Query Frame = 3
Query:   30 KMVSNEQLIA---KFKEMDRNGDNXXXXXXXXXXXXXXGFD--KNFIKNFLKGFDANEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGLILKS--NNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFL 440
            K++S +QL+     FK  D+N D  +S EE++  +   G    ++ I N +   D++ +G I   E+   LN   +  +    ++ VF  FD+D +G +   E+ + LKS       K +Q  +   DS+ DG++++DEF+  L
Sbjct:   17 KLLSVDQLMELRNAFKFFDKNNDGTISEEELNEVMLSLGLSPSRSHINNMISQVDSDNNGCIDFQEF---LNTMIDRYKIEKQFQQVFKFFDKDDNGYIDQSELKMALKSIGEKVTDKEVQEMIEEADSDGDGQVNFDEFVSVL 157          
The following BLAST results are available for this feature:
BLAST of 16 kDa calcium-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CALML56.236e-732.89calmodulin like 5 [Source:HGNC Symbol;Acc:HGNC:181... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
C50C3.53.799e-633.80Uncharacterized calcium-binding protein C50C3.5 [... [more]
cal-15.536e-624.75Calmodulin-like protein [Source:UniProtKB/Swiss-P... [more]
cal-18.210e-624.75Calmodulin-like protein [Source:UniProtKB/Swiss-P... [more]
cmd-19.018e-627.94Calmodulin [Source:UniProtKB/Swiss-Prot;Acc:O1630... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
FO704871.14.356e-734.62calcium-binding protein 7-like [Source:NCBI gene;A... [more]
cabp7b1.678e-633.33calcium binding protein 7b [Source:ZFIN;Acc:ZDB-GE... [more]
cabp7b1.793e-633.33calcium binding protein 7b [Source:ZFIN;Acc:ZDB-GE... [more]
calm2a2.710e-627.94calmodulin 2a (phosphorylase kinase, delta) [Sourc... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CALM27.695e-630.65calmodulin 1 (phosphorylase kinase, delta) [Source... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Calm44.815e-627.37calmodulin 4 [Source:MGI Symbol;Acc:MGI:1931464][more]
back to top
BLAST of 16 kDa calcium-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q07167|SM16_SCHMA2.016e-2138.5716 kDa calcium-binding protein OS=Schistosoma mans... [more]
sp|Q9LX27|CML4_ARATH1.144e-734.07Calmodulin-like protein 4 OS=Arabidopsis thaliana ... [more]
sp|Q9ZSA3|CDPKM_ARATH1.532e-629.29Calcium-dependent protein kinase 22 OS=Arabidopsis... [more]
sp|Q9NZT1|CALL5_HUMAN2.995e-632.89Calmodulin-like protein 5 OS=Homo sapiens OX=9606 ... [more]
sp|P60204|CALM_EMENI7.429e-629.41Calmodulin OS=Emericella nidulans (strain FGSC A4 ... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UPZ25.362e-2642.65Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FQZ91.046e-2542.65Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A1I8FZX31.823e-2438.62Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A183A6I01.895e-2441.35Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A3P7LGX13.066e-2345.11Uncharacterized protein OS=Dibothriocephalus latus... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CABP73.798e-734.62calcium-binding protein 7-like [Source:NCBI gene;A... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CALML32.538e-627.94calmodulin like 3 [Source:HGNC Symbol;Acc:HGNC:145... [more]
CALM32.562e-627.94calmodulin 3 [Source:HGNC Symbol;Acc:HGNC:1449][more]
ENSPMAT00000006008.16.535e-627.94pep scaffold:Pmarinus_7.0:GL476713:142259:146509:-... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO306743.225e-835.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315932.336e-627.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487783.932e-630.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281544.098e-625.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465184.935e-627.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000001047.26.867e-734.62calcium-binding protein 7 [Source:NCBI gene;Acc:10... [more]
tnnc1b3.804e-634.72troponin C, slow skeletal and cardiac muscles [Sou... [more]
tnnc1b5.044e-635.21troponin C, slow skeletal and cardiac muscles [Sou... [more]
ENSORLT00000031360.18.330e-629.73guanylyl cyclase-activating protein 2 [Source:NCBI... [more]
back to top
BLAST of 16 kDa calcium-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000553.11.872e-8399.29SMESG000000553.1[more]
SMESG000066843.11.209e-3346.32SMESG000066843.1[more]
SMESG000016862.12.975e-1745.63SMESG000016862.1[more]
SMESG000057759.17.811e-1533.57SMESG000057759.1[more]
SMESG000065184.15.426e-628.47SMESG000065184.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012133 ID=SMED30012133|Name=16 kDa calcium-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=759bp
ACATTTGAAAATTAAAAACTAGAAAGTGAAAAATGGTTTCCAACGAGCAA
TTAATTGCCAAGTTCAAAGAAATGGACAGGAACGGTGACAACGAATTGTC
TGTGGAAGAAATCTCCAGTAGTTTGGAGAAGTCGGGATTCGATAAAAACT
TTATAAAAAATTTTCTAAAAGGATTCGATGCCAACGAAGACGGCAAAATC
ACTCTCAATGAATATAAAGCTAAACTGAATTTATATCCGGAAAATGAAAG
AAGATATAATATGTGGAGAGACGTCTTTAACAGTTTCGACAGAGACGGAT
CTGGAAAGTTAAGCAGCGAAGAAGTCGGTTTGATTCTCAAATCGAATAAT
TTTGATAAAAAAACCCTTCAAAATTGGCTCCGAAATCGAGACTCCAACAA
CGACGGAGAAATGGATTATGATGAATTTTTAGATTTTCTAAAAAATCATA
AATAATTATTCTAATTGGAATCGGATATTGTTTGACAAAATTAAATATTT
TGTTTATTATAATTATCTGTTTATTATTTGCATGTTAGAATTACATCACG
CTATTTATCTTTGCAAATGATTCAGTTAGAATTTCTTTGCCGCAATTTCT
TCATTGTTAATTCGTGATGCTTAGCGTTGCGTAATCATTCTGATTGGCTG
TCGAGAAATTCCAAGCCGATCATTGGCACATTTTCTGAAATTCTATCGAT
TTTATTCATTCGATCTGAGATTTGTTGATAATAAAAATTTTTCATTTATT
AAAAAAAAA
back to top

protein sequence of SMED30012133-orf-1

>SMED30012133-orf-1 ID=SMED30012133-orf-1|Name=SMED30012133-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=141bp
MVSNEQLIAKFKEMDRNGDNELSVEEISSSLEKSGFDKNFIKNFLKGFDA
NEDGKITLNEYKAKLNLYPENERRYNMWRDVFNSFDRDGSGKLSSEEVGL
ILKSNNFDKKTLQNWLRNRDSNNDGEMDYDEFLDFLKNHK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0005509calcium ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000421tail
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 40..68
e-value: 5.3
score: 11.9
coord: 6..34
e-value: 6.8
score: 11.0
coord: 77..105
e-value: 0.028
score: 23.6
coord: 111..139
e-value: 0.47
score: 19.5
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 79..136
e-value: 3.9E-10
score: 40.0
coord: 5..63
e-value: 6.7E-9
score: 36.1
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 73..108
score: 12.477
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 41..71
score: 8.934
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 109..140
score: 9.827
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 2..37
score: 11.25
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 68..140
e-value: 2.9E-16
score: 61.0
coord: 1..67
e-value: 1.5E-11
score: 45.8
NoneNo IPR availablePANTHERPTHR23050CALCIUM BINDING PROTEINcoord: 79..135
coord: 5..104
NoneNo IPR availablePANTHERPTHR23050:SF382coord: 5..104
coord: 79..135
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 49..61
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 15..27
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 120..132
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 86..98
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 6..138