Phospholipase A2 group VI

Overview
NamePhospholipase A2 group VI
Smed IDSMED30012121
Length (bp)951
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phospholipase A2 group VI (SMED30012121) t-SNE clustered cells

Violin plots show distribution of expression levels for Phospholipase A2 group VI (SMED30012121) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phospholipase A2 group VI (SMED30012121) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phospholipase A2 group VI (SMED30012121) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012121

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012121SMESG000010440.1 Contig4405GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012121SMESG000024845.1 Contig4405GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phospholipase A2 group VI vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 77.411 bits (189), Expect = 5.008e-15
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+  G  +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  202 KMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL 342          

HSP 2 Score: 59.6918 bits (143), Expect = 3.495e-9
Identity = 38/141 (26.95%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  222 VMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSA 641
            VM   V Y    I    + G  PIH+A  + +L+I+  L+ N    ++ +       H   + G +E++  LL N   ++A       P+H A   G  E+V+LL+ +    D  T +G TPL I+++  ++D  +++  A
Sbjct:  392 VMELLVKYGAS-IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 531          

HSP 3 Score: 59.3066 bits (142), Expect = 4.183e-9
Identity = 32/119 (26.89%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+H+A   +N  +   L+           N Y P H   KK  ++I + LL            G+ P+H A  +G+ ++V LL+  G  I + T  GLT L +A+Q ++++  +++
Sbjct:  575 GLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADIL 693          

HSP 4 Score: 57.3806 bits (137), Expect = 1.939e-8
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+      + I ++   P H     G+L I+  LL+N    +  +  G   +H A   G  EVVR L+  G  +D +  +  TPL IAS+  + +   L+
Sbjct:  371 NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 495          

HSP 5 Score: 56.9954 bits (136), Expect = 2.237e-8
Identity = 31/119 (26.05%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  255 FINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
             ++ +  + + P+HIA  +   +I++ L+ +    +   TN Y P H   ++G +++ + LLE       A   G  P+H A   G  +V +LL+      D    +GLTPL +A+ ++
Sbjct:  468 LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYD 586          

HSP 6 Score: 55.8398 bits (133), Expect = 5.983e-8
Identity = 31/112 (27.68%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H+A   ++++ +K L+ +K   + +  +Y    H     G+  +   LL+ +    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+
Sbjct:  307 RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAA 418          

HSP 7 Score: 52.7582 bits (125), Expect = 6.069e-7
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  270 NDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +G+  +H+A     +++++ L+ N     L+D        P H   + G  EI+  LL++    +AA   G  P+H +  +G  +V  +L+  G    + T  G TPL +A+++  +D   L+
Sbjct:  440 NIRGETALHMAARAGQVEVVRCLLRNGA---LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL 561          

HSP 8 Score: 50.447 bits (119), Expect = 2.946e-6
Identity = 30/102 (29.41%), Postives = 51/102 (50.00%), Query Frame = 3
Query:  315 NLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            NLD +   +    D    + N     H   K+G++ ++  LL     +++A   G   +H A L G  EVV++L+  G  I+ ++ +G TPL +A+Q   ID
Sbjct:   22 NLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHID 123          
BLAST of Phospholipase A2 group VI vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 77.411 bits (189), Expect = 5.088e-15
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+  G  +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  195 KMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL 335          

HSP 2 Score: 59.6918 bits (143), Expect = 3.543e-9
Identity = 38/141 (26.95%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  222 VMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSA 641
            VM   V Y    I    + G  PIH+A  + +L+I+  L+ N    ++ +       H   + G +E++  LL N   ++A       P+H A   G  E+V+LL+ +    D  T +G TPL I+++  ++D  +++  A
Sbjct:  385 VMELLVKYGAS-IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 524          

HSP 3 Score: 59.3066 bits (142), Expect = 4.240e-9
Identity = 32/119 (26.89%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+H+A   +N  +   L+           N Y P H   KK  ++I + LL            G+ P+H A  +G+ ++V LL+  G  I + T  GLT L +A+Q ++++  +++
Sbjct:  568 GLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADIL 686          

HSP 4 Score: 57.3806 bits (137), Expect = 1.964e-8
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+      + I ++   P H     G+L I+  LL+N    +  +  G   +H A   G  EVVR L+  G  +D +  +  TPL IAS+  + +   L+
Sbjct:  364 NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 488          

HSP 5 Score: 56.9954 bits (136), Expect = 2.266e-8
Identity = 31/119 (26.05%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  255 FINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
             ++ +  + + P+HIA  +   +I++ L+ +    +   TN Y P H   ++G +++ + LLE       A   G  P+H A   G  +V +LL+      D    +GLTPL +A+ ++
Sbjct:  461 LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYD 579          

HSP 6 Score: 55.8398 bits (133), Expect = 6.059e-8
Identity = 31/112 (27.68%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H+A   ++++ +K L+ +K   + +  +Y    H     G+  +   LL+ +    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+
Sbjct:  300 RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAA 411          

HSP 7 Score: 52.7582 bits (125), Expect = 6.143e-7
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  270 NDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +G+  +H+A     +++++ L+ N     L+D        P H   + G  EI+  LL++    +AA   G  P+H +  +G  +V  +L+  G    + T  G TPL +A+++  +D   L+
Sbjct:  433 NIRGETALHMAARAGQVEVVRCLLRNGA---LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL 554          

HSP 8 Score: 50.447 bits (119), Expect = 2.981e-6
Identity = 30/102 (29.41%), Postives = 51/102 (50.00%), Query Frame = 3
Query:  315 NLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            NLD +   +    D    + N     H   K+G++ ++  LL     +++A   G   +H A L G  EVV++L+  G  I+ ++ +G TPL +A+Q   ID
Sbjct:   15 NLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHID 116          
BLAST of Phospholipase A2 group VI vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 77.411 bits (189), Expect = 5.278e-15
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+  G  +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  202 KMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL 342          

HSP 2 Score: 59.6918 bits (143), Expect = 3.655e-9
Identity = 38/141 (26.95%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  222 VMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSA 641
            VM   V Y    I    + G  PIH+A  + +L+I+  L+ N    ++ +       H   + G +E++  LL N   ++A       P+H A   G  E+V+LL+ +    D  T +G TPL I+++  ++D  +++  A
Sbjct:  392 VMELLVKYGAS-IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 531          

HSP 3 Score: 59.3066 bits (142), Expect = 4.374e-9
Identity = 32/119 (26.89%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+H+A   +N  +   L+           N Y P H   KK  ++I + LL            G+ P+H A  +G+ ++V LL+  G  I + T  GLT L +A+Q ++++  +++
Sbjct:  575 GLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADIL 693          

HSP 4 Score: 57.3806 bits (137), Expect = 2.024e-8
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+      + I ++   P H     G+L I+  LL+N    +  +  G   +H A   G  EVVR L+  G  +D +  +  TPL IAS+  + +   L+
Sbjct:  371 NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 495          

HSP 5 Score: 56.9954 bits (136), Expect = 2.336e-8
Identity = 31/119 (26.05%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  255 FINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
             ++ +  + + P+HIA  +   +I++ L+ +    +   TN Y P H   ++G +++ + LLE       A   G  P+H A   G  +V +LL+      D    +GLTPL +A+ ++
Sbjct:  468 LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYD 586          

HSP 6 Score: 55.8398 bits (133), Expect = 6.241e-8
Identity = 31/112 (27.68%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H+A   ++++ +K L+ +K   + +  +Y    H     G+  +   LL+ +    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+
Sbjct:  307 RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAA 418          

HSP 7 Score: 52.7582 bits (125), Expect = 6.318e-7
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  270 NDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +G+  +H+A     +++++ L+ N     L+D        P H   + G  EI+  LL++    +AA   G  P+H +  +G  +V  +L+  G    + T  G TPL +A+++  +D   L+
Sbjct:  440 NIRGETALHMAARAGQVEVVRCLLRNGA---LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL 561          

HSP 8 Score: 50.447 bits (119), Expect = 3.062e-6
Identity = 30/102 (29.41%), Postives = 51/102 (50.00%), Query Frame = 3
Query:  315 NLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            NLD +   +    D    + N     H   K+G++ ++  LL     +++A   G   +H A L G  EVV++L+  G  I+ ++ +G TPL +A+Q   ID
Sbjct:   22 NLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHID 123          
BLAST of Phospholipase A2 group VI vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 77.411 bits (189), Expect = 5.433e-15
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+  G  +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  238 KMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL 378          

HSP 2 Score: 59.6918 bits (143), Expect = 3.747e-9
Identity = 38/141 (26.95%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  222 VMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSA 641
            VM   V Y    I    + G  PIH+A  + +L+I+  L+ N    ++ +       H   + G +E++  LL N   ++A       P+H A   G  E+V+LL+ +    D  T +G TPL I+++  ++D  +++  A
Sbjct:  428 VMELLVKYGAS-IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 567          

HSP 3 Score: 59.3066 bits (142), Expect = 4.483e-9
Identity = 32/119 (26.89%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+H+A   +N  +   L+           N Y P H   KK  ++I + LL            G+ P+H A  +G+ ++V LL+  G  I + T  GLT L +A+Q ++++  +++
Sbjct:  611 GLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADIL 729          

HSP 4 Score: 57.3806 bits (137), Expect = 2.074e-8
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+      + I ++   P H     G+L I+  LL+N    +  +  G   +H A   G  EVVR L+  G  +D +  +  TPL IAS+  + +   L+
Sbjct:  407 NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 531          

HSP 5 Score: 56.9954 bits (136), Expect = 2.392e-8
Identity = 31/119 (26.05%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  255 FINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
             ++ +  + + P+HIA  +   +I++ L+ +    +   TN Y P H   ++G +++ + LLE       A   G  P+H A   G  +V +LL+      D    +GLTPL +A+ ++
Sbjct:  504 LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYD 622          

HSP 6 Score: 55.8398 bits (133), Expect = 6.389e-8
Identity = 31/112 (27.68%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H+A   ++++ +K L+ +K   + +  +Y    H     G+  +   LL+ +    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+
Sbjct:  343 RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAA 454          

HSP 7 Score: 52.7582 bits (125), Expect = 6.460e-7
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  270 NDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +G+  +H+A     +++++ L+ N     L+D        P H   + G  EI+  LL++    +AA   G  P+H +  +G  +V  +L+  G    + T  G TPL +A+++  +D   L+
Sbjct:  476 NIRGETALHMAARAGQVEVVRCLLRNGA---LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL 597          

HSP 8 Score: 50.447 bits (119), Expect = 3.128e-6
Identity = 30/102 (29.41%), Postives = 51/102 (50.00%), Query Frame = 3
Query:  315 NLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            NLD +   +    D    + N     H   K+G++ ++  LL     +++A   G   +H A L G  EVV++L+  G  I+ ++ +G TPL +A+Q   ID
Sbjct:   58 NLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHID 159          
BLAST of Phospholipase A2 group VI vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 77.411 bits (189), Expect = 5.445e-15
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+  G  +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  202 KMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL 342          

HSP 2 Score: 59.6918 bits (143), Expect = 3.754e-9
Identity = 38/141 (26.95%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  222 VMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSA 641
            VM   V Y    I    + G  PIH+A  + +L+I+  L+ N    ++ +       H   + G +E++  LL N   ++A       P+H A   G  E+V+LL+ +    D  T +G TPL I+++  ++D  +++  A
Sbjct:  392 VMELLVKYGAS-IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 531          

HSP 3 Score: 59.3066 bits (142), Expect = 4.492e-9
Identity = 32/119 (26.89%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+H+A   +N  +   L+           N Y P H   KK  ++I + LL            G+ P+H A  +G+ ++V LL+  G  I + T  GLT L +A+Q ++++  +++
Sbjct:  575 GLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADIL 693          

HSP 4 Score: 57.3806 bits (137), Expect = 2.077e-8
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+      + I ++   P H     G+L I+  LL+N    +  +  G   +H A   G  EVVR L+  G  +D +  +  TPL IAS+  + +   L+
Sbjct:  371 NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 495          

HSP 5 Score: 56.9954 bits (136), Expect = 2.397e-8
Identity = 31/119 (26.05%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  255 FINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
             ++ +  + + P+HIA  +   +I++ L+ +    +   TN Y P H   ++G +++ + LLE       A   G  P+H A   G  +V +LL+      D    +GLTPL +A+ ++
Sbjct:  468 LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYD 586          

HSP 6 Score: 55.8398 bits (133), Expect = 6.401e-8
Identity = 31/112 (27.68%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H+A   ++++ +K L+ +K   + +  +Y    H     G+  +   LL+ +    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+
Sbjct:  307 RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAA 418          

HSP 7 Score: 52.7582 bits (125), Expect = 6.471e-7
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  270 NDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +G+  +H+A     +++++ L+ N     L+D        P H   + G  EI+  LL++    +AA   G  P+H +  +G  +V  +L+  G    + T  G TPL +A+++  +D   L+
Sbjct:  440 NIRGETALHMAARAGQVEVVRCLLRNGA---LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL 561          

HSP 8 Score: 50.447 bits (119), Expect = 3.134e-6
Identity = 30/102 (29.41%), Postives = 51/102 (50.00%), Query Frame = 3
Query:  315 NLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            NLD +   +    D    + N     H   K+G++ ++  LL     +++A   G   +H A L G  EVV++L+  G  I+ ++ +G TPL +A+Q   ID
Sbjct:   22 NLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHID 123          
BLAST of Phospholipase A2 group VI vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 63.929 bits (154), Expect = 5.271e-11
Identity = 34/110 (30.91%), Postives = 54/110 (49.09%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            P+H+A    N  +   L+ N    +    N Y P H   KK  +EI + LL+ K    A    G  P+H +  +G+KE+  LLI  G  +  K N+GLT + + +Q + +
Sbjct:  593 PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHV 702          

HSP 2 Score: 62.003 bits (149), Expect = 2.356e-10
Identity = 35/109 (32.11%), Postives = 55/109 (50.46%), Query Frame = 3
Query:  282 KLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQH 605
            + P+HIA  + N DI+  L+    ++      NY P H   K+G  E+   LL++          G  P+H A   G  EVVRLL+  G  +DI+  + +TPL +A+ +
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHY 600          

HSP 3 Score: 61.2326 bits (147), Expect = 4.117e-10
Identity = 39/140 (27.86%), Postives = 65/140 (46.43%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTE-LIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID-CFNLIKSAIDIVPLIRDNY 674
            N +   G  P+HIAC    + +++ L+  +   E   ++   P H     G + I+ YLL+     +     G  P+H A      +VVR+LI  G ++D +  +  TPL IAS+    D    L+++  +     RDNY
Sbjct:  386 NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNY 525          

HSP 4 Score: 60.077 bits (144), Expect = 9.000e-10
Identity = 32/116 (27.59%), Postives = 59/116 (50.86%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            P+H+A    ++ + K L++   D      N + P H   KK  ++++  LL+ +  IEA  + G+ P+H A   G   +V  L+  G   D++T  G TPL +A++  + D   ++
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 5 Score: 59.6918 bits (143), Expect = 1.372e-9
Identity = 32/93 (34.41%), Postives = 45/93 (48.39%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDT-ELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLL 533
            IN K + G  P+H+AC    L+++KFL+ N  D  E    +Y P H   ++G+   + YLLEN          G  P+  A   GY  VV  L
Sbjct:  715 INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 6 Score: 56.9954 bits (136), Expect = 9.755e-9
Identity = 33/121 (27.27%), Postives = 59/121 (48.76%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G+ P+H+A      D+++ LI N  K D +  +    P H   + GN +I+  LL+      A       P+H A  +G +EV  +L+ +     + T  G TPL +AS++  ++   L+
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 7 Score: 54.6842 bits (130), Expect = 5.082e-8
Identity = 36/134 (26.87%), Postives = 64/134 (47.76%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFN-LIKSAIDIVPLIRDNY 674
            G  P+HIA     ++I   L+  K D        + P H   ++G+ EI   L+EN   + A  + G+  +H    + +  V ++L   G +I+ KTN G TPL +A    +++    L+++  D+    R +Y
Sbjct:  623 GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASY 756          

HSP 8 Score: 54.299 bits (129), Expect = 7.064e-8
Identity = 42/159 (26.42%), Postives = 72/159 (45.28%), Query Frame = 3
Query:  147 SMNFLRKLFGYGGYEKFMEAIASGDVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            S +FLR     G  EK +E + +G  +NT+           N  G   +H+A    + ++++ LI  +   +          H     G   I+T L+EN   +      G  P++ A  + ++EVV+ L+ +G    + T DG TPL +A Q  H+R+
Sbjct:   34 SASFLRAARA-GDLEKVLELLRAGTDINTS-----------NANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRV 180          

HSP 9 Score: 52.373 bits (124), Expect = 2.800e-7
Identity = 33/114 (28.95%), Postives = 53/114 (46.49%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+HIA    + ++ + L+    +       N  P H   K G   +   LL     I++     + P+H A   G+ +VV LL+  G  I  KT +GL PL +A+Q + +D
Sbjct:  227 GFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVD 340          

HSP 10 Score: 51.2174 bits (121), Expect = 6.735e-7
Identity = 31/111 (27.93%), Postives = 52/111 (46.85%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            P+HIA      ++   L+++  D T L    + P H   K GNLE++  LLE    ++      + P+H A      +V  LL+  G        +G TPL IA++  +++
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQME 637          

HSP 11 Score: 50.8322 bits (120), Expect = 9.182e-7
Identity = 29/116 (25.00%), Postives = 52/116 (44.83%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +  K + G   +H+    +++ + + L NN  +     +  Y P H     G L ++ +L+EN   +         P+H A  +G+   VR L+  G   + +T  G TPL IA +
Sbjct:  682 VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQR 797          

HSP 12 Score: 48.521 bits (114), Expect = 4.586e-6
Identity = 35/135 (25.93%), Postives = 60/135 (44.44%), Query Frame = 3
Query:  219 DVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDC 620
            ++ +T + +K D  N K+  G  P+H++    + +I   LI N  D      N     H   ++ ++ +   L  N   I +  + G  P+H AC  G   +V+ L+  G  +  KT    TPL  A+Q    +C
Sbjct:  637 EIASTLLQFKAD-PNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNC 770          
BLAST of Phospholipase A2 group VI vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 63.929 bits (154), Expect = 5.271e-11
Identity = 34/110 (30.91%), Postives = 54/110 (49.09%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            P+H+A    N  +   L+ N    +    N Y P H   KK  +EI + LL+ K    A    G  P+H +  +G+KE+  LLI  G  +  K N+GLT + + +Q + +
Sbjct:  593 PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHV 702          

HSP 2 Score: 62.003 bits (149), Expect = 2.356e-10
Identity = 35/109 (32.11%), Postives = 55/109 (50.46%), Query Frame = 3
Query:  282 KLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQH 605
            + P+HIA  + N DI+  L+    ++      NY P H   K+G  E+   LL++          G  P+H A   G  EVVRLL+  G  +DI+  + +TPL +A+ +
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHY 600          

HSP 3 Score: 61.2326 bits (147), Expect = 4.117e-10
Identity = 39/140 (27.86%), Postives = 65/140 (46.43%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTE-LIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID-CFNLIKSAIDIVPLIRDNY 674
            N +   G  P+HIAC    + +++ L+  +   E   ++   P H     G + I+ YLL+     +     G  P+H A      +VVR+LI  G ++D +  +  TPL IAS+    D    L+++  +     RDNY
Sbjct:  386 NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNY 525          

HSP 4 Score: 60.077 bits (144), Expect = 9.000e-10
Identity = 32/116 (27.59%), Postives = 59/116 (50.86%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            P+H+A    ++ + K L++   D      N + P H   KK  ++++  LL+ +  IEA  + G+ P+H A   G   +V  L+  G   D++T  G TPL +A++  + D   ++
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 5 Score: 59.6918 bits (143), Expect = 1.372e-9
Identity = 32/93 (34.41%), Postives = 45/93 (48.39%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDT-ELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLL 533
            IN K + G  P+H+AC    L+++KFL+ N  D  E    +Y P H   ++G+   + YLLEN          G  P+  A   GY  VV  L
Sbjct:  715 INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 6 Score: 56.9954 bits (136), Expect = 9.755e-9
Identity = 33/121 (27.27%), Postives = 59/121 (48.76%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G+ P+H+A      D+++ LI N  K D +  +    P H   + GN +I+  LL+      A       P+H A  +G +EV  +L+ +     + T  G TPL +AS++  ++   L+
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 7 Score: 54.6842 bits (130), Expect = 5.082e-8
Identity = 36/134 (26.87%), Postives = 64/134 (47.76%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFN-LIKSAIDIVPLIRDNY 674
            G  P+HIA     ++I   L+  K D        + P H   ++G+ EI   L+EN   + A  + G+  +H    + +  V ++L   G +I+ KTN G TPL +A    +++    L+++  D+    R +Y
Sbjct:  623 GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASY 756          

HSP 8 Score: 54.299 bits (129), Expect = 7.064e-8
Identity = 42/159 (26.42%), Postives = 72/159 (45.28%), Query Frame = 3
Query:  147 SMNFLRKLFGYGGYEKFMEAIASGDVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            S +FLR     G  EK +E + +G  +NT+           N  G   +H+A    + ++++ LI  +   +          H     G   I+T L+EN   +      G  P++ A  + ++EVV+ L+ +G    + T DG TPL +A Q  H+R+
Sbjct:   34 SASFLRAARA-GDLEKVLELLRAGTDINTS-----------NANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRV 180          

HSP 9 Score: 52.373 bits (124), Expect = 2.800e-7
Identity = 33/114 (28.95%), Postives = 53/114 (46.49%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+HIA    + ++ + L+    +       N  P H   K G   +   LL     I++     + P+H A   G+ +VV LL+  G  I  KT +GL PL +A+Q + +D
Sbjct:  227 GFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVD 340          

HSP 10 Score: 51.2174 bits (121), Expect = 6.735e-7
Identity = 31/111 (27.93%), Postives = 52/111 (46.85%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            P+HIA      ++   L+++  D T L    + P H   K GNLE++  LLE    ++      + P+H A      +V  LL+  G        +G TPL IA++  +++
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQME 637          

HSP 11 Score: 50.8322 bits (120), Expect = 9.182e-7
Identity = 29/116 (25.00%), Postives = 52/116 (44.83%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +  K + G   +H+    +++ + + L NN  +     +  Y P H     G L ++ +L+EN   +         P+H A  +G+   VR L+  G   + +T  G TPL IA +
Sbjct:  682 VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQR 797          

HSP 12 Score: 48.521 bits (114), Expect = 4.586e-6
Identity = 35/135 (25.93%), Postives = 60/135 (44.44%), Query Frame = 3
Query:  219 DVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDC 620
            ++ +T + +K D  N K+  G  P+H++    + +I   LI N  D      N     H   ++ ++ +   L  N   I +  + G  P+H AC  G   +V+ L+  G  +  KT    TPL  A+Q    +C
Sbjct:  637 EIASTLLQFKAD-PNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNC 770          
BLAST of Phospholipase A2 group VI vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 63.929 bits (154), Expect = 5.280e-11
Identity = 34/110 (30.91%), Postives = 54/110 (49.09%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            P+H+A    N  +   L+ N    +    N Y P H   KK  +EI + LL+ K    A    G  P+H +  +G+KE+  LLI  G  +  K N+GLT + + +Q + +
Sbjct:  593 PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHV 702          

HSP 2 Score: 62.003 bits (149), Expect = 2.360e-10
Identity = 35/109 (32.11%), Postives = 55/109 (50.46%), Query Frame = 3
Query:  282 KLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQH 605
            + P+HIA  + N DI+  L+    ++      NY P H   K+G  E+   LL++          G  P+H A   G  EVVRLL+  G  +DI+  + +TPL +A+ +
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHY 600          

HSP 3 Score: 61.2326 bits (147), Expect = 4.124e-10
Identity = 39/140 (27.86%), Postives = 65/140 (46.43%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTE-LIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID-CFNLIKSAIDIVPLIRDNY 674
            N +   G  P+HIAC    + +++ L+  +   E   ++   P H     G + I+ YLL+     +     G  P+H A      +VVR+LI  G ++D +  +  TPL IAS+    D    L+++  +     RDNY
Sbjct:  386 NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNY 525          

HSP 4 Score: 60.077 bits (144), Expect = 9.014e-10
Identity = 32/116 (27.59%), Postives = 59/116 (50.86%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            P+H+A    ++ + K L++   D      N + P H   KK  ++++  LL+ +  IEA  + G+ P+H A   G   +V  L+  G   D++T  G TPL +A++  + D   ++
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 5 Score: 59.6918 bits (143), Expect = 1.375e-9
Identity = 32/93 (34.41%), Postives = 45/93 (48.39%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDT-ELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLL 533
            IN K + G  P+H+AC    L+++KFL+ N  D  E    +Y P H   ++G+   + YLLEN          G  P+  A   GY  VV  L
Sbjct:  715 INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 6 Score: 56.9954 bits (136), Expect = 9.770e-9
Identity = 33/121 (27.27%), Postives = 59/121 (48.76%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G+ P+H+A      D+++ LI N  K D +  +    P H   + GN +I+  LL+      A       P+H A  +G +EV  +L+ +     + T  G TPL +AS++  ++   L+
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 7 Score: 54.6842 bits (130), Expect = 5.089e-8
Identity = 36/134 (26.87%), Postives = 64/134 (47.76%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFN-LIKSAIDIVPLIRDNY 674
            G  P+HIA     ++I   L+  K D        + P H   ++G+ EI   L+EN   + A  + G+  +H    + +  V ++L   G +I+ KTN G TPL +A    +++    L+++  D+    R +Y
Sbjct:  623 GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASY 756          

HSP 8 Score: 54.299 bits (129), Expect = 7.075e-8
Identity = 42/159 (26.42%), Postives = 72/159 (45.28%), Query Frame = 3
Query:  147 SMNFLRKLFGYGGYEKFMEAIASGDVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            S +FLR     G  EK +E + +G  +NT+           N  G   +H+A    + ++++ LI  +   +          H     G   I+T L+EN   +      G  P++ A  + ++EVV+ L+ +G    + T DG TPL +A Q  H+R+
Sbjct:   34 SASFLRAARA-GDLEKVLELLRAGTDINTS-----------NANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRV 180          

HSP 9 Score: 52.373 bits (124), Expect = 2.804e-7
Identity = 33/114 (28.95%), Postives = 53/114 (46.49%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+HIA    + ++ + L+    +       N  P H   K G   +   LL     I++     + P+H A   G+ +VV LL+  G  I  KT +GL PL +A+Q + +D
Sbjct:  227 GFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVD 340          

HSP 10 Score: 51.2174 bits (121), Expect = 6.745e-7
Identity = 31/111 (27.93%), Postives = 52/111 (46.85%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            P+HIA      ++   L+++  D T L    + P H   K GNLE++  LLE    ++      + P+H A      +V  LL+  G        +G TPL IA++  +++
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQME 637          

HSP 11 Score: 50.8322 bits (120), Expect = 9.195e-7
Identity = 29/116 (25.00%), Postives = 52/116 (44.83%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +  K + G   +H+    +++ + + L NN  +     +  Y P H     G L ++ +L+EN   +         P+H A  +G+   VR L+  G   + +T  G TPL IA +
Sbjct:  682 VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQR 797          

HSP 12 Score: 48.521 bits (114), Expect = 4.592e-6
Identity = 35/135 (25.93%), Postives = 60/135 (44.44%), Query Frame = 3
Query:  219 DVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDC 620
            ++ +T + +K D  N K+  G  P+H++    + +I   LI N  D      N     H   ++ ++ +   L  N   I +  + G  P+H AC  G   +V+ L+  G  +  KT    TPL  A+Q    +C
Sbjct:  637 EIASTLLQFKAD-PNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNC 770          
BLAST of Phospholipase A2 group VI vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 63.929 bits (154), Expect = 5.280e-11
Identity = 34/110 (30.91%), Postives = 54/110 (49.09%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            P+H+A    N  +   L+ N    +    N Y P H   KK  +EI + LL+ K    A    G  P+H +  +G+KE+  LLI  G  +  K N+GLT + + +Q + +
Sbjct:  593 PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHV 702          

HSP 2 Score: 62.003 bits (149), Expect = 2.360e-10
Identity = 35/109 (32.11%), Postives = 55/109 (50.46%), Query Frame = 3
Query:  282 KLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQH 605
            + P+HIA  + N DI+  L+    ++      NY P H   K+G  E+   LL++          G  P+H A   G  EVVRLL+  G  +DI+  + +TPL +A+ +
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHY 600          

HSP 3 Score: 61.2326 bits (147), Expect = 4.124e-10
Identity = 39/140 (27.86%), Postives = 65/140 (46.43%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTE-LIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID-CFNLIKSAIDIVPLIRDNY 674
            N +   G  P+HIAC    + +++ L+  +   E   ++   P H     G + I+ YLL+     +     G  P+H A      +VVR+LI  G ++D +  +  TPL IAS+    D    L+++  +     RDNY
Sbjct:  386 NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNY 525          

HSP 4 Score: 60.077 bits (144), Expect = 9.014e-10
Identity = 32/116 (27.59%), Postives = 59/116 (50.86%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            P+H+A    ++ + K L++   D      N + P H   KK  ++++  LL+ +  IEA  + G+ P+H A   G   +V  L+  G   D++T  G TPL +A++  + D   ++
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 5 Score: 59.6918 bits (143), Expect = 1.375e-9
Identity = 32/93 (34.41%), Postives = 45/93 (48.39%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDT-ELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLL 533
            IN K + G  P+H+AC    L+++KFL+ N  D  E    +Y P H   ++G+   + YLLEN          G  P+  A   GY  VV  L
Sbjct:  715 INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 6 Score: 56.9954 bits (136), Expect = 9.770e-9
Identity = 33/121 (27.27%), Postives = 59/121 (48.76%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G+ P+H+A      D+++ LI N  K D +  +    P H   + GN +I+  LL+      A       P+H A  +G +EV  +L+ +     + T  G TPL +AS++  ++   L+
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 7 Score: 54.6842 bits (130), Expect = 5.089e-8
Identity = 36/134 (26.87%), Postives = 64/134 (47.76%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFN-LIKSAIDIVPLIRDNY 674
            G  P+HIA     ++I   L+  K D        + P H   ++G+ EI   L+EN   + A  + G+  +H    + +  V ++L   G +I+ KTN G TPL +A    +++    L+++  D+    R +Y
Sbjct:  623 GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASY 756          

HSP 8 Score: 54.299 bits (129), Expect = 7.075e-8
Identity = 42/159 (26.42%), Postives = 72/159 (45.28%), Query Frame = 3
Query:  147 SMNFLRKLFGYGGYEKFMEAIASGDVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            S +FLR     G  EK +E + +G  +NT+           N  G   +H+A    + ++++ LI  +   +          H     G   I+T L+EN   +      G  P++ A  + ++EVV+ L+ +G    + T DG TPL +A Q  H+R+
Sbjct:   34 SASFLRAARA-GDLEKVLELLRAGTDINTS-----------NANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRV 180          

HSP 9 Score: 52.373 bits (124), Expect = 2.804e-7
Identity = 33/114 (28.95%), Postives = 53/114 (46.49%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+HIA    + ++ + L+    +       N  P H   K G   +   LL     I++     + P+H A   G+ +VV LL+  G  I  KT +GL PL +A+Q + +D
Sbjct:  227 GFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVD 340          

HSP 10 Score: 51.2174 bits (121), Expect = 6.745e-7
Identity = 31/111 (27.93%), Postives = 52/111 (46.85%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            P+HIA      ++   L+++  D T L    + P H   K GNLE++  LLE    ++      + P+H A      +V  LL+  G        +G TPL IA++  +++
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQME 637          

HSP 11 Score: 50.8322 bits (120), Expect = 9.195e-7
Identity = 29/116 (25.00%), Postives = 52/116 (44.83%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +  K + G   +H+    +++ + + L NN  +     +  Y P H     G L ++ +L+EN   +         P+H A  +G+   VR L+  G   + +T  G TPL IA +
Sbjct:  682 VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQR 797          

HSP 12 Score: 48.521 bits (114), Expect = 4.592e-6
Identity = 35/135 (25.93%), Postives = 60/135 (44.44%), Query Frame = 3
Query:  219 DVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDC 620
            ++ +T + +K D  N K+  G  P+H++    + +I   LI N  D      N     H   ++ ++ +   L  N   I +  + G  P+H AC  G   +V+ L+  G  +  KT    TPL  A+Q    +C
Sbjct:  637 EIASTLLQFKAD-PNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNC 770          
BLAST of Phospholipase A2 group VI vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 63.929 bits (154), Expect = 5.289e-11
Identity = 34/110 (30.91%), Postives = 54/110 (49.09%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            P+H+A    N  +   L+ N    +    N Y P H   KK  +EI + LL+ K    A    G  P+H +  +G+KE+  LLI  G  +  K N+GLT + + +Q + +
Sbjct:  593 PLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHV 702          

HSP 2 Score: 62.003 bits (149), Expect = 2.364e-10
Identity = 35/109 (32.11%), Postives = 55/109 (50.46%), Query Frame = 3
Query:  282 KLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQH 605
            + P+HIA  + N DI+  L+    ++      NY P H   K+G  E+   LL++          G  P+H A   G  EVVRLL+  G  +DI+  + +TPL +A+ +
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHY 600          

HSP 3 Score: 61.2326 bits (147), Expect = 4.130e-10
Identity = 39/140 (27.86%), Postives = 65/140 (46.43%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTE-LIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID-CFNLIKSAIDIVPLIRDNY 674
            N +   G  P+HIAC    + +++ L+  +   E   ++   P H     G + I+ YLL+     +     G  P+H A      +VVR+LI  G ++D +  +  TPL IAS+    D    L+++  +     RDNY
Sbjct:  386 NSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNY 525          

HSP 4 Score: 60.077 bits (144), Expect = 9.029e-10
Identity = 32/116 (27.59%), Postives = 59/116 (50.86%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            P+H+A    ++ + K L++   D      N + P H   KK  ++++  LL+ +  IEA  + G+ P+H A   G   +V  L+  G   D++T  G TPL +A++  + D   ++
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVL 477          

HSP 5 Score: 59.6918 bits (143), Expect = 1.377e-9
Identity = 32/93 (34.41%), Postives = 45/93 (48.39%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDT-ELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLL 533
            IN K + G  P+H+AC    L+++KFL+ N  D  E    +Y P H   ++G+   + YLLEN          G  P+  A   GY  VV  L
Sbjct:  715 INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 6 Score: 56.9954 bits (136), Expect = 9.785e-9
Identity = 33/121 (27.27%), Postives = 59/121 (48.76%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G+ P+H+A      D+++ LI N  K D +  +    P H   + GN +I+  LL+      A       P+H A  +G +EV  +L+ +     + T  G TPL +AS++  ++   L+
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 7 Score: 54.6842 bits (130), Expect = 5.097e-8
Identity = 36/134 (26.87%), Postives = 64/134 (47.76%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFN-LIKSAIDIVPLIRDNY 674
            G  P+HIA     ++I   L+  K D        + P H   ++G+ EI   L+EN   + A  + G+  +H    + +  V ++L   G +I+ KTN G TPL +A    +++    L+++  D+    R +Y
Sbjct:  623 GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASY 756          

HSP 8 Score: 54.299 bits (129), Expect = 7.085e-8
Identity = 42/159 (26.42%), Postives = 72/159 (45.28%), Query Frame = 3
Query:  147 SMNFLRKLFGYGGYEKFMEAIASGDVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            S +FLR     G  EK +E + +G  +NT+           N  G   +H+A    + ++++ LI  +   +          H     G   I+T L+EN   +      G  P++ A  + ++EVV+ L+ +G    + T DG TPL +A Q  H+R+
Sbjct:   34 SASFLRAARA-GDLEKVLELLRAGTDINTS-----------NANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRV 180          

HSP 9 Score: 52.373 bits (124), Expect = 2.808e-7
Identity = 33/114 (28.95%), Postives = 53/114 (46.49%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+HIA    + ++ + L+    +       N  P H   K G   +   LL     I++     + P+H A   G+ +VV LL+  G  I  KT +GL PL +A+Q + +D
Sbjct:  227 GFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVD 340          

HSP 10 Score: 51.2174 bits (121), Expect = 6.754e-7
Identity = 31/111 (27.93%), Postives = 52/111 (46.85%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            P+HIA      ++   L+++  D T L    + P H   K GNLE++  LLE    ++      + P+H A      +V  LL+  G        +G TPL IA++  +++
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQME 637          

HSP 11 Score: 50.8322 bits (120), Expect = 9.208e-7
Identity = 29/116 (25.00%), Postives = 52/116 (44.83%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +  K + G   +H+    +++ + + L NN  +     +  Y P H     G L ++ +L+EN   +         P+H A  +G+   VR L+  G   + +T  G TPL IA +
Sbjct:  682 VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQR 797          

HSP 12 Score: 48.521 bits (114), Expect = 4.598e-6
Identity = 35/135 (25.93%), Postives = 60/135 (44.44%), Query Frame = 3
Query:  219 DVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDC 620
            ++ +T + +K D  N K+  G  P+H++    + +I   LI N  D      N     H   ++ ++ +   L  N   I +  + G  P+H AC  G   +V+ L+  G  +  KT    TPL  A+Q    +C
Sbjct:  637 EIASTLLQFKAD-PNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNC 770          
BLAST of Phospholipase A2 group VI vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 74.7146 bits (182), Expect = 1.618e-14
Identity = 41/120 (34.17%), Postives = 59/120 (49.17%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
             G  P+HIA    N +I   LI    D       N  P H   K G   +++ LLE    IEA    G+ P+H A   G+++VV +L+  G  I  KT +GL PL +A+Q E +D   ++
Sbjct:  204 SGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARIL 323          

HSP 2 Score: 62.7734 bits (151), Expect = 1.226e-10
Identity = 33/125 (26.40%), Postives = 60/125 (48.00%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    L +++ L+ +    +   ++   P H     G + I+ YLL++    +     G  P+H A      +++R+L+  G Q+D +  +  TPL IAS+   +D   L+
Sbjct:  364 NARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLL 488          

HSP 3 Score: 56.225 bits (134), Expect = 1.521e-8
Identity = 34/130 (26.15%), Postives = 62/130 (47.69%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAI 644
            I+   + G  P+H+A  +  ++I+ +L+ +    ++       P H   +    +II  LL N   ++A       P+H A   G  ++V LL+ +G Q+D  T D  T L IA++  + +  +LI   I
Sbjct:  396 ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVKDLIAKKI 525          

HSP 4 Score: 56.225 bits (134), Expect = 1.853e-8
Identity = 38/149 (25.50%), Postives = 66/149 (44.30%), Query Frame = 3
Query:  183 GYEKFMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLINNKC--DTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            G   F+ A  +G++     + K +  IN  N  G   +H+A    ++ ++  L+      D+     N    H     G  E++  LLE+   +      G  P++ A  + +  VVRLL+  G    + T DG TPL +A Q  H+++
Sbjct:   11 GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTA-LHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKV 158          

HSP 5 Score: 55.8398 bits (133), Expect = 2.027e-8
Identity = 34/134 (25.37%), Postives = 61/134 (45.52%), Query Frame = 3
Query:  291 IHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPLIRDNYEKDIR 689
            +H+A    ++ + K L++   D      N + P H   KK  L+++  LL +   I A  + G+ P+H A   G   +V  L+ +    D+ T  G TPL +A++  + D   +         L+R+  + D R
Sbjct:  341 LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRI---------LLRNGAQVDAR 465          

HSP 6 Score: 53.9138 bits (128), Expect = 9.399e-8
Identity = 43/170 (25.29%), Postives = 75/170 (44.12%), Query Frame = 3
Query:  117 NFFICIIILLSMNFLRKLFGYGGYEKFMEAIASGDVMNTTVYYKKDFINRKNDQGKLP-IHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            N    + +LLS    + L    G+     A+  G      V  + D       + +LP +HIA   +++     L++N  + ++   + + P H     GN  I   L++    +  +    + P+H A   G   +V LL+  G  I+ KT DGLTPL  A++  HE++
Sbjct:  121 NHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESD----TRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQV 286          
BLAST of Phospholipase A2 group VI vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303120)

HSP 1 Score: 74.7146 bits (182), Expect = 1.723e-14
Identity = 41/119 (34.45%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA    N +I   LI    D       N  P H   K G   +++ LLE    IEA    G+ P+H A   G+++VV +L+  G  I  KT +GL PL +A+Q E +D   ++
Sbjct:  355 GFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARIL 473          

HSP 2 Score: 61.6178 bits (148), Expect = 3.206e-10
Identity = 33/125 (26.40%), Postives = 60/125 (48.00%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    L +++ L+ +    +   ++   P H     G + I+ YLL++    +     G  P+H A      +++R+L+  G Q+D +  +  TPL IAS+   +D   L+
Sbjct:  514 NARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLL 638          

HSP 3 Score: 55.4546 bits (132), Expect = 3.321e-8
Identity = 37/143 (25.87%), Postives = 62/143 (43.36%), Query Frame = 3
Query:  183 GYEKFMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLINNKC--DTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            G   F+ A  +G++     + K +  IN  N  G   +H+A    ++ ++  L+      D+     N    H     G  E++  LLE+   +      G  P++ A  + +  VVRLL+  G    + T DG TPL +A Q
Sbjct:  161 GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTA-LHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQ 302          

HSP 4 Score: 55.4546 bits (132), Expect = 3.473e-8
Identity = 34/134 (25.37%), Postives = 61/134 (45.52%), Query Frame = 3
Query:  291 IHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPLIRDNYEKDIR 689
            +H+A    ++ + K L++   D      N + P H   KK  L+++  LL +   I A  + G+ P+H A   G   +V  L+ +    D+ T  G TPL +A++  + D   +         L+R+  + D R
Sbjct:  491 LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRI---------LLRNGAQVDAR 615          

HSP 5 Score: 55.0694 bits (131), Expect = 3.731e-8
Identity = 34/130 (26.15%), Postives = 62/130 (47.69%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAI 644
            I+   + G  P+H+A  +  ++I+ +L+ +    ++       P H   +    +II  LL N   ++A       P+H A   G  ++V LL+ +G Q+D  T D  T L IA++  + +  +LI   I
Sbjct:  546 ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVKDLIAKKI 675          

HSP 6 Score: 53.9138 bits (128), Expect = 1.072e-7
Identity = 43/170 (25.29%), Postives = 75/170 (44.12%), Query Frame = 3
Query:  117 NFFICIIILLSMNFLRKLFGYGGYEKFMEAIASGDVMNTTVYYKKDFINRKNDQGKLP-IHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            N    + +LLS    + L    G+     A+  G      V  + D   +     +LP +HIA   +++     L++N  + ++   + + P H     GN  I   L++    +  +    + P+H A   G   +V LL+  G  I+ KT DGLTPL  A++  HE++
Sbjct:  271 NHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKV----RLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQV 436          
BLAST of Phospholipase A2 group VI vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 71.633 bits (174), Expect = 1.956e-13
Identity = 41/114 (35.96%), Postives = 57/114 (50.00%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+HIA    N +I   LI    D       N  P H   K G   +++ LLE    IEA    G+ P+H A   G+++VV +L+  G  I  KT +GL PL +A+Q E +D
Sbjct:  205 GFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVD 318          

HSP 2 Score: 63.1586 bits (152), Expect = 1.319e-10
Identity = 33/131 (25.19%), Postives = 64/131 (48.85%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKS 638
            K  +N     G  P+H+    +N+++ + L  N  + ++     Y P H     G   ++ +LL+N   ++AA  +G  P+H    +G+  +V LL+ +    + +T +G TPL IA +   I   + +K+
Sbjct:  657 KAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKT 787          

HSP 3 Score: 62.003 bits (149), Expect = 3.165e-10
Identity = 31/117 (26.50%), Postives = 60/117 (51.28%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQH 605
            ++ +  + + P+HIA  + N+DI+  L+ +    +    + Y   H   K+G  E+   L+EN   ++AA   G  P+H     G+ +V +LL+     +D +  +G+TPL +A  +
Sbjct:  462 VDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHY 578          

HSP 4 Score: 60.4622 bits (145), Expect = 8.995e-10
Identity = 33/125 (26.40%), Postives = 60/125 (48.00%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    L +++ L+ +    +   ++   P H     G + I+ YLL++    +     G  P+H A      +++R+L+  G Q+D +  +  TPL IAS+   +D   L+
Sbjct:  364 NARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLL 488          

HSP 5 Score: 59.6918 bits (143), Expect = 1.643e-9
Identity = 31/131 (23.66%), Postives = 61/131 (46.56%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIK 635
            K+  ++ +   G  P+H+AC   N  +   L+           N + P H   +K  ++I T LLE      A    G  P+H +  +G+ E+  LLI +   ++    +GLTP+ + +Q + ++   +++
Sbjct:  557 KEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILE 687          

HSP 6 Score: 58.151 bits (139), Expect = 4.866e-9
Identity = 33/120 (27.50%), Postives = 57/120 (47.50%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G+ P+H+A      DII+ L+ N    +        P H   + GN++I+  LL++   ++A        +H A  +G  EV  +LI  G  +D  T  G TPL + +++  I    L+
Sbjct:  435 RGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLL 554          

HSP 7 Score: 54.299 bits (129), Expect = 9.457e-8
Identity = 30/115 (26.09%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  291 IHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +H+A    ++ + K L++   D      N + P H   KK  L+++  LL +   I A  + G+ P+H A   G   +V  L+ +    D+ T  G TPL +A++  + D   ++
Sbjct:  341 LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRIL 455          

HSP 8 Score: 52.373 bits (124), Expect = 3.287e-7
Identity = 38/149 (25.50%), Postives = 66/149 (44.30%), Query Frame = 3
Query:  183 GYEKFMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLINNKC--DTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            G   F+ A  +G++     + K +  IN  N  G   +H+A    ++ ++  L+      D+     N    H     G  E++  LLE+   +      G  P++ A  + +  VVRLL+  G    + T DG TPL +A Q  H+++
Sbjct:   11 GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGN-TALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKV 158          

HSP 9 Score: 51.9878 bits (123), Expect = 4.946e-7
Identity = 34/115 (29.57%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIA--SQHERI 614
            +LP +HIA   +++     L++N  + ++   + + P H     GN  I   L++    +  +    + P+H A   G   +V LL+  G  I+ KT DGLTPL  A  S HE++
Sbjct:  172 RLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQV 286          

HSP 10 Score: 50.0618 bits (118), Expect = 2.232e-6
Identity = 31/109 (28.44%), Postives = 47/109 (43.12%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLIN-NKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            G  P+HIA     +DI   L+             + P H   ++G+ EI   L+E+K  +      G+ P+H    +    V  +L   G  ID+ T  G TPL +AS 
Sbjct:  601 GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASH 709          
BLAST of Phospholipase A2 group VI vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334061)

HSP 1 Score: 71.633 bits (174), Expect = 2.005e-13
Identity = 41/114 (35.96%), Postives = 57/114 (50.00%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+HIA    N +I   LI    D       N  P H   K G   +++ LLE    IEA    G+ P+H A   G+++VV +L+  G  I  KT +GL PL +A+Q E +D
Sbjct:  355 GFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVD 468          

HSP 2 Score: 63.1586 bits (152), Expect = 1.350e-10
Identity = 33/131 (25.19%), Postives = 64/131 (48.85%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKS 638
            K  +N     G  P+H+    +N+++ + L  N  + ++     Y P H     G   ++ +LL+N   ++AA  +G  P+H    +G+  +V LL+ +    + +T +G TPL IA +   I   + +K+
Sbjct:  807 KAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKT 937          

HSP 3 Score: 62.003 bits (149), Expect = 3.237e-10
Identity = 31/117 (26.50%), Postives = 60/117 (51.28%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQH 605
            ++ +  + + P+HIA  + N+DI+  L+ +    +    + Y   H   K+G  E+   L+EN   ++AA   G  P+H     G+ +V +LL+     +D +  +G+TPL +A  +
Sbjct:  612 VDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHY 728          

HSP 4 Score: 60.4622 bits (145), Expect = 9.196e-10
Identity = 33/125 (26.40%), Postives = 60/125 (48.00%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    L +++ L+ +    +   ++   P H     G + I+ YLL++    +     G  P+H A      +++R+L+  G Q+D +  +  TPL IAS+   +D   L+
Sbjct:  514 NARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLL 638          

HSP 5 Score: 59.6918 bits (143), Expect = 1.679e-9
Identity = 31/131 (23.66%), Postives = 61/131 (46.56%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIK 635
            K+  ++ +   G  P+H+AC   N  +   L+           N + P H   +K  ++I T LLE      A    G  P+H +  +G+ E+  LLI +   ++    +GLTP+ + +Q + ++   +++
Sbjct:  707 KEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILE 837          

HSP 6 Score: 58.151 bits (139), Expect = 4.972e-9
Identity = 33/120 (27.50%), Postives = 57/120 (47.50%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G+ P+H+A      DII+ L+ N    +        P H   + GN++I+  LL++   ++A        +H A  +G  EV  +LI  G  +D  T  G TPL + +++  I    L+
Sbjct:  585 RGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLL 704          

HSP 7 Score: 54.299 bits (129), Expect = 9.649e-8
Identity = 30/115 (26.09%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  291 IHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +H+A    ++ + K L++   D      N + P H   KK  L+++  LL +   I A  + G+ P+H A   G   +V  L+ +    D+ T  G TPL +A++  + D   ++
Sbjct:  491 LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRIL 605          

HSP 8 Score: 52.373 bits (124), Expect = 3.352e-7
Identity = 38/149 (25.50%), Postives = 66/149 (44.30%), Query Frame = 3
Query:  183 GYEKFMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLINNKC--DTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            G   F+ A  +G++     + K +  IN  N  G   +H+A    ++ ++  L+      D+     N    H     G  E++  LLE+   +      G  P++ A  + +  VVRLL+  G    + T DG TPL +A Q  H+++
Sbjct:  161 GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGN-TALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKV 308          

HSP 9 Score: 51.9878 bits (123), Expect = 5.042e-7
Identity = 34/115 (29.57%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIA--SQHERI 614
            +LP +HIA   +++     L++N  + ++   + + P H     GN  I   L++    +  +    + P+H A   G   +V LL+  G  I+ KT DGLTPL  A  S HE++
Sbjct:  322 RLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQV 436          

HSP 10 Score: 50.0618 bits (118), Expect = 2.274e-6
Identity = 31/109 (28.44%), Postives = 47/109 (43.12%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLIN-NKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            G  P+HIA     +DI   L+             + P H   ++G+ EI   L+E+K  +      G+ P+H    +    V  +L   G  ID+ T  G TPL +AS 
Sbjct:  751 GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASH 859          
BLAST of Phospholipase A2 group VI vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303118)

HSP 1 Score: 71.633 bits (174), Expect = 2.177e-13
Identity = 41/114 (35.96%), Postives = 57/114 (50.00%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+HIA    N +I   LI    D       N  P H   K G   +++ LLE    IEA    G+ P+H A   G+++VV +L+  G  I  KT +GL PL +A+Q E +D
Sbjct:  205 GFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVD 318          

HSP 2 Score: 63.1586 bits (152), Expect = 1.456e-10
Identity = 33/131 (25.19%), Postives = 64/131 (48.85%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKS 638
            K  +N     G  P+H+    +N+++ + L  N  + ++     Y P H     G   ++ +LL+N   ++AA  +G  P+H    +G+  +V LL+ +    + +T +G TPL IA +   I   + +K+
Sbjct:  657 KAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKT 787          

HSP 3 Score: 62.003 bits (149), Expect = 3.490e-10
Identity = 31/117 (26.50%), Postives = 60/117 (51.28%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQH 605
            ++ +  + + P+HIA  + N+DI+  L+ +    +    + Y   H   K+G  E+   L+EN   ++AA   G  P+H     G+ +V +LL+     +D +  +G+TPL +A  +
Sbjct:  462 VDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHY 578          

HSP 4 Score: 60.4622 bits (145), Expect = 9.902e-10
Identity = 33/125 (26.40%), Postives = 60/125 (48.00%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    L +++ L+ +    +   ++   P H     G + I+ YLL++    +     G  P+H A      +++R+L+  G Q+D +  +  TPL IAS+   +D   L+
Sbjct:  364 NARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLL 488          

HSP 5 Score: 59.6918 bits (143), Expect = 1.807e-9
Identity = 31/131 (23.66%), Postives = 61/131 (46.56%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIK 635
            K+  ++ +   G  P+H+AC   N  +   L+           N + P H   +K  ++I T LLE      A    G  P+H +  +G+ E+  LLI +   ++    +GLTP+ + +Q + ++   +++
Sbjct:  557 KEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILE 687          

HSP 6 Score: 58.151 bits (139), Expect = 5.342e-9
Identity = 33/120 (27.50%), Postives = 57/120 (47.50%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G+ P+H+A      DII+ L+ N    +        P H   + GN++I+  LL++   ++A        +H A  +G  EV  +LI  G  +D  T  G TPL + +++  I    L+
Sbjct:  435 RGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLL 554          

HSP 7 Score: 54.299 bits (129), Expect = 1.033e-7
Identity = 30/115 (26.09%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  291 IHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +H+A    ++ + K L++   D      N + P H   KK  L+++  LL +   I A  + G+ P+H A   G   +V  L+ +    D+ T  G TPL +A++  + D   ++
Sbjct:  341 LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRIL 455          

HSP 8 Score: 52.373 bits (124), Expect = 3.580e-7
Identity = 38/149 (25.50%), Postives = 66/149 (44.30%), Query Frame = 3
Query:  183 GYEKFMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLINNKC--DTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            G   F+ A  +G++     + K +  IN  N  G   +H+A    ++ ++  L+      D+     N    H     G  E++  LLE+   +      G  P++ A  + +  VVRLL+  G    + T DG TPL +A Q  H+++
Sbjct:   11 GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGN-TALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKV 158          

HSP 9 Score: 51.9878 bits (123), Expect = 5.382e-7
Identity = 34/115 (29.57%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIA--SQHERI 614
            +LP +HIA   +++     L++N  + ++   + + P H     GN  I   L++    +  +    + P+H A   G   +V LL+  G  I+ KT DGLTPL  A  S HE++
Sbjct:  172 RLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQV 286          

HSP 10 Score: 50.0618 bits (118), Expect = 2.421e-6
Identity = 31/109 (28.44%), Postives = 47/109 (43.12%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLIN-NKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            G  P+HIA     +DI   L+             + P H   ++G+ EI   L+E+K  +      G+ P+H    +    V  +L   G  ID+ T  G TPL +AS 
Sbjct:  601 GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASH 709          
BLAST of Phospholipase A2 group VI vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 80.8777 bits (198), Expect = 2.496e-16
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            K  +NR  + G  P+HIA    N+++   L+N     + +  N   P H   K+GN  ++  LL+    IEA    G+ P+H     G+++VV +L+  G  I  KT +GL+PL +A+Q + ++C  L+
Sbjct:  212 KMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 340          

HSP 2 Score: 65.855 bits (159), Expect = 2.077e-11
Identity = 36/126 (28.57%), Postives = 67/126 (53.17%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N  N +G+  +H+A     +D++++L+ N  K D +  D +    H   + G LEI+  LL+      AA   G  P+H +  +G++E+  LL+  G  +   T  G TPL +A+++ +++  NL+
Sbjct:  447 NTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKD-DQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLL 571          

HSP 3 Score: 57.7658 bits (138), Expect = 9.684e-9
Identity = 36/123 (29.27%), Postives = 57/123 (46.34%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHER 611
            KK   +     G  P+H+A   +N  +   L++          N Y P H   KK  LEI T LLE           G+ P+H A  +G  ++V LL+     +++   +GLTPL +A+Q ++
Sbjct:  574 KKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDK 696          

HSP 4 Score: 57.3806 bits (137), Expect = 1.277e-8
Identity = 39/118 (33.05%), Postives = 56/118 (47.46%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
            I  K+DQ  L  HIA  +  L+I++ L+          T+ Y P H   ++G+ EI   LLE    + AA   G  P+H A   G  EV  LL+      D     GLTPL +A+ ++
Sbjct:  481 IKAKDDQTAL--HIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYD 596          

HSP 5 Score: 56.225 bits (134), Expect = 2.956e-8
Identity = 31/120 (25.83%), Postives = 59/120 (49.17%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLIN--NKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA     L+I   L+    +C+T +      P H   ++G++++++ LL  +  +   +  G+ P+H A       V  +L+ +G +ID +T  G TPL +A  +  +   N +
Sbjct:  618 GYTPLHIAAKKNQLEIGTTLLEYGAECNT-VTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFL 736          

HSP 6 Score: 53.5286 bits (127), Expect = 2.056e-7
Identity = 26/77 (33.77%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
             H   K+G++E++  LL+    ++AA   G   +H A L G  EVVR L+  G  ++ ++ +G TPL +A+Q   +D
Sbjct:   57 LHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLD 133          

HSP 7 Score: 51.6026 bits (122), Expect = 8.493e-7
Identity = 34/125 (27.20%), Postives = 58/125 (46.40%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            KK   N K   G  P+HIAC    + +++ L+ +    + + ++   P H     G+  I+  L  +       +  G   +H A   G  +VVR L+  G ++DIK  D  T L IAS+  +++
Sbjct:  376 KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLE 500          

HSP 8 Score: 50.0618 bits (118), Expect = 2.928e-6
Identity = 31/120 (25.83%), Postives = 52/120 (43.33%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            N     G  P+H++    + +I   L+      +      + P H   K G LE+   LL+ K   +AA   G+ P+H A     + V  LL+  G        +G TPL IA++  +++
Sbjct:  513 NAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLE 632          

HSP 9 Score: 50.0618 bits (118), Expect = 3.033e-6
Identity = 27/110 (24.55%), Postives = 56/110 (50.91%), Query Frame = 3
Query:  291 IHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            +H+A    +  + K +++ K +      N + P H   KK  ++++  LL++   ++A  + G+ PIH A   G++ +V+ L  +G   +     G T L +A++  +ID
Sbjct:  358 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQID 467          

HSP 10 Score: 48.521 bits (114), Expect = 8.435e-6
Identity = 29/120 (24.17%), Postives = 52/120 (43.33%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G  P+H+A     L++   L+  K   +    +   P H      N  +   LL+      +    G  P+H A  K   E+   L+ YG + +  T  G++PL +A+Q   +D  +L+
Sbjct:  551 KGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLL 670          

HSP 11 Score: 48.521 bits (114), Expect = 8.661e-6
Identity = 32/153 (20.92%), Postives = 63/153 (41.18%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLI-NNKCDTELIDTNYPPFHSVYKKGNLEIITYLLEN-------------------------------------KLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +N ++  G  P+++A    +LD+++FL+ NN   +   +  + P     ++G+ ++++ LLEN                                     K+ +    + G  P+H A   G   V  LL+  G  +D    + +TPL +AS+
Sbjct:  112 VNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASK 264          
BLAST of Phospholipase A2 group VI vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 80.8777 bits (198), Expect = 2.496e-16
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            K  +NR  + G  P+HIA    N+++   L+N     + +  N   P H   K+GN  ++  LL+    IEA    G+ P+H     G+++VV +L+  G  I  KT +GL+PL +A+Q + ++C  L+
Sbjct:  217 KMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 345          

HSP 2 Score: 65.855 bits (159), Expect = 2.077e-11
Identity = 36/126 (28.57%), Postives = 67/126 (53.17%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N  N +G+  +H+A     +D++++L+ N  K D +  D +    H   + G LEI+  LL+      AA   G  P+H +  +G++E+  LL+  G  +   T  G TPL +A+++ +++  NL+
Sbjct:  452 NTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKD-DQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLL 576          

HSP 3 Score: 62.7734 bits (151), Expect = 2.581e-10
Identity = 35/135 (25.93%), Postives = 65/135 (48.15%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAID 647
            K+  +N  N  G  P+H+A   +   + + L+N+  + +    + Y P H     GN+++  +LLEN+    A    G  P+H A  +G+  ++ +L+ YG   +  T +G T L IA +   I   + ++   D
Sbjct:  678 KQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVTD 812          

HSP 4 Score: 57.7658 bits (138), Expect = 9.686e-9
Identity = 36/123 (29.27%), Postives = 57/123 (46.34%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHER 611
            KK   +     G  P+H+A   +N  +   L++          N Y P H   KK  LEI T LLE           G+ P+H A  +G  ++V LL+     +++   +GLTPL +A+Q ++
Sbjct:  579 KKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDK 701          

HSP 5 Score: 57.3806 bits (137), Expect = 1.278e-8
Identity = 39/118 (33.05%), Postives = 56/118 (47.46%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
            I  K+DQ  L  HIA  +  L+I++ L+          T+ Y P H   ++G+ EI   LLE    + AA   G  P+H A   G  EV  LL+      D     GLTPL +A+ ++
Sbjct:  486 IKAKDDQTAL--HIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYD 601          

HSP 6 Score: 56.225 bits (134), Expect = 2.957e-8
Identity = 31/120 (25.83%), Postives = 59/120 (49.17%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLIN--NKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA     L+I   L+    +C+T +      P H   ++G++++++ LL  +  +   +  G+ P+H A       V  +L+ +G +ID +T  G TPL +A  +  +   N +
Sbjct:  623 GYTPLHIAAKKNQLEIGTTLLEYGAECNT-VTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFL 741          

HSP 7 Score: 53.5286 bits (127), Expect = 2.057e-7
Identity = 26/77 (33.77%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
             H   K+G++E++  LL+    ++AA   G   +H A L G  EVVR L+  G  ++ ++ +G TPL +A+Q   +D
Sbjct:   62 LHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLD 138          

HSP 8 Score: 51.6026 bits (122), Expect = 8.495e-7
Identity = 34/125 (27.20%), Postives = 58/125 (46.40%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            KK   N K   G  P+HIAC    + +++ L+ +    + + ++   P H     G+  I+  L  +       +  G   +H A   G  +VVR L+  G ++DIK  D  T L IAS+  +++
Sbjct:  381 KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLE 505          

HSP 9 Score: 50.0618 bits (118), Expect = 2.928e-6
Identity = 31/120 (25.83%), Postives = 52/120 (43.33%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            N     G  P+H++    + +I   L+      +      + P H   K G LE+   LL+ K   +AA   G+ P+H A     + V  LL+  G        +G TPL IA++  +++
Sbjct:  518 NAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLE 637          

HSP 10 Score: 50.0618 bits (118), Expect = 3.034e-6
Identity = 27/110 (24.55%), Postives = 56/110 (50.91%), Query Frame = 3
Query:  291 IHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            +H+A    +  + K +++ K +      N + P H   KK  ++++  LL++   ++A  + G+ PIH A   G++ +V+ L  +G   +     G T L +A++  +ID
Sbjct:  363 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQID 472          

HSP 11 Score: 48.521 bits (114), Expect = 8.437e-6
Identity = 29/120 (24.17%), Postives = 52/120 (43.33%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G  P+H+A     L++   L+  K   +    +   P H      N  +   LL+      +    G  P+H A  K   E+   L+ YG + +  T  G++PL +A+Q   +D  +L+
Sbjct:  556 KGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLL 675          

HSP 12 Score: 48.521 bits (114), Expect = 8.663e-6
Identity = 32/153 (20.92%), Postives = 63/153 (41.18%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLI-NNKCDTELIDTNYPPFHSVYKKGNLEIITYLLEN-------------------------------------KLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +N ++  G  P+++A    +LD+++FL+ NN   +   +  + P     ++G+ ++++ LLEN                                     K+ +    + G  P+H A   G   V  LL+  G  +D    + +TPL +AS+
Sbjct:  117 VNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASK 269          
BLAST of Phospholipase A2 group VI vs. Ensembl Zebrafish
Match: BX511162.1 (ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926])

HSP 1 Score: 78.5666 bits (192), Expect = 5.676e-16
Identity = 42/142 (29.58%), Postives = 71/142 (50.00%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
             K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  +I  LL+    I+A    G+ P+H A   G+   V +L+  G  I  +T +GL+PL +++Q + ++C   +   K+ +D V L
Sbjct:  192 SKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMIALLLDRGSQIDAKTRDGLTPLHCAARSGHDSAVEILLEKGAPILARTKNGLSPLHMSAQGDHVECVKHLLQHKAPVDDVTL 333          

HSP 2 Score: 60.8474 bits (146), Expect = 5.511e-10
Identity = 34/117 (29.06%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTEL---------IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +LP +HIA   ++      L+ N  + ++          ++ + P H     GN+ + T LL     ++     G+ P+H A  +G   ++ LL+  G QID KT DGLTPL  A++
Sbjct:  162 RLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMIALLLDRGSQIDAKTRDGLTPLHCAAR 278          

HSP 3 Score: 57.3806 bits (137), Expect = 7.280e-9
Identity = 25/77 (32.47%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
             H   K+G++E++  LLE    ++++   G   +H ACL G KEV +LL+     ++ ++ +G TPL +A+Q   +D
Sbjct:   38 LHLAAKEGHVELVEELLERGAAVDSSTKKGNTALHIACLAGQKEVAKLLVKKTADVNSQSQNGFTPLYMAAQENHLD 114          
BLAST of Phospholipase A2 group VI vs. Ensembl Zebrafish
Match: BX511162.1 (ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926])

HSP 1 Score: 78.5666 bits (192), Expect = 7.352e-16
Identity = 42/142 (29.58%), Postives = 71/142 (50.00%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
             K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  +I  LL+    I+A    G+ P+H A   G+   V +L+  G  I  +T +GL+PL +++Q + ++C   +   K+ +D V L
Sbjct:  200 SKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMIALLLDRGSQIDAKTRDGLTPLHCAARSGHDSAVEILLEKGAPILARTKNGLSPLHMSAQGDHVECVKHLLQHKAPVDDVTL 341          

HSP 2 Score: 60.8474 bits (146), Expect = 5.766e-10
Identity = 34/117 (29.06%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTEL---------IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +LP +HIA   ++      L+ N  + ++          ++ + P H     GN+ + T LL     ++     G+ P+H A  +G   ++ LL+  G QID KT DGLTPL  A++
Sbjct:  170 RLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMIALLLDRGSQIDAKTRDGLTPLHCAAR 286          

HSP 3 Score: 57.3806 bits (137), Expect = 6.922e-9
Identity = 25/77 (32.47%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
             H   K+G++E++  LLE    ++++   G   +H ACL G KEV +LL+     ++ ++ +G TPL +A+Q   +D
Sbjct:   46 LHLAAKEGHVELVEELLERGAAVDSSTKKGNTALHIACLAGQKEVAKLLVKKTADVNSQSQNGFTPLYMAAQENHLD 122          
BLAST of Phospholipase A2 group VI vs. Ensembl Zebrafish
Match: BX511162.1 (ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926])

HSP 1 Score: 78.5666 bits (192), Expect = 8.765e-16
Identity = 42/141 (29.79%), Postives = 71/141 (50.35%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  +I  LL+    I+A    G+ P+H A   G+   V +L+  G  I  +T +GL+PL +++Q + ++C   +   K+ +D V L
Sbjct:  226 KMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMIALLLDRGSQIDAKTRDGLTPLHCAARSGHDSAVEILLEKGAPILARTKNGLSPLHMSAQGDHVECVKHLLQHKAPVDDVTL 366          

HSP 2 Score: 60.8474 bits (146), Expect = 6.337e-10
Identity = 34/117 (29.06%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTEL---------IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +LP +HIA   ++      L+ N  + ++          ++ + P H     GN+ + T LL     ++     G+ P+H A  +G   ++ LL+  G QID KT DGLTPL  A++
Sbjct:  195 RLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMIALLLDRGSQIDAKTRDGLTPLHCAAR 311          

HSP 3 Score: 57.7658 bits (138), Expect = 6.775e-9
Identity = 25/77 (32.47%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
             H   K+G++E++  LLE    ++++   G   +H ACL G KEV +LL+     ++ ++ +G TPL +A+Q   +D
Sbjct:   71 LHLAAKEGHVELVEELLERGAAVDSSTKKGNTALHIACLAGQKEVAKLLVKKTADVNSQSQNGFTPLYMAAQENHLD 147          

HSP 4 Score: 54.6842 bits (130), Expect = 5.525e-8
Identity = 30/112 (26.79%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H++   ++++ +K L+ +K   + +  +Y    H     G+  +   LL+ K    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +++
Sbjct:  331 RTKNGLSPLHMSAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVSA 442          
BLAST of Phospholipase A2 group VI vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 78.1814 bits (191), Expect = 2.511e-15
Identity = 40/129 (31.01%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H     G+++VV +L+  G  I  KT +GL+PL +A+Q + ++C  L+
Sbjct:  219 KMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 347          

HSP 2 Score: 64.3142 bits (155), Expect = 9.352e-11
Identity = 34/113 (30.09%), Postives = 56/113 (49.56%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            G  P+H+A   +N  +   L++          N Y P H   KK  ++I T LLE      A    G+ P+H A  +G+ ++V LL+     +++    GLTPL +A+Q +R+
Sbjct:  592 GLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRV 704          

HSP 3 Score: 61.6178 bits (148), Expect = 7.109e-10
Identity = 33/125 (26.40%), Postives = 63/125 (50.40%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N  N +G+  +H+A      ++++FL+ N    E     +  P H   + G  +I+  LL+     +AA   G  P+H +  +G+ +V  +L+ +G    I T  G TPL +A+++ +I+   L+
Sbjct:  454 NTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLL 578          

HSP 4 Score: 57.3806 bits (137), Expect = 2.068e-8
Identity = 37/155 (23.87%), Postives = 74/155 (47.74%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN----YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIK----SAIDIVPLIRDNYEKDIREII 698
            +N  N  G  P+H+A   + + + + L N      +ID      Y P H     GN++++T+LL++   + A    G  P+H A  +G+  ++ +L+ +G   +  T +G T L IA +   I   + +K      +  V L+ + ++ ++ E +
Sbjct:  684 VNVSNKSGLTPLHLAAQEDRVSVAEVLANQGA---VIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVTEETLTTVQLVTEKHKMNVPETM 835          

HSP 5 Score: 56.9954 bits (136), Expect = 2.281e-8
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            KK   N K   G  P+HIAC    L +++ L+ +    + + ++   P H     G++ I++ L  +       +  G   +H A   G  EVVR L+  G Q++ K  D  TPL I+++  + D
Sbjct:  383 KKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKAD 507          

HSP 6 Score: 55.0694 bits (131), Expect = 9.250e-8
Identity = 41/157 (26.11%), Postives = 67/157 (42.68%), Query Frame = 3
Query:  156 FLRKLFGYGGYEKFMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            F   LF       ++ A  SG++     Y K    IN  N  G   +H+A    +++I+  LI    D +          H     G  E++  L+ N   + A    G  P++ A  + + EVV+ L+  G    + T DG TPL +A Q  H+++
Sbjct:   18 FFFSLFQSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQV 174          

HSP 7 Score: 55.0694 bits (131), Expect = 1.187e-7
Identity = 34/115 (29.57%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
            K+DQ   P+HI+  +   DI++ L+      +   T+ Y P H   ++G+ ++ + LLE+          G  P+H A   G  EVV+LL+      D     GLTPL +A+ ++
Sbjct:  491 KDDQ--TPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYD 603          

HSP 8 Score: 54.6842 bits (130), Expect = 1.536e-7
Identity = 31/112 (27.68%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            K   G  P+H+A   ++L+ ++ L+ +    + +  +Y    H     G+ ++   LL+ K    A    G  P+H AC K   +V+ LL+ +G  I   T  GLTP+ +A+
Sbjct:  324 KTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAA 435          

HSP 9 Score: 54.299 bits (129), Expect = 1.819e-7
Identity = 29/107 (27.10%), Postives = 56/107 (52.34%), Query Frame = 3
Query:  315 NLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            NL+     + N  D  + + N     H   K+G++EI++ L++    ++A+   G   +H A L G  EVVR+L+  G  ++ ++ +G TPL +A+Q   ++    +
Sbjct:   39 NLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFL 145          

HSP 10 Score: 51.2174 bits (121), Expect = 1.824e-6
Identity = 31/113 (27.43%), Postives = 51/113 (45.13%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            G  P+HIA     +DI   L+    D   I      P H   ++G++++++ LL     +  ++  G+ P+H A  +    V  +L   G  ID  T    TPL +AS +  I
Sbjct:  625 GYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNI 737          

HSP 11 Score: 49.6766 bits (117), Expect = 5.127e-6
Identity = 29/114 (25.44%), Postives = 54/114 (47.37%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+H++    + D+   L+ +     ++    + P H   K G +E++  LL+     +AA   G+ P+H A     ++V  LL+  G        +G TPL IA++  ++D
Sbjct:  526 GYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMD 639          

HSP 12 Score: 48.9062 bits (115), Expect = 9.016e-6
Identity = 27/120 (22.50%), Postives = 52/120 (43.33%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G  P+H+A     ++++K L+      +    +   P H      N ++   LL+       A   G  P+H A  K   ++   L+ YG   +  T  G+ P+ +A+Q   +D  +L+
Sbjct:  558 KGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLL 677          
BLAST of Phospholipase A2 group VI vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 77.411 bits (189), Expect = 5.293e-15
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+  G  +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  202 KMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL 342          

HSP 2 Score: 65.4698 bits (158), Expect = 4.838e-11
Identity = 34/113 (30.09%), Postives = 58/113 (51.33%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            G  P+H+A   +N  +   L++     ++   N Y P H   KK  ++I T LL          + G+ P+H A  +G+ ++V LL+     I + T +GLTPL +A+Q +R+
Sbjct:  575 GLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRV 687          

HSP 3 Score: 59.6918 bits (143), Expect = 3.614e-9
Identity = 38/141 (26.95%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  222 VMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSA 641
            VM   V Y    I    + G  PIH+A  + +L+I+  L+ N    ++ +       H   + G +E++  LL N   ++A       P+H A   G  E+V+LL+ +    D  T +G TPL I+++  ++D  +++  A
Sbjct:  392 VMELLVKYGAS-IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 531          

HSP 4 Score: 58.9214 bits (141), Expect = 6.243e-9
Identity = 33/120 (27.50%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G  P+H+A    +LD+ K L+  +   +    N   P H      N ++   LL+     +     G  P+H A  K   ++   L+ YG + +I TN G+TPL +A+Q    D   L+
Sbjct:  541 KGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLL 660          

HSP 5 Score: 57.3806 bits (137), Expect = 1.997e-8
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+      + I ++   P H     G+L I+  LL+N    +  +  G   +H A   G  EVVR L+  G  +D +  +  TPL IAS+  + +   L+
Sbjct:  371 NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 495          

HSP 6 Score: 57.3806 bits (137), Expect = 2.088e-8
Identity = 33/125 (26.40%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N   +QG  P+H+A    + D++  L+N + +  +   N   P H   ++  + +   L +N   ++A   LG  P+  AC  G  ++V  L+ +G  ++ KT +G TPL  A+Q       N++
Sbjct:  635 NILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVL 759          

HSP 7 Score: 56.6102 bits (135), Expect = 3.038e-8
Identity = 31/119 (26.05%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  255 FINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
             ++ +  + + P+HIA  +   +I++ L+ +    +   TN Y P H   ++G +++ + LLE       A   G  P+H A   G  +V +LL+      D    +GLTPL +A+ ++
Sbjct:  468 LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAAHYD 586          

HSP 8 Score: 55.8398 bits (133), Expect = 6.145e-8
Identity = 31/112 (27.68%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H+A   ++++ +K L+ +K   + +  +Y    H     G+  +   LL+ +    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+
Sbjct:  307 RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAA 418          

HSP 9 Score: 53.5286 bits (127), Expect = 3.300e-7
Identity = 25/77 (32.47%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
             H   K+G++ ++  L+E    +++A   G   +H A L G  EVV++L+  G  I+ ++ +G TPL +A+Q   ID
Sbjct:   47 LHLAAKEGHIGLVQELMERGSAVDSATKKGNTALHIASLAGQAEVVKILVKQGANINAQSQNGFTPLYMAAQENHID 123          

HSP 10 Score: 52.7582 bits (125), Expect = 6.195e-7
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  270 NDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +G+  +H+A     +++++ L+ N     L+D        P H   + G  EI+  LL++    +AA   G  P+H +  +G  +V  +L+  G    + T  G TPL +A+++  +D   L+
Sbjct:  440 NIRGETALHMAARAGQVEVVRCLLRNGA---LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL 561          

HSP 11 Score: 52.373 bits (124), Expect = 8.448e-7
Identity = 32/119 (26.89%), Postives = 54/119 (45.38%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTE-LIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA     + I   L+N   +T  L +    P H   ++G+ +++T LL  +  I      G+ P+H A  +    V  +L   G  +D +T  G +PL +A  +  I   N +
Sbjct:  608 GYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFL 726          

HSP 12 Score: 49.2914 bits (116), Expect = 6.453e-6
Identity = 32/138 (23.19%), Postives = 65/138 (47.10%), Query Frame = 3
Query:  225 MNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIK 635
            M T +  K+  I+     G  P+H+A   + + + + L  N  + +      Y P       GN++++ +LL +   + A    G  P+H A  +G+  ++ +L+  G + ++ T++G T L IA +   I   + +K
Sbjct:  656 MVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNVTTSNGNTALAIARRLGYISVVDTLK 793          
BLAST of Phospholipase A2 group VI vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 77.411 bits (189), Expect = 5.295e-15
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+  G  +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  223 KMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL 363          

HSP 2 Score: 65.4698 bits (158), Expect = 4.840e-11
Identity = 34/113 (30.09%), Postives = 58/113 (51.33%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            G  P+H+A   +N  +   L++     ++   N Y P H   KK  ++I T LL          + G+ P+H A  +G+ ++V LL+     I + T +GLTPL +A+Q +R+
Sbjct:  596 GLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRV 708          

HSP 3 Score: 59.6918 bits (143), Expect = 3.616e-9
Identity = 38/141 (26.95%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  222 VMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSA 641
            VM   V Y    I    + G  PIH+A  + +L+I+  L+ N    ++ +       H   + G +E++  LL N   ++A       P+H A   G  E+V+LL+ +    D  T +G TPL I+++  ++D  +++  A
Sbjct:  413 VMELLVKYGAS-IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 552          

HSP 4 Score: 58.9214 bits (141), Expect = 6.246e-9
Identity = 33/120 (27.50%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G  P+H+A    +LD+ K L+  +   +    N   P H      N ++   LL+     +     G  P+H A  K   ++   L+ YG + +I TN G+TPL +A+Q    D   L+
Sbjct:  562 KGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLL 681          

HSP 5 Score: 57.3806 bits (137), Expect = 1.998e-8
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+      + I ++   P H     G+L I+  LL+N    +  +  G   +H A   G  EVVR L+  G  +D +  +  TPL IAS+  + +   L+
Sbjct:  392 NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 516          

HSP 6 Score: 57.3806 bits (137), Expect = 2.089e-8
Identity = 33/125 (26.40%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N   +QG  P+H+A    + D++  L+N + +  +   N   P H   ++  + +   L +N   ++A   LG  P+  AC  G  ++V  L+ +G  ++ KT +G TPL  A+Q       N++
Sbjct:  656 NILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVL 780          

HSP 7 Score: 56.6102 bits (135), Expect = 3.039e-8
Identity = 31/119 (26.05%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  255 FINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
             ++ +  + + P+HIA  +   +I++ L+ +    +   TN Y P H   ++G +++ + LLE       A   G  P+H A   G  +V +LL+      D    +GLTPL +A+ ++
Sbjct:  489 LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAAHYD 607          

HSP 8 Score: 55.8398 bits (133), Expect = 6.147e-8
Identity = 31/112 (27.68%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H+A   ++++ +K L+ +K   + +  +Y    H     G+  +   LL+ +    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+
Sbjct:  328 RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAA 439          

HSP 9 Score: 53.5286 bits (127), Expect = 3.301e-7
Identity = 25/77 (32.47%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
             H   K+G++ ++  L+E    +++A   G   +H A L G  EVV++L+  G  I+ ++ +G TPL +A+Q   ID
Sbjct:   68 LHLAAKEGHIGLVQELMERGSAVDSATKKGNTALHIASLAGQAEVVKILVKQGANINAQSQNGFTPLYMAAQENHID 144          

HSP 10 Score: 52.7582 bits (125), Expect = 6.197e-7
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  270 NDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +G+  +H+A     +++++ L+ N     L+D        P H   + G  EI+  LL++    +AA   G  P+H +  +G  +V  +L+  G    + T  G TPL +A+++  +D   L+
Sbjct:  461 NIRGETALHMAARAGQVEVVRCLLRNGA---LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL 582          

HSP 11 Score: 52.373 bits (124), Expect = 8.451e-7
Identity = 32/119 (26.89%), Postives = 54/119 (45.38%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTE-LIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA     + I   L+N   +T  L +    P H   ++G+ +++T LL  +  I      G+ P+H A  +    V  +L   G  +D +T  G +PL +A  +  I   N +
Sbjct:  629 GYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFL 747          

HSP 12 Score: 49.2914 bits (116), Expect = 6.455e-6
Identity = 32/138 (23.19%), Postives = 65/138 (47.10%), Query Frame = 3
Query:  225 MNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIK 635
            M T +  K+  I+     G  P+H+A   + + + + L  N  + +      Y P       GN++++ +LL +   + A    G  P+H A  +G+  ++ +L+  G + ++ T++G T L IA +   I   + +K
Sbjct:  677 MVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNVTTSNGNTALAIARRLGYISVVDTLK 814          
BLAST of Phospholipase A2 group VI vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 77.411 bits (189), Expect = 5.297e-15
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+  G  +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  202 KMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL 342          

HSP 2 Score: 65.4698 bits (158), Expect = 4.841e-11
Identity = 34/113 (30.09%), Postives = 58/113 (51.33%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            G  P+H+A   +N  +   L++     ++   N Y P H   KK  ++I T LL          + G+ P+H A  +G+ ++V LL+     I + T +GLTPL +A+Q +R+
Sbjct:  575 GLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRV 687          

HSP 3 Score: 59.6918 bits (143), Expect = 3.617e-9
Identity = 38/141 (26.95%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  222 VMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSA 641
            VM   V Y    I    + G  PIH+A  + +L+I+  L+ N    ++ +       H   + G +E++  LL N   ++A       P+H A   G  E+V+LL+ +    D  T +G TPL I+++  ++D  +++  A
Sbjct:  392 VMELLVKYGAS-IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 531          

HSP 4 Score: 58.9214 bits (141), Expect = 6.248e-9
Identity = 33/120 (27.50%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G  P+H+A    +LD+ K L+  +   +    N   P H      N ++   LL+     +     G  P+H A  K   ++   L+ YG + +I TN G+TPL +A+Q    D   L+
Sbjct:  541 KGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLL 660          

HSP 5 Score: 57.3806 bits (137), Expect = 1.998e-8
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+      + I ++   P H     G+L I+  LL+N    +  +  G   +H A   G  EVVR L+  G  +D +  +  TPL IAS+  + +   L+
Sbjct:  371 NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 495          

HSP 6 Score: 57.3806 bits (137), Expect = 2.089e-8
Identity = 33/125 (26.40%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N   +QG  P+H+A    + D++  L+N + +  +   N   P H   ++  + +   L +N   ++A   LG  P+  AC  G  ++V  L+ +G  ++ KT +G TPL  A+Q       N++
Sbjct:  635 NILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVL 759          

HSP 7 Score: 56.6102 bits (135), Expect = 3.040e-8
Identity = 31/119 (26.05%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  255 FINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
             ++ +  + + P+HIA  +   +I++ L+ +    +   TN Y P H   ++G +++ + LLE       A   G  P+H A   G  +V +LL+      D    +GLTPL +A+ ++
Sbjct:  468 LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAAHYD 586          

HSP 8 Score: 55.8398 bits (133), Expect = 6.149e-8
Identity = 31/112 (27.68%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H+A   ++++ +K L+ +K   + +  +Y    H     G+  +   LL+ +    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+
Sbjct:  307 RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAA 418          

HSP 9 Score: 53.5286 bits (127), Expect = 3.302e-7
Identity = 25/77 (32.47%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
             H   K+G++ ++  L+E    +++A   G   +H A L G  EVV++L+  G  I+ ++ +G TPL +A+Q   ID
Sbjct:   47 LHLAAKEGHIGLVQELMERGSAVDSATKKGNTALHIASLAGQAEVVKILVKQGANINAQSQNGFTPLYMAAQENHID 123          

HSP 10 Score: 52.7582 bits (125), Expect = 6.199e-7
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  270 NDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +G+  +H+A     +++++ L+ N     L+D        P H   + G  EI+  LL++    +AA   G  P+H +  +G  +V  +L+  G    + T  G TPL +A+++  +D   L+
Sbjct:  440 NIRGETALHMAARAGQVEVVRCLLRNGA---LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL 561          

HSP 11 Score: 52.373 bits (124), Expect = 8.453e-7
Identity = 32/119 (26.89%), Postives = 54/119 (45.38%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTE-LIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA     + I   L+N   +T  L +    P H   ++G+ +++T LL  +  I      G+ P+H A  +    V  +L   G  +D +T  G +PL +A  +  I   N +
Sbjct:  608 GYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFL 726          

HSP 12 Score: 49.2914 bits (116), Expect = 6.457e-6
Identity = 32/138 (23.19%), Postives = 65/138 (47.10%), Query Frame = 3
Query:  225 MNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIK 635
            M T +  K+  I+     G  P+H+A   + + + + L  N  + +      Y P       GN++++ +LL +   + A    G  P+H A  +G+  ++ +L+  G + ++ T++G T L IA +   I   + +K
Sbjct:  656 MVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNVTTSNGNTALAIARRLGYISVVDTLK 793          
BLAST of Phospholipase A2 group VI vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 77.411 bits (189), Expect = 5.350e-15
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+  G  +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  202 KMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL 342          

HSP 2 Score: 65.4698 bits (158), Expect = 4.886e-11
Identity = 34/113 (30.09%), Postives = 58/113 (51.33%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            G  P+H+A   +N  +   L++     ++   N Y P H   KK  ++I T LL          + G+ P+H A  +G+ ++V LL+     I + T +GLTPL +A+Q +R+
Sbjct:  575 GLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRV 687          

HSP 3 Score: 59.6918 bits (143), Expect = 3.649e-9
Identity = 38/141 (26.95%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  222 VMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSA 641
            VM   V Y    I    + G  PIH+A  + +L+I+  L+ N    ++ +       H   + G +E++  LL N   ++A       P+H A   G  E+V+LL+ +    D  T +G TPL I+++  ++D  +++  A
Sbjct:  392 VMELLVKYGAS-IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 531          

HSP 4 Score: 58.9214 bits (141), Expect = 6.302e-9
Identity = 33/120 (27.50%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G  P+H+A    +LD+ K L+  +   +    N   P H      N ++   LL+     +     G  P+H A  K   ++   L+ YG + +I TN G+TPL +A+Q    D   L+
Sbjct:  541 KGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLL 660          

HSP 5 Score: 57.3806 bits (137), Expect = 2.015e-8
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+      + I ++   P H     G+L I+  LL+N    +  +  G   +H A   G  EVVR L+  G  +D +  +  TPL IAS+  + +   L+
Sbjct:  371 NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 495          

HSP 6 Score: 57.3806 bits (137), Expect = 2.107e-8
Identity = 33/125 (26.40%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N   +QG  P+H+A    + D++  L+N + +  +   N   P H   ++  + +   L +N   ++A   LG  P+  AC  G  ++V  L+ +G  ++ KT +G TPL  A+Q       N++
Sbjct:  635 NILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVL 759          

HSP 7 Score: 56.6102 bits (135), Expect = 3.065e-8
Identity = 31/119 (26.05%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  255 FINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
             ++ +  + + P+HIA  +   +I++ L+ +    +   TN Y P H   ++G +++ + LLE       A   G  P+H A   G  +V +LL+      D    +GLTPL +A+ ++
Sbjct:  468 LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAAHYD 586          

HSP 8 Score: 55.8398 bits (133), Expect = 6.200e-8
Identity = 31/112 (27.68%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H+A   ++++ +K L+ +K   + +  +Y    H     G+  +   LL+ +    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+
Sbjct:  307 RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAA 418          

HSP 9 Score: 53.5286 bits (127), Expect = 3.329e-7
Identity = 25/77 (32.47%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
             H   K+G++ ++  L+E    +++A   G   +H A L G  EVV++L+  G  I+ ++ +G TPL +A+Q   ID
Sbjct:   47 LHLAAKEGHIGLVQELMERGSAVDSATKKGNTALHIASLAGQAEVVKILVKQGANINAQSQNGFTPLYMAAQENHID 123          

HSP 10 Score: 52.7582 bits (125), Expect = 6.248e-7
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  270 NDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +G+  +H+A     +++++ L+ N     L+D        P H   + G  EI+  LL++    +AA   G  P+H +  +G  +V  +L+  G    + T  G TPL +A+++  +D   L+
Sbjct:  440 NIRGETALHMAARAGQVEVVRCLLRNGA---LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL 561          

HSP 11 Score: 52.373 bits (124), Expect = 8.520e-7
Identity = 32/119 (26.89%), Postives = 54/119 (45.38%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTE-LIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA     + I   L+N   +T  L +    P H   ++G+ +++T LL  +  I      G+ P+H A  +    V  +L   G  +D +T  G +PL +A  +  I   N +
Sbjct:  608 GYTPLHIASKKNQMQIATTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFL 726          

HSP 12 Score: 49.2914 bits (116), Expect = 6.505e-6
Identity = 32/138 (23.19%), Postives = 65/138 (47.10%), Query Frame = 3
Query:  225 MNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIK 635
            M T +  K+  I+     G  P+H+A   + + + + L  N  + +      Y P       GN++++ +LL +   + A    G  P+H A  +G+  ++ +L+  G + ++ T++G T L IA +   I   + +K
Sbjct:  656 MVTLLLNKQANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLIVACHYGNIKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNVTTSNGNTALAIARRLGYISVVDTLK 793          
BLAST of Phospholipase A2 group VI vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 77.7962 bits (190), Expect = 1.453e-15
Identity = 42/142 (29.58%), Postives = 72/142 (50.70%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
             K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+     +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  201 SKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTL 342          

HSP 2 Score: 62.003 bits (149), Expect = 2.730e-10
Identity = 36/123 (29.27%), Postives = 62/123 (50.41%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTEL---------IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            +LP +HIA   ++      L+ N  + ++          ++ + P H     GN+ + T LL     ++     G+ P+H A  +G   +V+LL+  G QID KT DGLTPL  A++  H+++
Sbjct:  171 RLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQV 293          

HSP 3 Score: 55.4546 bits (132), Expect = 3.807e-8
Identity = 40/134 (29.85%), Postives = 64/134 (47.76%), Query Frame = 3
Query:  252 DFINRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERIDCFNLIKSA 641
            DF  R    G  P+H+A    N +++K L++   + D +  D    P H   + G+ +++  LLE K  + A    G+ P+H A    + E V+ L+ Y   +D  T D LT L +A+   H R+    L K A
Sbjct:  239 DFTARN---GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD-GLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRA 368          

HSP 4 Score: 52.373 bits (124), Expect = 3.517e-7
Identity = 25/77 (32.47%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
             H   K+G++ ++  LL     +++A   G   +H A L G  EVV++L+  G  I+ ++ +G TPL +A+Q   ID
Sbjct:   47 LHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHID 123          
BLAST of Phospholipase A2 group VI vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 77.7962 bits (190), Expect = 1.614e-15
Identity = 42/141 (29.79%), Postives = 72/141 (51.06%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+     +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  238 KMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTL 378          

HSP 2 Score: 62.003 bits (149), Expect = 2.412e-10
Identity = 35/117 (29.91%), Postives = 58/117 (49.57%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTEL---------IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +LP +HIA   ++      L+ N  + ++          ++ + P H     GN+ + T LL     ++     G+ P+H A  +G   +V+LL+  G QID KT DGLTPL  A++
Sbjct:  207 RLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAAR 323          

HSP 3 Score: 55.4546 bits (132), Expect = 3.306e-8
Identity = 40/134 (29.85%), Postives = 64/134 (47.76%), Query Frame = 3
Query:  252 DFINRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERIDCFNLIKSA 641
            DF  R    G  P+H+A    N +++K L++   + D +  D    P H   + G+ +++  LLE K  + A    G+ P+H A    + E V+ L+ Y   +D  T D LT L +A+   H R+    L K A
Sbjct:  275 DFTAR---NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD-GLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRA 404          

HSP 4 Score: 52.373 bits (124), Expect = 3.809e-7
Identity = 25/78 (32.05%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDC 620
             H   K+G++ ++  LL     +++A   G   +H A L G  EVV++L+  G  I+ ++ +G TPL +A+Q   ID 
Sbjct:   83 LHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDV 160          
BLAST of Phospholipase A2 group VI vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 77.7962 bits (190), Expect = 1.863e-15
Identity = 42/142 (29.58%), Postives = 72/142 (50.70%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
             K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+     +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  234 SKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTL 375          

HSP 2 Score: 62.003 bits (149), Expect = 3.274e-10
Identity = 36/123 (29.27%), Postives = 62/123 (50.41%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTEL---------IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            +LP +HIA   ++      L+ N  + ++          ++ + P H     GN+ + T LL     ++     G+ P+H A  +G   +V+LL+  G QID KT DGLTPL  A++  H+++
Sbjct:  204 RLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQV 326          

HSP 3 Score: 55.4546 bits (132), Expect = 4.490e-8
Identity = 40/134 (29.85%), Postives = 64/134 (47.76%), Query Frame = 3
Query:  252 DFINRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERIDCFNLIKSA 641
            DF  R    G  P+H+A    N +++K L++   + D +  D    P H   + G+ +++  LLE K  + A    G+ P+H A    + E V+ L+ Y   +D  T D LT L +A+   H R+    L K A
Sbjct:  272 DFTARN---GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD-GLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRA 401          

HSP 4 Score: 54.299 bits (129), Expect = 8.123e-8
Identity = 31/112 (27.68%), Postives = 54/112 (48.21%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H+A   ++++ +K L+  K   + +  +Y    H     G+  +   LL+ +    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+
Sbjct:  340 RTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAA 451          

HSP 5 Score: 52.7582 bits (125), Expect = 3.175e-7
Identity = 25/79 (31.65%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCF 623
             H   K+G++ ++  LL     +++A   G   +H A L G  EVV++L+  G  I+ ++ +G TPL +A+Q   ID  
Sbjct:   80 LHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVV 158          
BLAST of Phospholipase A2 group VI vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 77.0258 bits (188), Expect = 4.655e-15
Identity = 39/129 (30.23%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H     G+++VV +L+     I  KT +GL+PL +A+Q + ++C  L+
Sbjct:  233 KMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLL 361          

HSP 2 Score: 62.7734 bits (151), Expect = 2.682e-10
Identity = 33/114 (28.95%), Postives = 56/114 (49.12%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+H+A   +N  +   L++          N Y P H   KK  ++I T LLE      A    G+  +H A  +G+ ++V LL+     +++    GLTPL +A+Q +R++
Sbjct:  606 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVN 719          

HSP 3 Score: 62.3882 bits (150), Expect = 2.988e-10
Identity = 34/130 (26.15%), Postives = 67/130 (51.54%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI--KSA 641
            N  N +G+  +H+A      +++++L+ +    E     +  P H   + G  +I+  LL+      AA   G  P+H A  +G+++V   L+ +G  + I T  G TPL +A+++ +++  +L+  KSA
Sbjct:  468 NTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSA 597          

HSP 4 Score: 57.7658 bits (138), Expect = 1.093e-8
Identity = 34/125 (27.20%), Postives = 60/125 (48.00%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            KK   N K   G  P+HIAC    + +++ L+ +    + + ++   P H     G++ I++ L+ +       +  G   +H A   G  EVVR L+  G Q++ K  D  TPL I+++  + D
Sbjct:  397 KKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKAD 521          

HSP 5 Score: 56.9954 bits (136), Expect = 1.818e-8
Identity = 28/94 (29.79%), Postives = 53/94 (56.38%), Query Frame = 3
Query:  339 INNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            I N  D  + + N     H   K+G++E+++ LL+ +  ++AA   G   +H A L G  EVV++L+  G  ++ ++ +G TPL +A+Q   ++
Sbjct:   61 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLE 154          

HSP 6 Score: 56.9954 bits (136), Expect = 1.901e-8
Identity = 33/120 (27.50%), Postives = 56/120 (46.67%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            N     G  P+H+A    + D+  FL+++     +     + P H   K G LE+ + LL+     +AA   G+ P+H A     ++V  LL+  G        +G TPL IA++  ++D
Sbjct:  534 NAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMD 653          

HSP 7 Score: 54.299 bits (129), Expect = 1.543e-7
Identity = 31/112 (27.68%), Postives = 54/112 (48.21%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            K   G  P+H+A   ++L+ ++ L+ +    + +  +Y    H     G+ ++   LL+ K    A    G  P+H AC K    V+ LL+ +G  I   T  GLTP+ +A+
Sbjct:  338 KTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAA 449          

HSP 8 Score: 52.7582 bits (125), Expect = 4.852e-7
Identity = 28/119 (23.53%), Postives = 53/119 (44.54%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA     +DI   L+    D   +        H   ++G++++++ LL     +  ++  G+ P+H A  +    V  +L+  G  +D +T  G TPL +   +  I   N +
Sbjct:  639 GYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL 757          

HSP 9 Score: 52.373 bits (124), Expect = 5.691e-7
Identity = 30/139 (21.58%), Postives = 64/139 (46.04%), Query Frame = 3
Query:  219 DVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            D+  + + Y  D  N    QG   +H+A    ++D++  L++   +  L + +   P H   ++  + +   L+     ++A   +G  P+H  C  G  ++V  L+ +  +++ KT +G T L  A+Q       N++
Sbjct:  653 DIATSLLEYGAD-ANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVL 790          

HSP 10 Score: 50.8322 bits (120), Expect = 1.881e-6
Identity = 30/127 (23.62%), Postives = 59/127 (46.46%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIK 635
            +N  N  G  P+H+A   + +++ + L+N     +      Y P H     GN++I+ +LL++   + A    G   +H A  +G+  ++ +L+      +  T +G T L IA +   I   + +K
Sbjct:  698 VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 824          

HSP 11 Score: 49.6766 bits (117), Expect = 4.277e-6
Identity = 34/144 (23.61%), Postives = 64/144 (44.44%), Query Frame = 3
Query:  195 FMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            ++ A  +G +     Y K    +N  N  G   +H+A    +++++  L+  + + +          H     G  E++  L+ N   + A    G  P++ A  + + EVVR L+  G    + T DG TPL +A Q  H+++
Sbjct:   45 YLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQV 188          
BLAST of Phospholipase A2 group VI vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 75.0998 bits (183), Expect = 1.711e-14
Identity = 36/119 (30.25%), Postives = 62/119 (52.10%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA   ENL++ + L+N          N   P H   ++GN+ ++  LL+    IE      + P+H A   G+  +  +L+ +G  I  KT +GL+P+ +A+Q + +DC  L+
Sbjct:  210 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 328          

HSP 2 Score: 62.7734 bits (151), Expect = 1.882e-10
Identity = 41/131 (31.30%), Postives = 63/131 (48.09%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERIDCFNLIKSA 641
            +N     G  P+HIA    N+ +++ L++     E        P H   + G++ I   LL++   I+A    G+ PIH A    + + VRLL+ Y  +ID  T D LTPL +A+   H R+    L K A
Sbjct:  236 VNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGA 366          

HSP 3 Score: 59.3066 bits (142), Expect = 2.283e-9
Identity = 36/115 (31.30%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            I  K   G  PIH+A   ++LD ++ L+    + + I  ++  P H     G+  +   LL+      +    G  P+H AC K +  V+ LL+  G  ID  T  GLTPL +AS
Sbjct:  302 IQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVAS 416          

HSP 4 Score: 56.6102 bits (135), Expect = 1.911e-8
Identity = 36/116 (31.03%), Postives = 57/116 (49.14%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERID 617
            +LP +HIA   ++      L+ N  + +++  T + P H      NL +   LL     +      G+ P+H A  +G   +VRLL+  G QI+ +T D LTPL  A++  H RI 
Sbjct:  177 RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRIS 292          

HSP 5 Score: 56.225 bits (134), Expect = 2.226e-8
Identity = 34/122 (27.87%), Postives = 58/122 (47.54%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDC 620
            I+   + G  P+H+A  + +L I+K L+       + +     P H   + G+ E+  YLL+NK    A       P+H A   G+  +V+LL+  G   ++ T  G TPL  A++   +D 
Sbjct:  401 IDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDT 522          

HSP 6 Score: 53.1434 bits (126), Expect = 2.330e-7
Identity = 24/82 (29.27%), Postives = 44/82 (53.66%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
             H   K+G+++++  LL  ++ +E     G   +H A L G  EVVR L+ YG  ++ ++  G TPL +A+Q   ++    +
Sbjct:   53 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFL 134          

HSP 7 Score: 51.2174 bits (121), Expect = 1.008e-6
Identity = 35/166 (21.08%), Postives = 69/166 (41.57%), Query Frame = 3
Query:  225 MNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT-NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQ-----------------------------IDIKTNDGLTPLDIASQHERIDCFNLI 632
            M   + +K+  +     +G   +HIA +    ++++ L+N   +        + P +   ++ +LE++ +LLEN      A + G  P+  A  +G++ VV  LI YG +                              D+ +  G TPL IA+ +E ++   L+
Sbjct:   64 MVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLL 229          
BLAST of Phospholipase A2 group VI vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 77.411 bits (189), Expect = 2.811e-14
Identity = 39/129 (30.23%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H     G+++VV +L+     I  KT +GL+PL +A+Q + ++C  L+
Sbjct:  233 KMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLL 361          

HSP 2 Score: 62.7734 bits (151), Expect = 1.876e-9
Identity = 33/114 (28.95%), Postives = 56/114 (49.12%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+H+A   +N  +   L++          N Y P H   KK  ++I T LLE      A    G+  +H A  +G+ ++V LL+     +++    GLTPL +A+Q +R++
Sbjct:  606 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVN 719          

HSP 3 Score: 61.2326 bits (147), Expect = 5.049e-9
Identity = 33/130 (25.38%), Postives = 67/130 (51.54%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI--KSA 641
            N  N +G+  +H+A      +++++L+ +    E     +  P H   + G  +I+  LL+      AA   G  P+H +  +G+++V   L+ +G  + I T  G TPL +A+++ +++  +L+  KSA
Sbjct:  468 NTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSA 597          

HSP 4 Score: 57.3806 bits (137), Expect = 9.304e-8
Identity = 34/125 (27.20%), Postives = 60/125 (48.00%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            KK   N K   G  P+HIAC    + +++ L+ +    + + ++   P H     G++ I++ L+ +       +  G   +H A   G  EVVR L+  G Q++ K  D  TPL I+++  + D
Sbjct:  397 KKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKAD 521          

HSP 5 Score: 56.9954 bits (136), Expect = 1.272e-7
Identity = 28/94 (29.79%), Postives = 53/94 (56.38%), Query Frame = 3
Query:  339 INNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            I N  D  + + N     H   K+G++E+++ LL+ +  ++AA   G   +H A L G  EVV++L+  G  ++ ++ +G TPL +A+Q   ++
Sbjct:   61 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLE 154          

HSP 6 Score: 55.8398 bits (133), Expect = 3.160e-7
Identity = 31/139 (22.30%), Postives = 65/139 (46.76%), Query Frame = 3
Query:  219 DVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            D+  + + Y  D  N    QG   +H+A    ++D++  L++   +  L + +   P H   ++  + +   L+     ++A   +G  P+H  C  G  ++V  L+ +  +++ KT +G TPL  A+Q       N++
Sbjct:  653 DIATSLLEYGAD-ANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVL 790          

HSP 7 Score: 55.8398 bits (133), Expect = 3.188e-7
Identity = 32/120 (26.67%), Postives = 56/120 (46.67%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            N     G  P+H++    + D+  FL+++     +     + P H   K G LE+ + LL+     +AA   G+ P+H A     ++V  LL+  G        +G TPL IA++  ++D
Sbjct:  534 NAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMD 653          

HSP 8 Score: 54.299 bits (129), Expect = 1.051e-6
Identity = 31/127 (24.41%), Postives = 60/127 (47.24%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIK 635
            +N  N  G  P+H+A   + +++ + L+N     +      Y P H     GN++I+ +LL++   + A    G  P+H A  +G+  ++ +L+      +  T +G T L IA +   I   + +K
Sbjct:  698 VNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 824          

HSP 9 Score: 53.9138 bits (128), Expect = 1.129e-6
Identity = 31/112 (27.68%), Postives = 54/112 (48.21%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            K   G  P+H+A   ++L+ ++ L+ +    + +  +Y    H     G+ ++   LL+ K    A    G  P+H AC K    V+ LL+ +G  I   T  GLTP+ +A+
Sbjct:  338 KTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAA 449          

HSP 10 Score: 52.7582 bits (125), Expect = 3.394e-6
Identity = 28/119 (23.53%), Postives = 53/119 (44.54%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA     +DI   L+    D   +        H   ++G++++++ LL     +  ++  G+ P+H A  +    V  +L+  G  +D +T  G TPL +   +  I   N +
Sbjct:  639 GYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL 757          
BLAST of Phospholipase A2 group VI vs. UniProt/SwissProt
Match: sp|Q01484|ANK2_HUMAN (Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4)

HSP 1 Score: 77.411 bits (189), Expect = 2.816e-14
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+  G  +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  223 KMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL 363          

HSP 2 Score: 59.6918 bits (143), Expect = 1.922e-8
Identity = 38/141 (26.95%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  222 VMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSA 641
            VM   V Y    I    + G  PIH+A  + +L+I+  L+ N    ++ +       H   + G +E++  LL N   ++A       P+H A   G  E+V+LL+ +    D  T +G TPL I+++  ++D  +++  A
Sbjct:  413 VMELLVKYGAS-IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 552          

HSP 3 Score: 59.3066 bits (142), Expect = 2.300e-8
Identity = 32/119 (26.89%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+H+A   +N  +   L+           N Y P H   KK  ++I + LL            G+ P+H A  +G+ ++V LL+  G  I + T  GLT L +A+Q ++++  +++
Sbjct:  596 GLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADIL 714          

HSP 4 Score: 57.3806 bits (137), Expect = 1.062e-7
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+      + I ++   P H     G+L I+  LL+N    +  +  G   +H A   G  EVVR L+  G  +D +  +  TPL IAS+  + +   L+
Sbjct:  392 NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 516          

HSP 5 Score: 56.9954 bits (136), Expect = 1.225e-7
Identity = 31/119 (26.05%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  255 FINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
             ++ +  + + P+HIA  +   +I++ L+ +    +   TN Y P H   ++G +++ + LLE       A   G  P+H A   G  +V +LL+      D    +GLTPL +A+ ++
Sbjct:  489 LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYD 607          

HSP 6 Score: 55.8398 bits (133), Expect = 3.267e-7
Identity = 31/112 (27.68%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H+A   ++++ +K L+ +K   + +  +Y    H     G+  +   LL+ +    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+
Sbjct:  328 RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAA 439          

HSP 7 Score: 52.7582 bits (125), Expect = 3.293e-6
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  270 NDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +G+  +H+A     +++++ L+ N     L+D        P H   + G  EI+  LL++    +AA   G  P+H +  +G  +V  +L+  G    + T  G TPL +A+++  +D   L+
Sbjct:  461 NIRGETALHMAARAGQVEVVRCLLRNGA---LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL 582          
BLAST of Phospholipase A2 group VI vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 2.712e-13
Identity = 42/141 (29.79%), Postives = 72/141 (51.06%), Query Frame = 3
Query:  249 KDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            K  +NR  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+ +VV LL+     +  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  223 KMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTL 363          

HSP 2 Score: 60.8474 bits (146), Expect = 6.782e-9
Identity = 39/136 (28.68%), Postives = 62/136 (45.59%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFN-LIKSAIDIVPLIRDNYEK 680
            G  P+H+A   +N  +   L+           N Y P H   KK  ++I + LL            G+ P+H A  +G+ ++V LL+  G  I + T  GLT L +A+Q ++++  + L K   D     RD Y K
Sbjct:  596 GLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGAD-----RDAYTK 726          

HSP 3 Score: 59.6918 bits (143), Expect = 1.921e-8
Identity = 38/141 (26.95%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  222 VMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSA 641
            VM   V Y    I    + G  PIH+A  + +L+I+  L+ N    ++ +       H   + G +E++  LL N   ++A       P+H A   G  E+V+LL+ +    D  T +G TPL I+++  ++D  +++  A
Sbjct:  413 VMELLVKYGAS-IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEA 552          

HSP 4 Score: 59.3066 bits (142), Expect = 2.652e-8
Identity = 37/123 (30.08%), Postives = 61/123 (49.59%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTEL---------IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIA--SQHERI 614
            +LP +HIA   ++      L+ N  + ++          ++ + P H     GN+ + T LL     ++     G+ P+H A  +G   +V+LL+  G QID KT DGLTPL  A  S H+++
Sbjct:  192 RLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQV 314          

HSP 5 Score: 57.3806 bits (137), Expect = 1.061e-7
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+      + I ++   P H     G+L I+  LL+N    +  +  G   +H A   G  EVVR L+  G  +D +  +  TPL IAS+  + +   L+
Sbjct:  392 NARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLL 516          

HSP 6 Score: 56.9954 bits (136), Expect = 1.224e-7
Identity = 31/119 (26.05%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  255 FINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
             ++ +  + + P+HIA  +   +I++ L+ +    +   TN Y P H   ++G +++ + LLE       A   G  P+H A   G  +V +LL+      D    +GLTPL +A+ ++
Sbjct:  489 LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYD 607          

HSP 7 Score: 54.6842 bits (130), Expect = 7.471e-7
Identity = 31/112 (27.68%), Postives = 54/112 (48.21%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H+A   ++++ +K L+  K   + +  +Y    H     G+  +   LL+ +    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+
Sbjct:  328 RTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAA 439          

HSP 8 Score: 53.1434 bits (126), Expect = 2.268e-6
Identity = 40/134 (29.85%), Postives = 64/134 (47.76%), Query Frame = 3
Query:  252 DFINRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERIDCFNLIKSA 641
            DF  R    G  P+H+A    N +++K L++   + D +  D    P H   + G+ +++  LLE K  + A    G+ P+H A    + E V+ L+ Y   +D  T D LT L +A+   H R+    L K A
Sbjct:  260 DFTAR---NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD-GLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRA 389          

HSP 9 Score: 52.7582 bits (125), Expect = 3.291e-6
Identity = 32/125 (25.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  270 NDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +G+  +H+A     +++++ L+ N     L+D        P H   + G  EI+  LL++    +AA   G  P+H +  +G  +V  +L+  G    + T  G TPL +A+++  +D   L+
Sbjct:  461 NIRGETALHMAARAGQVEVVRCLLRNGA---LVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLL 582          
BLAST of Phospholipase A2 group VI vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 5.858e-13
Identity = 36/119 (30.25%), Postives = 62/119 (52.10%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA   ENL++ + L+N          N   P H   ++GN+ ++  LL+    IE      + P+H A   G+  +  +L+ +G  I  KT +GL+P+ +A+Q + +DC  L+
Sbjct:  206 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 324          

HSP 2 Score: 63.1586 bits (152), Expect = 1.211e-9
Identity = 39/153 (25.49%), Postives = 73/153 (47.71%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN----YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVP--LIRDNYEKDIREIIE 701
            N  N  G  P+H+     ++ +   LI +     ++D      Y P H     GN++++ +LL+++  + A   LG  P+H A  +G+ ++V LL+  G   +  ++DG TPL IA +   I   +++K   D     L+ D +     E ++
Sbjct:  662 NLGNKSGLTPLHLVAQEGHVPVADVLIKHGV---MVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMSFPETVD 811          

HSP 3 Score: 62.003 bits (149), Expect = 2.983e-9
Identity = 35/126 (27.78%), Postives = 58/126 (46.03%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT-NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +N K    + P+H A  I + +++K L+ N  +  L  T  + P H   ++G++E +  LLE +         G  P+H A   G   V  LL+      +    +GLTPL +A  H  +D   L+
Sbjct:  463 VNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL 588          

HSP 4 Score: 61.6178 bits (148), Expect = 3.669e-9
Identity = 38/122 (31.15%), Postives = 60/122 (49.18%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            +N     G  P+HIA    N+ +++ L++     E        P H   + G++ I   LL++   I+A    G+ PIH A    + + VRLL+ Y  +ID  T D LTPL +A+   H R+
Sbjct:  232 VNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRV 353          

HSP 5 Score: 59.3066 bits (142), Expect = 2.174e-8
Identity = 36/115 (31.30%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            I  K   G  PIH+A   ++LD ++ L+    + + I  ++  P H     G+  +   LL+      +    G  P+H AC K +  V+ LL+  G  ID  T  GLTPL +AS
Sbjct:  298 IQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVAS 412          

HSP 6 Score: 58.5362 bits (140), Expect = 3.496e-8
Identity = 33/121 (27.27%), Postives = 59/121 (48.76%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            I+   + G  P+H+A  + +L I+K L+       + +     P H   + G+ E+  YLL+NK  + A       P+H A   G+  +V+LL+      ++ T  G TPL IA++   ++
Sbjct:  397 IDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVE 517          

HSP 7 Score: 55.4546 bits (132), Expect = 4.424e-7
Identity = 37/115 (32.17%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            +LP +HIA   ++      L+ N  + +++  T + P H      NL +   LL     +      G+ P+H A  +G   +VRLL+  G QI+ KT D LTPL  A++  H RI
Sbjct:  173 RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRI 287          

HSP 8 Score: 52.373 bits (124), Expect = 3.481e-6
Identity = 24/82 (29.27%), Postives = 44/82 (53.66%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
             H   K+G+++++  LL  ++ +E     G   +H A L G  EVVR L+ YG  ++ ++  G TPL +A+Q   ++    +
Sbjct:   49 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFL 130          

HSP 9 Score: 52.373 bits (124), Expect = 4.307e-6
Identity = 30/114 (26.32%), Postives = 54/114 (47.37%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLIN--NKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            G  P+HIA     +++ + L+      + E +     P H   ++G+ E++  LL  +      +  G+ P+H    +G+  V  +LI +G  +D  T  G TPL +AS +  I
Sbjct:  602 GYTPLHIAAKQNQVEVARSLLQYGGSANAESVQ-GVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNI 714          
BLAST of Phospholipase A2 group VI vs. UniProt/SwissProt
Match: sp|Q02357|ANK1_MOUSE (Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 7.220e-13
Identity = 36/119 (30.25%), Postives = 62/119 (52.10%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA   ENL++ + L+N          N   P H   ++GN+ ++  LL+    IE      + P+H A   G+  +  +L+ +G  I  KT +GL+P+ +A+Q + +DC  L+
Sbjct:  202 GFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 320          

HSP 2 Score: 63.5438 bits (153), Expect = 1.076e-9
Identity = 39/157 (24.84%), Postives = 76/157 (48.41%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPLI------RDNYEKDIREIIENYE 710
            N  N  G  P+H+     ++ +   LI +    +      Y P H     GN++++ +LL+++  + A   LG  P+H A  +G+ ++V LL+  G   +  +++G TPL IA +   I   +++K   D   ++      R +Y + + EI++  E
Sbjct:  658 NLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVLKVVTDETSVVLVSDKHRMSYPETVDEILDVSE 814          

HSP 3 Score: 62.003 bits (149), Expect = 2.772e-9
Identity = 38/122 (31.15%), Postives = 60/122 (49.18%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            +N     G  P+HIA    N+ +++ L++     E        P H   + G++ I   LL++   I+A    G+ PIH A    + + VRLL+ Y  +ID  T D LTPL +A+   H R+
Sbjct:  228 VNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRV 349          

HSP 4 Score: 59.3066 bits (142), Expect = 2.076e-8
Identity = 36/115 (31.30%), Postives = 55/115 (47.83%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            I  K   G  PIH+A   ++LD ++ L+    + + I  ++  P H     G+  +   LL+      +    G  P+H AC K +  V+ LL+  G  ID  T  GLTPL +AS
Sbjct:  294 IQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVAS 408          

HSP 5 Score: 55.4546 bits (132), Expect = 4.419e-7
Identity = 31/118 (26.27%), Postives = 54/118 (45.76%), Query Frame = 3
Query:  282 KLPIHIACMIENLDIIKFLINNKCDTELIDT-NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            + P+H A  I +  ++K L+ N     L  T  + P H+  ++G+++    LLE +         G  P+H A   G   +  LL+ +    +    +GLTPL +A  H  +D   L+
Sbjct:  467 QTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL 584          

HSP 6 Score: 54.299 bits (129), Expect = 9.254e-7
Identity = 36/115 (31.30%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            +LP +HIA   ++      L+ N  + +++  T + P H      NL +   LL     +      G+ P+H A  +G   +VRLL+  G QI+ +T D LTPL  A++  H RI
Sbjct:  169 RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRI 283          

HSP 7 Score: 52.373 bits (124), Expect = 3.478e-6
Identity = 24/82 (29.27%), Postives = 44/82 (53.66%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
             H   K+G+++++  LL  ++ +E     G   +H A L G  EVVR L+ YG  ++ ++  G TPL +A+Q   ++    +
Sbjct:   45 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFL 126          

HSP 8 Score: 52.373 bits (124), Expect = 4.008e-6
Identity = 30/114 (26.32%), Postives = 54/114 (47.37%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLIN--NKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            G  P+HIA     +++ + L+      + E +     P H   ++G+ E++  LL  +      +  G+ P+H    +G+  V  +LI +G  +D  T  G TPL +AS +  I
Sbjct:  598 GYTPLHIAAKQNQIEVARSLLQYGGSANAESVQ-GVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNI 710          

HSP 9 Score: 51.9878 bits (123), Expect = 4.702e-6
Identity = 34/121 (28.10%), Postives = 58/121 (47.93%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            I+   + G  P+H+A  + +L I+K L+       + +     P H   + G+ E+  YLL+NK    A       P+H A   G+  +V+LL+  G   ++ T  G TPL  A++   +D
Sbjct:  393 IDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVD 513          
BLAST of Phospholipase A2 group VI vs. TrEMBL
Match: A0A429GFV7 (Ankyrin repeat domain-containing protein (Fragment) OS=Candidatus Methanodesulfokores washburnensis OX=2478471 GN=D6D85_13520 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 6.019e-18
Identity = 46/150 (30.67%), Postives = 78/150 (52.00%), Query Frame = 3
Query:  189 EKFMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            E  ++A + GD+        K   +N K++ G  P+H A     LDI+K L++   D    D +   P H     G+L+++ +LL+    + A D++G  P+HWA   G+ ++V+LL+  G  I+ K  DG TPL  A+ + R+D    +
Sbjct:    6 EGLIDAASRGDLEEVRRLLDKGADVNAKSEYGGTPLHWAAARGYLDIVKLLVDRGADISARDVDGETPLHRAAANGHLDVVEFLLDRGADVNAKDEVGGTPLHWAAAWGHLDIVKLLVDRGADINAKDEDGETPLHWAADNGRLDVVEFL 155          

HSP 2 Score: 82.0333 bits (201), Expect = 1.952e-14
Identity = 40/131 (30.53%), Postives = 69/131 (52.67%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAID 647
            +N K++ G  P+H A    +LDI+K L++   D    D +   P H     G L+++ +LL+    + A D  G  P+H A   G  ++V+LL+  G  ++ K   G TPLD+A + +  D  N ++ A++
Sbjct:   96 VNAKDEVGGTPLHWAAAWGHLDIVKLLVDRGADINAKDEDGETPLHWAADNGRLDVVEFLLDRGADVNAKDIYGWTPLHLAAYYGRLDIVKLLLDRGADVNAKNGGGKTPLDLAREKKYWDIVNFLEKAVE 226          
BLAST of Phospholipase A2 group VI vs. TrEMBL
Match: A0A0F2NPH8 (ANK_REP_REGION domain-containing protein OS=Peptococcaceae bacterium BRH_c4a OX=1629716 GN=VR68_00165 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.517e-17
Identity = 42/115 (36.52%), Postives = 67/115 (58.26%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +N+++++    + IAC   + +I+K LI N CD +L    Y P HS    G  EI+ +L+E  + +   D+ G  PIHWA  +G+ EV++LL+  G  ++ K + G TPL IAS 
Sbjct:   62 VNKRDNEWFTALEIACTKGHFEIVKLLIANNCDIKLDRGGYTPLHSAAATGRYEIVKFLIEKGIDVNIKDNEGYTPIHWATQEGHLEVIKLLVEMGGNLETKDDSGFTPLYIASS 176          

HSP 2 Score: 75.0998 bits (183), Expect = 1.052e-11
Identity = 42/121 (34.71%), Postives = 63/121 (52.07%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDT-NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIK--TNDGLTPLDIASQHERIDCFNLI 632
            G  P+H A      +I+KFLI    D  + D   Y P H   ++G+LE+I  L+E    +E  DD G  P++ A  +G+KE+V+  I     ID K  ++   TPL+IA  + R D   L+
Sbjct:  101 GYTPLHSAAATGRYEIVKFLIEKGIDVNIKDNEGYTPIHWATQEGHLEVIKLLVEMGGNLETKDDSGFTPLYIASSEGHKEIVKYFISKNINIDTKCESSSNSTPLNIAGIYNRTDVVELL 221          

HSP 3 Score: 61.2326 bits (147), Expect = 5.535e-7
Identity = 49/188 (26.06%), Postives = 76/188 (40.43%), Query Frame = 3
Query:  180 GGYEKFMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITY-----------------------------------LLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            GGY     A A+G         +K   +N K+++G  PIH A    +L++IK L+    + E  D + + P +    +G+ EI+ Y                                   LL+N    EA DD G  P+  A L G  EV++LL+ YG   D+K  +G    DI     + +   L+
Sbjct:  100 GGYTPLHSAAATGRYEIVKFLIEKGIDVNIKDNEGYTPIHWATQEGHLEVIKLLVEMGGNLETKDDSGFTPLYIASSEGHKEIVKYFISKNINIDTKCESSSNSTPLNIAGIYNRTDVVELLLKNGADFEARDDDGGTPLFNAVLHGNSEVIKLLLKYGANKDVKDKEGRNLYDIMPSENKEELLQLL 287          
BLAST of Phospholipase A2 group VI vs. TrEMBL
Match: W4XEP4 (ANK_REP_REGION domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.870e-17
Identity = 46/133 (34.59%), Postives = 71/133 (53.38%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFN-LIKSAIDI 650
            +NR  D G+ P+H A    +LD+++FLI  K D      +   P  +   KG+L+++ +L   K+ +  ADD G   +H A   G+ +VV+ LIG G  ++I +N G TPL  AS +  ID    LI    D+
Sbjct:   44 LNRAGDDGRTPLHAASSNGHLDVVQFLIGQKADLNTAGNDGGTPLQAASLKGHLDVVQFLTSQKVDLNTADDDGRTSLHAASFNGHLDVVQFLIGQGADLNIASNGGRTPLHAASSNGHIDVVQFLIGQGADL 176          

HSP 2 Score: 79.7221 bits (195), Expect = 5.630e-13
Identity = 49/163 (30.06%), Postives = 74/163 (45.40%), Query Frame = 3
Query:  174 GYGGYEKFMEAIASG--DVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT-NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFN-LIKSAIDI 650
            G GG     EA   G  DV+      K D +NR  + G  P+  A    +LD+++FLI  + D     +    P       G+L+++ +L+     +    + G  P+H A   G  EVV+ LIG G  ++   NDG TPL  AS +  +D    LI    D+
Sbjct:  180 GNGGRTPLHEASLKGRLDVVEFLTGQKAD-LNRAVNNGSTPLEAASRKGHLDVVQFLIGQQADLNRAGSKGRTPLQVASFNGHLDVVQFLIGQGAALNRTGNGGSTPLHAASFSGQVEVVQFLIGQGADLNTAGNDGRTPLHAASSNGHLDVVQFLIGQGADL 341          

HSP 3 Score: 77.0258 bits (188), Expect = 5.445e-12
Identity = 38/128 (29.69%), Postives = 64/128 (50.00%), Query Frame = 3
Query:  219 DVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            DV+   +  + D +NR   +G+ P+ +A    +LD+++FLI          +    P H+    G +E++ +L+     +  A + G  P+H A   G+ +VV+ LIG G  +    NDG TPL  AS
Sbjct:  230 DVVQFLIGQQAD-LNRAGSKGRTPLQVASFNGHLDVVQFLIGQGAALNRTGNGGSTPLHAASFSGQVEVVQFLIGQGADLNTAGNDGRTPLHAASSNGHLDVVQFLIGQGADLSRAGNDGRTPLQAAS 356          

HSP 4 Score: 76.2554 bits (186), Expect = 9.923e-12
Identity = 39/139 (28.06%), Postives = 69/139 (49.64%), Query Frame = 3
Query:  219 DVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            DV+      K D +N  +D G+  +H A    +LD+++FLI    D  +  +    P H+    G+++++ +L+     +  A + G  P+H A LKG  +VV  L G    ++   N+G TPL+ AS+   +D    +
Sbjct:   98 DVVQFLTSQKVD-LNTADDDGRTSLHAASFNGHLDVVQFLIGQGADLNIASNGGRTPLHAASSNGHIDVVQFLIGQGADLNRAGNGGRTPLHEASLKGRLDVVEFLTGQKADLNRAVNNGSTPLEAASRKGHLDVVQFL 235          
BLAST of Phospholipase A2 group VI vs. TrEMBL
Match: J9HSB7 (AAEL017480-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AaeL_AAEL017480 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.148e-16
Identity = 38/122 (31.15%), Postives = 72/122 (59.02%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDC 620
            ++   ++G  P+H A    +L+++K LI+N+ + +   +  + P H   + G LE++ +L++N   ++  D+ G  P+H+A   G+ EVV+LLI  G  +D   N+G TPL  AS++ R++ 
Sbjct:   35 VDTTQNKGWTPLHFASQNGHLEVVKLLIDNRANVDTTQNEEWTPLHYASRNGRLEVVKFLIDNGANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTTRNEGWTPLHYASRNGRLEV 156          

HSP 2 Score: 83.5741 bits (205), Expect = 1.657e-14
Identity = 36/126 (28.57%), Postives = 71/126 (56.35%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++  +++G  P+H A    +L+++K LI+N  + +   +  + P H   + G LE++ ++++N   ++  D+ G  P+H+A   G  EVV+ LI  G  +D   N+G TPL  AS++  ++   L+
Sbjct:  101 VDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTTRNEGWTPLHYASRNGRLEVVKFMIDNGANVDTTDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTPLHYASRNGHLEVVKLL 226          

HSP 3 Score: 82.8037 bits (203), Expect = 2.883e-14
Identity = 40/126 (31.75%), Postives = 73/126 (57.94%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++  +++G  P+H A     L+++KFLI+N  + +   +  + P H   + G+LE++  L++++  ++  D+ G  P+H A L G+ EVV+LLI  G  +D K     T L IASQ+ R++   L+
Sbjct:  167 VDTTDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTPLHYASRNGHLEVVKLLIDDEANVDTTDNEGWTPLHDASLIGHLEVVKLLIDNGANVDTKNTRRPTSLHIASQNGRLEVVKLL 292          

HSP 4 Score: 67.0106 bits (162), Expect = 7.864e-9
Identity = 35/126 (27.78%), Postives = 66/126 (52.38%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT-NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++   ++G  P+H A    +L+++K LI+++ + +  D   + P H     G+LE++  L++N   ++  +      +H A   G  EVV+LLI  G  +D K   G T L IAS++  ++   L+
Sbjct:  200 VDTTQNEGWTPLHYASRNGHLEVVKLLIDDEANVDTTDNEGWTPLHDASLIGHLEVVKLLIDNGANVDTKNTRRPTSLHIASQNGRLEVVKLLIDNGANVDTKNTRGSTSLHIASRNGHLEVVKLL 325          

HSP 5 Score: 63.929 bits (154), Expect = 1.061e-7
Identity = 30/101 (29.70%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNYP-PFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQID 557
            ++  +++G  P+H A +I +L+++K LI+N  + +  +T  P   H   + G LE++  L++N   ++  +  G   +H A   G+ EVV+LLI  G  +D
Sbjct:  233 VDTTDNEGWTPLHDASLIGHLEVVKLLIDNGANVDTKNTRRPTSLHIASQNGRLEVVKLLIDNGANVDTKNTRGSTSLHIASRNGHLEVVKLLIDNGANVD 333          

HSP 6 Score: 59.6918 bits (143), Expect = 2.482e-6
Identity = 26/85 (30.59%), Postives = 46/85 (54.12%), Query Frame = 3
Query:  378 YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            + P H     G+LE++  L++N   ++   + G  P+H+A   G+ EVV+LLI     +D   N+  TPL  AS++ R++    +
Sbjct:   10 WTPLHYASLNGHLEVVKLLIDNGANVDTTQNKGWTPLHFASQNGHLEVVKLLIDNRANVDTTQNEEWTPLHYASRNGRLEVVKFL 94          
BLAST of Phospholipase A2 group VI vs. TrEMBL
Match: Q16FI9 (AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014742 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 5.410e-16
Identity = 41/129 (31.78%), Postives = 73/129 (56.59%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++   D+G  P+H+A    +L+++K LI N+ +   +DT     + P H   + G+LE++ +L++N+  ++   D G  P+H A   G+ EVV+LLI     +D K N G TPL +ASQ+  ++    +
Sbjct:  177 VDTTQDEGWTPLHVASQNGHLEVVKLLIENRAN---VDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFL 302          

HSP 2 Score: 88.9669 bits (219), Expect = 8.697e-16
Identity = 39/121 (32.23%), Postives = 73/121 (60.33%), Query Frame = 3
Query:  273 DQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++G  P+++A    +L+++K LI+NK + +  D   + P H   + G+LE++  L+EN+  ++   + G+ P+H+A   G+ EVV+LLI     +D   N+G TPL +ASQ+  ++   L+
Sbjct:  556 NKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLL 676          

HSP 3 Score: 88.5817 bits (218), Expect = 1.216e-15
Identity = 38/126 (30.16%), Postives = 74/126 (58.73%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++   ++G  P+H A    +L+++K LI+N+ + +   +  + P H   + G+LE++  L+EN+  ++   + G+ P+H+A   G+ EVV+LLI     +D   N+G TPL +ASQ+  ++   L+
Sbjct:  617 VDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLL 742          

HSP 4 Score: 87.8113 bits (216), Expect = 2.443e-15
Identity = 41/129 (31.78%), Postives = 73/129 (56.59%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++ K + G  P+H+A    +L+++K LI N+ +   +DT     + P H   + G+LE++ +L++N+  ++   D G  P+H A   G+ EVV+LLI     +D K N+G TPL  ASQ+  ++    +
Sbjct:  111 VDTKKNGGWTPLHVASQNGHLEVVKLLIENRAN---VDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFL 236          

HSP 5 Score: 87.8113 bits (216), Expect = 2.465e-15
Identity = 45/127 (35.43%), Postives = 71/127 (55.91%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            I+  N+ G+ P+H+A    +L ++K LI+N    DTE  D  + P H   + G LE++  L++N   ++   D G  P+H A   G+ EVV+LLI     +D K N G TPL +ASQ+  ++   L+
Sbjct:   12 IDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTE-GDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLL 137          

HSP 6 Score: 87.0409 bits (214), Expect = 4.188e-15
Identity = 49/168 (29.17%), Postives = 86/168 (51.19%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT----NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPLIRDNYEKDIREIIENYEKI-VKANKKICAV 746
            ++   D+G  P+H+A    +L+++K LI N+ +   +DT     + P H   + G+LE++ +L++N+  ++     G  P+H A   G+ EVV+LLI     +D   N G+TPL  ASQ             +++V L+ DN    ++ +IEN   +    NK I  +
Sbjct:  243 VDTTQDEGWTPLHLAAENGHLEVVKLLIENRAN---VDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQ----------NGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPL 397          

HSP 7 Score: 83.1889 bits (204), Expect = 6.710e-14
Identity = 39/126 (30.95%), Postives = 71/126 (56.35%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++ + D+G  P+H+A     L+++K LI+N  + +   D  + P H   + G+LE++  L++N+  ++   + G  P+H A   G+ EVV+LLI     +D K N+G TPL  ASQ+  ++    +
Sbjct:   45 VDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFL 170          

HSP 8 Score: 81.6481 bits (200), Expect = 2.689e-13
Identity = 37/126 (29.37%), Postives = 74/126 (58.73%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++   ++G  P+++A +  +L+++K LINN+ + +   +  + P +   K G+LE++  L++NK  ++   + G  P+H A   G+ EVV+LLI     +D   N G+TPL +AS++  ++   L+
Sbjct:  452 VDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLL 577          

HSP 9 Score: 80.8777 bits (198), Expect = 4.904e-13
Identity = 36/126 (28.57%), Postives = 74/126 (58.73%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++   ++G  P+++A    +L+++K LI+NK + +   +  + P H   + G+LE++  L++N+  ++   + G+ P++ A   G+ EVV+LLI     +D   N+G TPL +ASQ+  ++   L+
Sbjct:  485 VDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLL 610          

HSP 10 Score: 80.1073 bits (196), Expect = 9.022e-13
Identity = 36/126 (28.57%), Postives = 71/126 (56.35%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++   ++G  P+H A    +L+++K LI N+ +     +  + P H   + G+LE++  L+EN+  ++   + G  P++ A + G+ EVV+LLI     +D   N+G TPL +AS++  ++   L+
Sbjct:  386 VDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLL 511          

HSP 11 Score: 73.559 bits (179), Expect = 1.162e-10
Identity = 37/131 (28.24%), Postives = 69/131 (52.67%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLL-----------ENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G  P+H+A    +L+++K LI+NK + +   +    P H   + G+LE++  L+           EN+  ++   + G+ P+H+A   G+ EVV+LLI     +    N+G TPL  AS++  ++   L+
Sbjct:  315 EGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLL 445          
BLAST of Phospholipase A2 group VI vs. Ensembl Cavefish
Match: ENSAMXT00000037173.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21074007:21119253:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000037173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 3.429e-14
Identity = 40/135 (29.63%), Postives = 68/135 (50.37%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            ++  G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+   V LL+  G  I  +T +GL+PL +A+Q + ++C   +   K+ +D V L
Sbjct:  205 QSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL 339          

HSP 2 Score: 65.855 bits (159), Expect = 1.012e-11
Identity = 36/109 (33.03%), Postives = 57/109 (52.29%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +LP +HIA   ++      L+ N  + ++   + + P H     GN+ + T LL     ++     G+ P+H A  +G   +VRLL+  G QID KT DGLTPL  A++
Sbjct:  176 RLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAAR 284          

HSP 3 Score: 57.7658 bits (138), Expect = 5.437e-9
Identity = 26/78 (33.33%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDC 620
             H   K+G+++++  LLE    +++A   G   +H A L G  EVV++L+  G  I+ ++ +G TPL +ASQ   +D 
Sbjct:   52 LHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDV 129          

HSP 4 Score: 56.6102 bits (135), Expect = 1.403e-8
Identity = 31/112 (27.68%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            +   G  P+H+A   ++++ +K L+ +K   + +  +Y    H     G+  +   LL+ +    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+
Sbjct:  304 RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAA 415          

HSP 5 Score: 54.6842 bits (130), Expect = 5.369e-8
Identity = 45/200 (22.50%), Postives = 83/200 (41.50%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLEN---------KLGIEAADD--------------------LGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAID------IVPL---IRDNYEKDIREIIENYEKIVKANK 731
            IN ++  G  P+++A    +LD++++L+ N  + +   +  + P     ++G+ ++++ LLEN          L I A  D                     G  P+H A   G   V  LL+  G  +D    +G+TPL +AS+    +   L+    S ID      + PL    R  ++  +  ++E    I+   K
Sbjct:  107 INAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTK 306          

HSP 6 Score: 50.8322 bits (120), Expect = 8.674e-7
Identity = 37/140 (26.43%), Postives = 61/140 (43.57%), Query Frame = 3
Query:  192 KFMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLI--NNKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
             F+ A  +G++     Y K    I   N  G   +H+A    ++D+++ L+   +  D+     N    H     G  E++  L++    I A    G  P++ A  + + +VVR L+  G      T DG TPL IA Q
Sbjct:   18 SFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTA-LHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQ 156          

HSP 7 Score: 49.2914 bits (116), Expect = 3.230e-6
Identity = 43/161 (26.71%), Postives = 71/161 (44.10%), Query Frame = 3
Query:  183 GYEKFMEAIASGDVMNTTVYYKK----DFINRKNDQGKLPIHIACMIENLDIIKFLIN--NKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERIDCFNLIKSA 641
            G+     A   G+V   T+   +    DF  R    G  P+H+A    N ++++ L++  ++ D +  D    P H   + G+   +  LLE    I A    G+ P+H A    + E V+ L+ +   +D  T D LT L +A+   H R+    L K A
Sbjct:  209 GFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN---GITPLHVASKRGNTNMVRLLLDRGSQIDAKTRD-GLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRA 365          
BLAST of Phospholipase A2 group VI vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 73.559 bits (179), Expect = 5.571e-14
Identity = 38/123 (30.89%), Postives = 65/123 (52.85%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++  G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LLE    I+A    G+ P+H     G+++VV +L+  G  I  KT +GL+PL +A+Q + ++C  L+
Sbjct:  178 ESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 300          

HSP 2 Score: 66.2402 bits (160), Expect = 1.469e-11
Identity = 37/126 (29.37%), Postives = 67/126 (53.17%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKC--DTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N  N +G+  +H+A      +++K+L+ N    D +  D +  P H   + G  EII  LL++    ++    G  P+H A  +G+K+V  +L+  G  + I T  G TPL +A+++ +I+  NL+
Sbjct:  407 NTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKD-DQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLL 531          

HSP 3 Score: 62.003 bits (149), Expect = 3.031e-10
Identity = 35/114 (30.70%), Postives = 56/114 (49.12%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+H+A   +N  +   L++          N Y P H   KK  +EI T LLE      A    G+ P+H A  +G  ++V LL+     I++    GLTPL +A+Q ++++
Sbjct:  545 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVN 658          

HSP 4 Score: 58.151 bits (139), Expect = 5.718e-9
Identity = 31/110 (28.18%), Postives = 53/110 (48.18%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQH 605
            G  P+HIA     ++I   L+    DT  I      P H   ++GN++++T L+     I   +  G+ P+H A  +    V  +L+ +G  +D +T  G TPL +A  +
Sbjct:  578 GYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHY 687          

HSP 5 Score: 56.225 bits (134), Expect = 2.186e-8
Identity = 34/120 (28.33%), Postives = 57/120 (47.50%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            KK   N K   G  P+HIAC    + +++ L+ +    + + ++   P H     G+  I+T L+ +       +  G   +H A   G  EVV+ L+  G  +D K+ D  TPL I+S+
Sbjct:  336 KKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSR 455          

HSP 6 Score: 53.9138 bits (128), Expect = 1.200e-7
Identity = 30/119 (25.21%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  255 FINRKNDQGKLPIHIACMIENLDIIKFLINN-KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
            +++ K+   + P+HI+  +   +II+ L+ +  C      + Y P H   ++G+ ++ + LL+    +      G  P+H A   G  EV  LL+      D     GLTPL +A+ ++
Sbjct:  438 YVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYD 556          

HSP 7 Score: 51.9878 bits (123), Expect = 5.778e-7
Identity = 37/166 (22.29%), Postives = 68/166 (40.96%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI-----------KSAIDIVPLIRDNYEKDIREIIENYEKIVKANKKI 737
            +G  P+H+A     +++   L+  +   +    +   P H      N ++   LL+      AA   G  P+H A  K   E+   L+ YG   +  T  G++PL +ASQ   +D   L+           KS +  + L     + ++ E++ N+   V    K+
Sbjct:  511 KGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKM 676          

HSP 8 Score: 50.8322 bits (120), Expect = 1.465e-6
Identity = 34/145 (23.45%), Postives = 64/145 (44.14%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENK---------LGIEAADD--------------------LGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +N ++  G  P+++A    +LD++++L++N     +  +  + P     ++G+ ++++ LLEN          L I A  D                     G  P+H A   G   V  LL+  G  +D K  + +TPL +AS+
Sbjct:   80 VNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASK 224          

HSP 9 Score: 48.521 bits (114), Expect = 7.378e-6
Identity = 26/105 (24.76%), Postives = 53/105 (50.48%), Query Frame = 3
Query:  291 IHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +H+A    +  + K +++ K +      N + P H   KK  ++++  LL++   I+A  + G+ PIH A   G++ +V  L+ +G   +     G T L +A++
Sbjct:  318 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAAR 422          
BLAST of Phospholipase A2 group VI vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 73.559 bits (179), Expect = 5.774e-14
Identity = 37/123 (30.08%), Postives = 66/123 (53.66%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++  G  P+HIA    N+++   L+N     + +  N   P H   K+GN  ++  LL+    I+A    G+ P+H     G+++VV +L+  G  I  KT +GL+PL +A+Q + ++C  L+
Sbjct:  233 ESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 355          

HSP 2 Score: 64.3142 bits (155), Expect = 5.969e-11
Identity = 36/126 (28.57%), Postives = 64/126 (50.79%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N  N +G+  +H+A      D++++L+ N  K D +  D +    H   + G  EI+  LL+      AA   G  P+H A  +G++E   LL+ +G  +   T  G TPL +A+++ +I+   L+
Sbjct:  462 NTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKD-DQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLL 586          

HSP 3 Score: 64.3142 bits (155), Expect = 6.302e-11
Identity = 35/155 (22.58%), Postives = 76/155 (49.03%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAID----IVPLIRDNYEKDIREIIENY 707
            +N  N  G  P+H+A   + + + + L+N+  + +    T Y P H     GN++++++LLEN+  I +    G  P+H A  +G+  ++ +L+ +    +  T +G T L IA +   I   + ++   D      P + + ++ ++ E +  +
Sbjct:  692 VNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLTDENLTATPPVSEKHKLNVPETMNEF 846          

HSP 4 Score: 63.929 bits (154), Expect = 7.688e-11
Identity = 36/113 (31.86%), Postives = 57/113 (50.44%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            G  P+H+A   +N  +   L+++         N Y P H   KK  LEI T LLE      A    G+ P+H A  +G  ++V LL+     +++   +GLTPL +A+Q +R+
Sbjct:  600 GLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRV 712          

HSP 5 Score: 55.8398 bits (133), Expect = 3.095e-8
Identity = 36/118 (30.51%), Postives = 56/118 (47.46%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
            I  K+DQ  L  HIA  +   +I++ L+          T+ Y P H   ++G+ E  + LLE+   + AA   G  P+H A   G  E  +LL+      D     GLTPL +A+ ++
Sbjct:  496 IKAKDDQTAL--HIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYD 611          

HSP 6 Score: 53.5286 bits (127), Expect = 1.938e-7
Identity = 28/110 (25.45%), Postives = 53/110 (48.18%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQH 605
            G  P+HIA     L+I   L+    +T  +      P H   ++G++++++ LL     +   +  G+ P+H A  +    V  +L+ +G ++D  T  G TPL +A  +
Sbjct:  633 GYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHY 742          

HSP 7 Score: 52.7582 bits (125), Expect = 3.273e-7
Identity = 35/130 (26.92%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            KK   N K   G  P+HIAC    + +++ L+ +    + + ++   P H     G+  I+  L  +       +  G   +H A   G  +VVR L+  G ++DIK  D  T L IAS+  + +   L+
Sbjct:  391 KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLL 520          

HSP 8 Score: 50.447 bits (119), Expect = 1.672e-6
Identity = 24/77 (31.17%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
             H   K+G++E++  LL+    ++AA   G   +H A L G  +VVR L+  G  ++ ++ +G TPL +A+Q   ++
Sbjct:   80 LHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLE 156          

HSP 9 Score: 50.447 bits (119), Expect = 2.013e-6
Identity = 30/120 (25.00%), Postives = 54/120 (45.00%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G  P+H+A     ++  K L+  +   +    T   P H      N  +   LL++     AA   G  P+H A  K   E+   L+ +G + +  T  G++PL +A+Q   +D  +L+
Sbjct:  566 KGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLL 685          

HSP 10 Score: 48.521 bits (114), Expect = 7.505e-6
Identity = 37/145 (25.52%), Postives = 65/145 (44.83%), Query Frame = 3
Query:  195 FMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLIN--NKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            ++ A  +G++     Y K    IN  N  G   +H+A    +++++  L+      D      N    H     G  +++  L+ N   + A    G  P++ A  + + EVVR L+ +G    I T DG TPL +A Q  H+++
Sbjct:   47 YLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGN-TALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQV 190          

HSP 11 Score: 48.521 bits (114), Expect = 7.639e-6
Identity = 35/119 (29.41%), Postives = 60/119 (50.42%), Query Frame = 3
Query:  252 DFINRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            DF+ R ND    P+H+A    N +++K L++   K D +  D    P H   + G+ +++  LL+    I +    G+ P+H A    +   V+LL+ +   +D  TND LT L +A+ 
Sbjct:  264 DFMAR-ND--ITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKD-GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAH 378          
BLAST of Phospholipase A2 group VI vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 73.1738 bits (178), Expect = 6.937e-14
Identity = 37/119 (31.09%), Postives = 64/119 (53.78%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA    N+++   L+N     + +  N   P H   K+GN  ++  LL+    I+A    G+ P+H     G+++VV +L+  G  I  KT +GL+PL +A+Q + ++C  L+
Sbjct:  209 GFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 327          

HSP 2 Score: 64.3142 bits (155), Expect = 6.023e-11
Identity = 36/126 (28.57%), Postives = 64/126 (50.79%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N  N +G+  +H+A      D++++L+ N  K D +  D +    H   + G  EI+  LL+      AA   G  P+H A  +G++E   LL+ +G  +   T  G TPL +A+++ +I+   L+
Sbjct:  434 NTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKD-DQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLL 558          

HSP 3 Score: 64.3142 bits (155), Expect = 6.358e-11
Identity = 35/155 (22.58%), Postives = 76/155 (49.03%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAID----IVPLIRDNYEKDIREIIENY 707
            +N  N  G  P+H+A   + + + + L+N+  + +    T Y P H     GN++++++LLEN+  I +    G  P+H A  +G+  ++ +L+ +    +  T +G T L IA +   I   + ++   D      P + + ++ ++ E +  +
Sbjct:  664 VNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLTDENLTATPPVSEKHKLNVPETMNEF 818          

HSP 4 Score: 63.929 bits (154), Expect = 7.757e-11
Identity = 36/113 (31.86%), Postives = 57/113 (50.44%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            G  P+H+A   +N  +   L+++         N Y P H   KK  LEI T LLE      A    G+ P+H A  +G  ++V LL+     +++   +GLTPL +A+Q +R+
Sbjct:  572 GLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRV 684          

HSP 5 Score: 55.8398 bits (133), Expect = 3.120e-8
Identity = 36/118 (30.51%), Postives = 56/118 (47.46%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
            I  K+DQ  L  HIA  +   +I++ L+          T+ Y P H   ++G+ E  + LLE+   + AA   G  P+H A   G  E  +LL+      D     GLTPL +A+ ++
Sbjct:  468 IKAKDDQTAL--HIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYD 583          

HSP 6 Score: 53.9138 bits (128), Expect = 1.230e-7
Identity = 35/123 (28.46%), Postives = 58/123 (47.15%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTEL---------IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIA--SQHERI 614
            +LP +HIA   ++      L+ N  + ++           + + P H     GN+ + T LL     ++      + P+H A  +G   +V+LL+  G +ID KT DGLTPL     S HE++
Sbjct:  168 RLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQV 290          

HSP 7 Score: 53.5286 bits (127), Expect = 1.953e-7
Identity = 28/110 (25.45%), Postives = 53/110 (48.18%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQH 605
            G  P+HIA     L+I   L+    +T  +      P H   ++G++++++ LL     +   +  G+ P+H A  +    V  +L+ +G ++D  T  G TPL +A  +
Sbjct:  605 GYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHY 714          

HSP 8 Score: 52.7582 bits (125), Expect = 3.298e-7
Identity = 35/130 (26.92%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            KK   N K   G  P+HIAC    + +++ L+ +    + + ++   P H     G+  I+  L  +       +  G   +H A   G  +VVR L+  G ++DIK  D  T L IAS+  + +   L+
Sbjct:  363 KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLL 492          

HSP 9 Score: 50.447 bits (119), Expect = 1.684e-6
Identity = 24/77 (31.17%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
             H   K+G++E++  LL+    ++AA   G   +H A L G  +VVR L+  G  ++ ++ +G TPL +A+Q   ++
Sbjct:   44 LHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLE 120          

HSP 10 Score: 50.447 bits (119), Expect = 2.028e-6
Identity = 30/120 (25.00%), Postives = 54/120 (45.00%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G  P+H+A     ++  K L+  +   +    T   P H      N  +   LL++     AA   G  P+H A  K   E+   L+ +G + +  T  G++PL +A+Q   +D  +L+
Sbjct:  538 KGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLL 657          

HSP 11 Score: 48.521 bits (114), Expect = 7.558e-6
Identity = 37/145 (25.52%), Postives = 65/145 (44.83%), Query Frame = 3
Query:  195 FMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLIN--NKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            ++ A  +G++     Y K    IN  N  G   +H+A    +++++  L+      D      N    H     G  +++  L+ N   + A    G  P++ A  + + EVVR L+ +G    I T DG TPL +A Q  H+++
Sbjct:   11 YLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGN-TALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQV 154          

HSP 12 Score: 48.521 bits (114), Expect = 7.693e-6
Identity = 35/119 (29.41%), Postives = 60/119 (50.42%), Query Frame = 3
Query:  252 DFINRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            DF+ R ND    P+H+A    N +++K L++   K D +  D    P H   + G+ +++  LL+    I +    G+ P+H A    +   V+LL+ +   +D  TND LT L +A+ 
Sbjct:  236 DFMAR-ND--ITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKD-GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAH 350          
BLAST of Phospholipase A2 group VI vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 73.1738 bits (178), Expect = 7.415e-14
Identity = 37/119 (31.09%), Postives = 64/119 (53.78%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA    N+++   L+N     + +  N   P H   K+GN  ++  LL+    I+A    G+ P+H     G+++VV +L+  G  I  KT +GL+PL +A+Q + ++C  L+
Sbjct:  189 GFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 307          

HSP 2 Score: 64.3142 bits (155), Expect = 6.408e-11
Identity = 36/126 (28.57%), Postives = 64/126 (50.79%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N  N +G+  +H+A      D++++L+ N  K D +  D +    H   + G  EI+  LL+      AA   G  P+H A  +G++E   LL+ +G  +   T  G TPL +A+++ +I+   L+
Sbjct:  414 NTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKD-DQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLL 538          

HSP 3 Score: 64.3142 bits (155), Expect = 6.765e-11
Identity = 35/155 (22.58%), Postives = 76/155 (49.03%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAID----IVPLIRDNYEKDIREIIENY 707
            +N  N  G  P+H+A   + + + + L+N+  + +    T Y P H     GN++++++LLEN+  I +    G  P+H A  +G+  ++ +L+ +    +  T +G T L IA +   I   + ++   D      P + + ++ ++ E +  +
Sbjct:  644 VNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLTDENLTATPPVSEKHKLNVPETMNEF 798          

HSP 4 Score: 63.929 bits (154), Expect = 8.251e-11
Identity = 36/113 (31.86%), Postives = 57/113 (50.44%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI 614
            G  P+H+A   +N  +   L+++         N Y P H   KK  LEI T LLE      A    G+ P+H A  +G  ++V LL+     +++   +GLTPL +A+Q +R+
Sbjct:  552 GLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRV 664          

HSP 5 Score: 55.8398 bits (133), Expect = 3.300e-8
Identity = 36/118 (30.51%), Postives = 56/118 (47.46%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
            I  K+DQ  L  HIA  +   +I++ L+          T+ Y P H   ++G+ E  + LLE+   + AA   G  P+H A   G  E  +LL+      D     GLTPL +A+ ++
Sbjct:  448 IKAKDDQTAL--HIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYD 563          

HSP 6 Score: 53.9138 bits (128), Expect = 1.299e-7
Identity = 35/123 (28.46%), Postives = 58/123 (47.15%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTEL---------IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIA--SQHERI 614
            +LP +HIA   ++      L+ N  + ++           + + P H     GN+ + T LL     ++      + P+H A  +G   +V+LL+  G +ID KT DGLTPL     S HE++
Sbjct:  148 RLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQV 270          

HSP 7 Score: 53.5286 bits (127), Expect = 2.061e-7
Identity = 28/110 (25.45%), Postives = 53/110 (48.18%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQH 605
            G  P+HIA     L+I   L+    +T  +      P H   ++G++++++ LL     +   +  G+ P+H A  +    V  +L+ +G ++D  T  G TPL +A  +
Sbjct:  585 GYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHY 694          

HSP 8 Score: 52.7582 bits (125), Expect = 3.479e-7
Identity = 35/130 (26.92%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            KK   N K   G  P+HIAC    + +++ L+ +    + + ++   P H     G+  I+  L  +       +  G   +H A   G  +VVR L+  G ++DIK  D  T L IAS+  + +   L+
Sbjct:  343 KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLL 472          

HSP 9 Score: 50.447 bits (119), Expect = 1.773e-6
Identity = 24/77 (31.17%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
             H   K+G++E++  LL+    ++AA   G   +H A L G  +VVR L+  G  ++ ++ +G TPL +A+Q   ++
Sbjct:   24 LHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLE 100          

HSP 10 Score: 50.447 bits (119), Expect = 2.134e-6
Identity = 30/120 (25.00%), Postives = 54/120 (45.00%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +G  P+H+A     ++  K L+  +   +    T   P H      N  +   LL++     AA   G  P+H A  K   E+   L+ +G + +  T  G++PL +A+Q   +D  +L+
Sbjct:  518 KGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLL 637          

HSP 11 Score: 48.521 bits (114), Expect = 8.082e-6
Identity = 35/119 (29.41%), Postives = 60/119 (50.42%), Query Frame = 3
Query:  252 DFINRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            DF+ R ND    P+H+A    N +++K L++   K D +  D    P H   + G+ +++  LL+    I +    G+ P+H A    +   V+LL+ +   +D  TND LT L +A+ 
Sbjct:  216 DFMAR-ND--ITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKD-GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAH 330          
BLAST of Phospholipase A2 group VI vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 4.494e-15
Identity = 41/142 (28.87%), Postives = 72/142 (50.70%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
             K  +N+  + G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+     G+ P+H A   G+++V+ +L+     I  KT +GL+PL +A+Q E + C  L+   ++ +D V L
Sbjct:  201 SKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTL 342          

HSP 2 Score: 66.2402 bits (160), Expect = 2.606e-12
Identity = 36/125 (28.80%), Postives = 62/125 (49.60%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N  N +G+ P+H+A     L+++K L+ +     +    +  P H   + G  EI+  LL+      A    G  P+++A  +G+ +V  LL+  G  I   T  G TPL IAS++ R++   L+
Sbjct:  437 NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLL 561          

HSP 3 Score: 63.5438 bits (153), Expect = 1.948e-11
Identity = 34/125 (27.20%), Postives = 60/125 (48.00%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+ +        ++   P H     G+L ++  LL+N     A +  G  P+H A   G  EVV+ L+  G ++ +K  +  TPL IAS+  + +   L+
Sbjct:  371 NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL 495          

HSP 4 Score: 62.7734 bits (151), Expect = 2.900e-11
Identity = 36/125 (28.80%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEA--ADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            K   G  P+H+A   ++  +   L++          N Y P H   KK  LE+   LLE  LG E       G+ P+H A  +G+ ++V LL+G    I + T  GLT + +A+Q ++++   ++
Sbjct:  571 KGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLE--LGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEIL 693          

HSP 5 Score: 62.003 bits (149), Expect = 6.596e-11
Identity = 36/123 (29.27%), Postives = 63/123 (51.22%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTELI---------DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIA--SQHERI 614
            +LP +HIA   ++ +    L+ ++ + ++          ++ + P H     GN+ + T LL     ++     G+ P+H A  +G   +V+LL+  G +ID KT DGLTPL  A  S HE++
Sbjct:  171 RLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKV 293          

HSP 6 Score: 58.5362 bits (140), Expect = 8.893e-10
Identity = 41/125 (32.80%), Postives = 62/125 (49.60%), Query Frame = 3
Query:  252 DFINRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            DF  R    G  P+H+A    N +++K L++   K DT+  D    P H   + G+ ++I  LLE    I A    G+ P+H A    +   V+LL+G    +D  T D LTPL +A+   H R+
Sbjct:  239 DFTARN---GITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRD-GLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRV 359          

HSP 7 Score: 57.7658 bits (138), Expect = 1.229e-9
Identity = 28/112 (25.00%), Postives = 61/112 (54.46%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFN-LIKSAIDIVPLIRDNYEKDIREIIENYEKIV 719
             H   K+G+++++T LL+ +  I+ A  +G   +H A L G  ++VR+L+ +G  I+ ++ +G TPL +A+Q   ++    L+ +  +      D +      + + +E++V
Sbjct:   47 LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVV 158          

HSP 8 Score: 56.225 bits (134), Expect = 4.010e-9
Identity = 32/121 (26.45%), Postives = 54/121 (44.63%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDC 620
            N     G  P++ A    + D+   L+ N  D + +    + P H   K G LE+ T LLE     +     G+ P+H A    +++V  LL+  G        +G TPL IA++  +++ 
Sbjct:  503 NAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEV 623          

HSP 9 Score: 53.1434 bits (126), Expect = 4.798e-8
Identity = 35/148 (23.65%), Postives = 69/148 (46.62%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN----YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPLIRDNYEKDIREIIENYE 710
            G   +H+A   + +++ + L  +K D   ++T     Y P H     GN++++ +LL N+  + A    G  P+H A  +G+  VV  L+ +    +  T +G T L IA +   I       S +D + ++ +     +  +IE ++
Sbjct:  674 GLTAMHLAAQEDKVNVAEILTKHKAD---VNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYI-------SVVDTLSILTEEPVTGVNTVIEKHK 811          

HSP 10 Score: 52.373 bits (124), Expect = 7.623e-8
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 3
Query:  192 KFMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY----PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
             F+ A  +G++     + K    IN  N  G   +H+A    ++D++  L+  + +   IDT         H     G  +I+  L+E    I A    G  P++ A  + + E+V+ L+  G    + T DG TPL +A Q  HE++
Sbjct:   13 SFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAE---IDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQV 157          

HSP 11 Score: 48.521 bits (114), Expect = 1.204e-6
Identity = 33/135 (24.44%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  231 TTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            T +  ++  I+     G   +HIA +    DI++ L+    +      N + P +   ++ +LEI+ +LL+N      A + G  P+  A  +G+++VV LL+    + D K    L  L IA++ +  +   L+
Sbjct:   60 TELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL----ESDTKGKVRLPALHIAARKDDTNAAALL 190          
BLAST of Phospholipase A2 group VI vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007071.1 (pep scaffold:Pmarinus_7.0:GL486086:7043:13224:-1 gene:ENSPMAG00000006394.1 transcript:ENSPMAT00000007071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 9.685e-14
Identity = 47/198 (23.74%), Postives = 87/198 (43.94%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI--KSAIDIVPLIRDNYEKDI-----REIIENYEKIVKANKKICAVCLDNEIDCVLNCGHSFCMGCGRKFVEC 827
            +R + + + P+  A    ++ ++K L+ N  K +     T +   H    KG++E++  LLE    +EA DD G+ P+  A   G    +R+L+ +G  ++ K+ D  TPL IA+Q    +C  L+    A   +P   D ++  +     R  ++    ++      C       +  V +  H    GC R  +E 
Sbjct:   41 SRASSEEETPVFAAIGGGHVAVVKALLRNGAKVNGPQYWTGWTSLHQATWKGHVELLQLLLERGARVEARDDYGITPLFLAAQYGQAPCLRILLQHGPDVNAKSKDWATPLFIAAQEGHTECLRLLLDNGAQPGLPCNEDGWQLPLHAAAQRGHVQLVSLLLPMTDGGCG-WQPGAVSPVYSATHGGSGGCLRSLLEA 237          
BLAST of Phospholipase A2 group VI vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 1.979e-13
Identity = 39/132 (29.55%), Postives = 67/132 (50.76%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
             G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+     G+ P+H A   G+++V+ +L+     I  KT +GL+PL +A+Q E + C  L+   ++ +D V L
Sbjct:  204 SGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTL 335          

HSP 2 Score: 65.855 bits (159), Expect = 2.797e-12
Identity = 36/125 (28.80%), Postives = 62/125 (49.60%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N  N +G+ P+H+A     L+++K L+ +     +    +  P H   + G  EI+  LL+      A    G  P+++A  +G+ +V  LL+  G  I   T  G TPL IAS++ R++   L+
Sbjct:  430 NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLL 554          

HSP 3 Score: 64.3142 bits (155), Expect = 9.957e-12
Identity = 36/115 (31.30%), Postives = 62/115 (53.91%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIA--SQHERI 614
            +LP +HIA   ++ +    L+ ++ + ++   + + P H     GN+ + T LL     ++     G+ P+H A  +G   +V+LL+  G +ID KT DGLTPL  A  S HE++
Sbjct:  172 RLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKV 286          

HSP 4 Score: 63.5438 bits (153), Expect = 1.624e-11
Identity = 34/125 (27.20%), Postives = 60/125 (48.00%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+ +        ++   P H     G+L ++  LL+N     A +  G  P+H A   G  EVV+ L+  G ++ +K  +  TPL IAS+  + +   L+
Sbjct:  364 NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL 488          

HSP 5 Score: 62.003 bits (149), Expect = 6.414e-11
Identity = 35/121 (28.93%), Postives = 60/121 (49.59%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEA--ADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+H+A   ++  +   L++          N Y P H   KK  LE+   LLE  LG E       G+ P+H A  +G+ ++V LL+G    I + T  GLT + +A+Q ++++   ++
Sbjct:  570 GLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLE--LGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEIL 688          

HSP 6 Score: 58.151 bits (139), Expect = 9.301e-10
Identity = 41/125 (32.80%), Postives = 62/125 (49.60%), Query Frame = 3
Query:  252 DFINRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            DF  R    G  P+H+A    N +++K L++   K DT+  D    P H   + G+ ++I  LLE    I A    G+ P+H A    +   V+LL+G    +D  T D LTPL +A+   H R+
Sbjct:  232 DFTARN---GITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRD-GLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRV 352          

HSP 7 Score: 58.151 bits (139), Expect = 1.074e-9
Identity = 28/112 (25.00%), Postives = 61/112 (54.46%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFN-LIKSAIDIVPLIRDNYEKDIREIIENYEKIV 719
             H   K+G+++++T LL+ +  I+ A  +G   +H A L G  ++VR+L+ +G  I+ ++ +G TPL +A+Q   ++    L+ +  +      D +      + + +E++V
Sbjct:   48 LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVV 159          

HSP 8 Score: 54.6842 bits (130), Expect = 1.366e-8
Identity = 37/141 (26.24%), Postives = 63/141 (44.68%), Query Frame = 3
Query:  234 TVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKT--NDGLTPLDIASQ--HERIDCFNLIKSA 641
            T+      +  K  + + P+HIA  +   +I++ L+    D      +   P +   ++G+ ++ + LLEN   I      G  P+H A   G  EV  LL+      D K    +GLTPL +A+   H+++    L K A
Sbjct:  454 TLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGA 594          

HSP 9 Score: 53.9138 bits (128), Expect = 2.232e-8
Identity = 33/123 (26.83%), Postives = 55/123 (44.72%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIE--AADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDC 620
            N     G  P++ A    + D+   L+ N  D + +    + P H   K G LE+ T LLE     +   A   G+ P+H A    +++V  LL+  G        +G TPL IA++  +++ 
Sbjct:  496 NAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEV 618          

HSP 10 Score: 53.1434 bits (126), Expect = 4.056e-8
Identity = 35/148 (23.65%), Postives = 69/148 (46.62%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN----YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPLIRDNYEKDIREIIENYE 710
            G   +H+A   + +++ + L  +K D   ++T     Y P H     GN++++ +LL N+  + A    G  P+H A  +G+  VV  L+ +    +  T +G T L IA +   I       S +D + ++ +     +  +IE ++
Sbjct:  669 GLTAMHLAAQEDKVNVAEILTKHKAD---VNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYI-------SVVDTLSILTEEPVTGVNTVIEKHK 806          

HSP 11 Score: 53.1434 bits (126), Expect = 4.395e-8
Identity = 41/160 (25.62%), Postives = 69/160 (43.12%), Query Frame = 3
Query:  156 FLRKLFGYGGYEKFMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY----PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            F    F       F+ A  +G++     + K    IN  N  G   +H+A    ++D++  L+  + +   IDT         H     G  +I+  L+E    I A    G  P++ A  + + E+V+ L+  G    + T DG TPL +A Q  HE++
Sbjct:    2 FFALSFQSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAE---IDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQV 158          

HSP 12 Score: 48.521 bits (114), Expect = 1.285e-6
Identity = 33/135 (24.44%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  231 TTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            T +  ++  I+     G   +HIA +    DI++ L+    +      N + P +   ++ +LEI+ +LL+N      A + G  P+  A  +G+++VV LL+    + D K    L  L IA++ +  +   L+
Sbjct:   61 TELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL----ESDTKGKVRLPALHIAARKDDTNAAALL 191          
BLAST of Phospholipase A2 group VI vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 1.126e-11
Identity = 33/125 (26.40%), Postives = 66/125 (52.80%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N  N +G+  +H+A      ++++ L+ N    +        P H   + G LEI+  LL++    +AA   G  P+H A  +G+++V  +L+ +G  + + T  G TPL +AS++ +++  +L+
Sbjct:   75 NATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLL 199          

HSP 2 Score: 61.6178 bits (148), Expect = 9.321e-11
Identity = 34/114 (29.82%), Postives = 55/114 (48.25%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+H+A   +N  +   L++          N Y P H   KK  LEI T LLE      A    G+ P+H    +G+ +V  LL+     ++  T  GL+PL +A+Q ++++
Sbjct:  213 GLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVN 326          

HSP 3 Score: 61.2326 bits (147), Expect = 1.244e-10
Identity = 33/118 (27.97%), Postives = 59/118 (50.00%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
            ++ K  + + P+HIA  +  L+I++ L+ +    +   +N Y P H   ++G+ ++   LLE+   +      G  P+H A   G  EV  LL+      D    +GLTPL +AS ++
Sbjct:  107 VDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYD 224          

HSP 4 Score: 60.8474 bits (146), Expect = 1.644e-10
Identity = 37/125 (29.60%), Postives = 60/125 (48.00%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+      E + ++   P H     GNL I+  LL+      A +  G   +H A   G  EVVR L+  G Q+D K  +  TPL IA++  +++   L+
Sbjct:    9 NVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLL 133          

HSP 5 Score: 51.2174 bits (121), Expect = 1.663e-7
Identity = 30/120 (25.00%), Postives = 54/120 (45.00%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDT-ELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            QG  P+H+     + D+   L+    D      +   P H   ++  + +   L+++   + A   LG  P+  AC  G  ++V  L+ +G  ++ KT +G TPL  A+Q       NL+
Sbjct:  278 QGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLL 397          

HSP 6 Score: 49.2914 bits (116), Expect = 7.504e-7
Identity = 29/114 (25.44%), Postives = 54/114 (47.37%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+H+A    + D+   L+ +     +     + P H   K G +E+ + LL+     +AA   G+ P+H A     ++V  LL+  G        +G TPL IA++ ++++
Sbjct:  147 GYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLE 260          

HSP 7 Score: 47.7506 bits (112), Expect = 2.226e-6
Identity = 29/127 (22.83%), Postives = 59/127 (46.46%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTE-LIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIK 635
            +N     G  P+H+A   + +++ + L+ +           Y P       GN++++ +LL++   + +    G  P+H A  +G+  +V LL+  G + +  T +G T L IA +   I   + +K
Sbjct:  305 VNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLK 431          
BLAST of Phospholipase A2 group VI vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 1.184e-11
Identity = 33/125 (26.40%), Postives = 66/125 (52.80%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N  N +G+  +H+A      ++++ L+ N    +        P H   + G LEI+  LL++    +AA   G  P+H A  +G+++V  +L+ +G  + + T  G TPL +AS++ +++  +L+
Sbjct:  165 NATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLL 289          

HSP 2 Score: 61.6178 bits (148), Expect = 9.782e-11
Identity = 34/114 (29.82%), Postives = 55/114 (48.25%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+H+A   +N  +   L++          N Y P H   KK  LEI T LLE      A    G+ P+H    +G+ +V  LL+     ++  T  GL+PL +A+Q ++++
Sbjct:  303 GLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVN 416          

HSP 3 Score: 61.2326 bits (147), Expect = 1.305e-10
Identity = 33/118 (27.97%), Postives = 59/118 (50.00%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHE 608
            ++ K  + + P+HIA  +  L+I++ L+ +    +   +N Y P H   ++G+ ++   LLE+   +      G  P+H A   G  EV  LL+      D    +GLTPL +AS ++
Sbjct:  197 VDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYD 314          

HSP 4 Score: 60.8474 bits (146), Expect = 1.725e-10
Identity = 37/125 (29.60%), Postives = 60/125 (48.00%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N +   G  P+HIAC    + +++ L+      E + ++   P H     GNL I+  LL+      A +  G   +H A   G  EVVR L+  G Q+D K  +  TPL IA++  +++   L+
Sbjct:   99 NVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLL 223          

HSP 5 Score: 51.2174 bits (121), Expect = 1.733e-7
Identity = 30/120 (25.00%), Postives = 54/120 (45.00%), Query Frame = 3
Query:  276 QGKLPIHIACMIENLDIIKFLINNKCDT-ELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            QG  P+H+     + D+   L+    D      +   P H   ++  + +   L+++   + A   LG  P+  AC  G  ++V  L+ +G  ++ KT +G TPL  A+Q       NL+
Sbjct:  368 QGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLL 487          

HSP 6 Score: 49.2914 bits (116), Expect = 7.806e-7
Identity = 29/114 (25.44%), Postives = 54/114 (47.37%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+H+A    + D+   L+ +     +     + P H   K G +E+ + LL+     +AA   G+ P+H A     ++V  LL+  G        +G TPL IA++ ++++
Sbjct:  237 GYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLE 350          

HSP 7 Score: 47.7506 bits (112), Expect = 2.252e-6
Identity = 34/157 (21.66%), Postives = 69/157 (43.95%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTE-LIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIV--------PLIRDNYEKDIREIIE 701
            +N     G  P+H+A   + +++ + L+ +           Y P       GN++++ +LL++   + +    G  P+H A  +G+  +V LL+  G + +  T +G T L IA +   I   + +K   +          P  R N  + + E++E
Sbjct:  395 VNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEETITSTTVSNPSSRVNVPETMTEVLE 551          

HSP 8 Score: 47.3654 bits (111), Expect = 3.563e-6
Identity = 21/65 (32.31%), Postives = 41/65 (63.08%), Query Frame = 3
Query:  474 GMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            G+ P+H A   G+++VV +L+  G  I  KT +GL+PL +A+Q + ++C  ++   ++ +D + L
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITL 70          
BLAST of Phospholipase A2 group VI vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 51.9878 bits (123), Expect = 2.429e-8
Identity = 31/110 (28.18%), Postives = 50/110 (45.45%), Query Frame = 3
Query:  270 NDQGKLPIHIACMIENLDIIKFLINNKCDTEL---IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYG-CQIDIKTNDGLTPL 587
            +D G  P HIAC + NL+++K L +     +L    +      H    K   E+  +L+EN   +   D     P+H A   G  +++ LL G G   ++ +   G TPL
Sbjct:   69 DDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPL 178          

HSP 2 Score: 50.447 bits (119), Expect = 7.438e-8
Identity = 38/147 (25.85%), Postives = 67/147 (45.58%), Query Frame = 3
Query:  237 VYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLI----NNKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKL--GIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI----KSAID 647
            ++ K   + +K+  G++P+H +   +  +I  FL+    N   D    D+ + PFH     GNLE++  L +  L   +    + G+  +H A  K + EV + LI  G  + IK      PL  A+    +    L+    KSA++
Sbjct:   22 LHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVN 168          
BLAST of Phospholipase A2 group VI vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 64.6994 bits (156), Expect = 2.637e-12
Identity = 45/163 (27.61%), Postives = 75/163 (46.01%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLE----------------NKLGIEA----------ADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERI-DCFNLIKSAIDI 650
            K   +++KND+G+ P+H+A  I + D +KFL++     +  D ++  PF S    G  E    LLE                  L +EA           D+ G   +H A L G+++VV  L+ YG  I+ + ++  TPL  A++   +  C  L++S   I
Sbjct:   58 KGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          

HSP 2 Score: 48.521 bits (114), Expect = 8.916e-7
Identity = 30/85 (35.29%), Postives = 43/85 (50.59%), Query Frame = 3
Query:  345 NKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS 599
            NK D    DT +   H   +   +E +  L+ N     + +DL   P+H AC KG  EV RLL+  G  +D K + G TPL +A+
Sbjct:    2 NKMD----DTGFSALHHATRYNRVEAMAELIRNG----SIEDLST-PLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAA 77          

HSP 3 Score: 47.3654 bits (111), Expect = 1.947e-6
Identity = 29/110 (26.36%), Postives = 50/110 (45.45%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPL 587
            +N+ +D G   +H A     ++ +  LI N      I+    P H   KKG++E+   L+E    ++  +D G  P+H A   G  + ++ L+  G  ID +     TP 
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIRNGS----IEDLSTPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPF 106          
BLAST of Phospholipase A2 group VI vs. Ensembl Nematostella
Match: EDO34823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNB2])

HSP 1 Score: 59.3066 bits (142), Expect = 8.233e-10
Identity = 38/153 (24.84%), Postives = 73/153 (47.71%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFL--INNKCDTELIDTNYPPFHSVYKKGNLEIITYL-LENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPLIRDNYEKDIREIIENY 707
            +N     G  P+++A    N D +KFL  +  KC+    D  +P  H+  + G+L+ + YL +  ++ +   D  G  P H+A  +G+  V++ L    C + IK + G TPL  A++  ++ C   +   + +    +D+      ++ E Y
Sbjct:   25 VNESATDGTTPLYLAAQDGNFDCLKFLHGVGAKCNITSRDGMHP-IHAAAQNGHLDCLGYLAIHGRVSMTERDRTGATPAHYAAGQGHLSVLKWL-NVRCDVKIKDSLGGTPLHDAAEKGQLHCLRFLVEVVHLDVRSKDSSNTSPIDLAERY 175          
BLAST of Phospholipase A2 group VI vs. Ensembl Nematostella
Match: EDO46099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR35])

HSP 1 Score: 55.8398 bits (133), Expect = 1.116e-9
Identity = 32/102 (31.37%), Postives = 51/102 (50.00%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTND---GLTPLDIASQHERIDCF--NLIKSAIDIVPLIRDNYE 677
             H   + GN + I  LL++   +      G RPIH A + G+ E VR+L+ YG   + KT      +TPL  A++   +DC    L++  ID+  + RD + 
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWR 102          
BLAST of Phospholipase A2 group VI vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 54.6842 bits (130), Expect = 1.231e-8
Identity = 31/100 (31.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:  195 FMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPI 488
            F+ A++SGDV        K   IN +N  G   +H AC+ EN D++K L++     ++ D   +   H+    G++EI  YL+EN   + A ++ G  P+
Sbjct:   53 FLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPL 152          
BLAST of Phospholipase A2 group VI vs. Ensembl Nematostella
Match: EDO27749 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8D8])

HSP 1 Score: 51.9878 bits (123), Expect = 1.394e-8
Identity = 36/122 (29.51%), Postives = 59/122 (48.36%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN--YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFN-LIK 635
            G+ PI +A +  +  I++ L+ N  D  +I +N       +  K GN E +   +E  +  ++ D  G   +H A   G +     L+  G ++DI   DG TPL  A+Q+  +DC   LIK
Sbjct:    2 GETPIFLASLHGHAHIMRSLLMNDADI-MIQSNELVSTLVAAVKGGNQECLKICIEQGMSPDSQDAGGWTALHEAAYVGDELSTEGLLAAGAKVDITNTDGATPLFTAAQYGIVDCLKALIK 122          
BLAST of Phospholipase A2 group VI vs. Ensembl Medaka
Match: ENSORLT00000039903.1 (pep primary_assembly:ASM223467v1:15:18469388:18484014:-1 gene:ENSORLG00000030042.1 transcript:ENSORLT00000039903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 1.091e-15
Identity = 38/123 (30.89%), Postives = 66/123 (53.66%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++  G  P+HIA    N+++   L+N     + +  N   P H   K+GN  ++  LL+    IEA    G+ P+H     G+++VV +L+  G  I  KT +GL+PL +A+Q + ++C  L+
Sbjct:  207 ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 329          

HSP 2 Score: 52.7582 bits (125), Expect = 2.447e-7
Identity = 32/119 (26.89%), Postives = 57/119 (47.90%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS--QHERI 614
            K   G  P+H+A   ++L+ ++ L+ +    + +  +Y    H     G+ ++   +++ K    A    G  P+H AC K    V+ LL+ +G  I   T  GLTP+ +A+   HE I
Sbjct:  306 KTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENI 424          

HSP 3 Score: 50.8322 bits (120), Expect = 9.051e-7
Identity = 38/150 (25.33%), Postives = 63/150 (42.00%), Query Frame = 3
Query:  192 KFMEAIASGDVMNTTVYYKKDF-INRKNDQGKLPIHIACMIENLDIIKFLI--NNKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
             ++ A  +G++     Y K    IN  N  G   +H+A    +++++  L+      D      N    H     G  E++T L+ N   + A    G  P++ A  + + EVVR L+       I T DG TPL +A Q       +L+
Sbjct:   20 SYLRAARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTA-LHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLL 168          

HSP 4 Score: 48.1358 bits (113), Expect = 7.384e-6
Identity = 23/88 (26.14%), Postives = 44/88 (50.00%), Query Frame = 3
Query:  291 IHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQ 551
            +H+A    +  + K +++ K +      N + P H   KK  + ++  LL++   I+A  + G+ PIH A   G++ +V  LI +G  
Sbjct:  347 LHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGAS 434          
BLAST of Phospholipase A2 group VI vs. Ensembl Medaka
Match: ENSORLT00000040233.1 (pep primary_assembly:ASM223467v1:19:16412534:16434057:1 gene:ENSORLG00000021910.1 transcript:ENSORLT00000040233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 1.206e-15
Identity = 39/119 (32.77%), Postives = 64/119 (53.78%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LLE    I+A    G+ P+H A   G+++VV +L+  G  I  KT +GL+PL +A+Q + ++C  L+
Sbjct:  211 GFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 329          

HSP 2 Score: 58.151 bits (139), Expect = 3.774e-9
Identity = 25/82 (30.49%), Postives = 46/82 (56.10%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
             H   K+G++E++  L++    ++AA   G   +H A L G  EVV+ L+  G  ++ ++ +G TPL +A+Q   +D   L+
Sbjct:   54 LHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLL 135          

HSP 3 Score: 52.373 bits (124), Expect = 2.796e-7
Identity = 32/119 (26.89%), Postives = 59/119 (49.58%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIAS--QHERI 614
            K   G  P+H+A   ++L+ ++ L+++    + +  +Y    H     G+ ++   +++ K    A    G  P+H AC K   +V+ LL+ +G  I   T  GLTP+ +A+   HE I
Sbjct:  306 KTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENI 424          

HSP 4 Score: 51.9878 bits (123), Expect = 4.340e-7
Identity = 34/145 (23.45%), Postives = 62/145 (42.76%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLEN---------KLGIEAADD--------------------LGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            +N ++  G  P+++A    +LD+++ L+ N     +  +  + P     ++G+ ++++ LLEN          L I A  D                     G  P+H A   G   V  LL+  G  +D K  + +TPL +AS+
Sbjct:  109 VNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASK 253          

HSP 5 Score: 50.0618 bits (118), Expect = 1.678e-6
Identity = 32/126 (25.40%), Postives = 55/126 (43.65%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            IN  N  G   +H+A    +++++  LI    + +          H     G  E++  L+ N   + A    G  P++ A  + + +VV+LL+  G    I T DG TPL +A Q       +L+
Sbjct:   43 INICNQNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLL 168          

HSP 6 Score: 49.2914 bits (116), Expect = 2.920e-6
Identity = 24/87 (27.59%), Postives = 45/87 (51.72%), Query Frame = 3
Query:  291 IHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGC 548
            +H+A    +  + K +++ K +      N + P H   KK  ++++  LL++   I+A  + G+ PIH A   G++ +V  LI YG 
Sbjct:  347 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLINYGA 433          
BLAST of Phospholipase A2 group VI vs. Ensembl Medaka
Match: ENSORLT00000006308.2 (pep primary_assembly:ASM223467v1:1:12516834:12530692:1 gene:ENSORLG00000005003.2 transcript:ENSORLT00000006308.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 1.656e-14
Identity = 40/135 (29.63%), Postives = 69/135 (51.11%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI---KSAIDIVPL 659
            ++  G  P+HIA    N+++   L+N     +    N   P H   K+GN  ++  LL+    I+A    G+ P+H A   G+   V LL+  G  I  +T +GL+PL +++Q + I+C  L+   ++ +D V L
Sbjct:  177 QSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTL 311          

HSP 2 Score: 58.5362 bits (140), Expect = 2.402e-9
Identity = 35/147 (23.81%), Postives = 69/147 (46.94%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPLIRDNYEKDIREIIEN 704
            +   G  P+H++   ++++ +K L+ ++   + +  +Y    H     G+  +   LL+ K    A    G  P+H AC K   +V+ LL+ YG  I   T  GLTP+ +A+    ++          ++ L+++    D+R I+ N
Sbjct:  276 RTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNI---------VLLLLQNGASPDVRNIVSN 413          

HSP 3 Score: 54.6842 bits (130), Expect = 5.624e-8
Identity = 24/78 (30.77%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDC 620
             H   K+G+ +++  LL+    +++A   G   +H A L G KEVV+LL+  G  ++ ++ +G TPL +A+Q   ++ 
Sbjct:   24 LHLAAKEGHKDLVEELLQRGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEV 101          

HSP 4 Score: 53.1434 bits (126), Expect = 1.764e-7
Identity = 32/155 (20.65%), Postives = 65/155 (41.94%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQ-----------------------------IDIKTNDGLTPLDIASQHERIDCFNLI 632
            ++    +G   +HIA +    +++K L++   D      N + P +   ++ +LE++ Y LEN+     A + G  P+  A  +G+  VV LL+ +  +                              D+++  G TPL IA+ +  ++   L+
Sbjct:   46 VDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEHDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLL 200          

HSP 5 Score: 48.9062 bits (115), Expect = 3.343e-6
Identity = 43/161 (26.71%), Postives = 71/161 (44.10%), Query Frame = 3
Query:  183 GYEKFMEAIASGDVMNTTVYYKK----DFINRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERIDCFNLIKSA 641
            G+     A   G+V  +T+   +    DF  R    G  P+H+A    N +++  L++   + D +  D    P H   + G+   +  LLE    I A    G+ P+H +    + E V+LL+ +   +D  T D LT L +A+   H R+    L K A
Sbjct:  181 GFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARN---GITPLHVASKRGNTNMVALLLDRGAQIDAKTRD-GLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKA 337          

HSP 6 Score: 48.1358 bits (113), Expect = 5.666e-6
Identity = 32/155 (20.65%), Postives = 66/155 (42.58%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLLEN---------KLGIEAADD--------------------LGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            +N ++  G  P+++A    +L+++++ + N+ +  +  +  + P     ++G+  +++ LLE+          L I A  D                     G  P+H A   G   V  LL+  G  +D    +G+TPL +AS+    +   L+
Sbjct:   79 VNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEHDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALL 233          
BLAST of Phospholipase A2 group VI vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 72.7886 bits (177), Expect = 9.343e-14
Identity = 34/115 (29.57%), Postives = 62/115 (53.91%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDC 620
            G  P+HIA   EN+ + + L+N   +      N   P H   ++GN+ ++  LL+    I+A     + P+H A   G+  ++ +L+ +G  I  KT +GL+P+ +A+Q + +DC
Sbjct:  204 GFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDC 318          

HSP 2 Score: 65.0846 bits (157), Expect = 3.045e-11
Identity = 36/126 (28.57%), Postives = 67/126 (53.17%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            N  N + + P+H+A    + ++ +FL+ N  + D    D +  P H   + G+ E++  LL++K   ++A   G  P+H A  +G+   +R+L+  G Q    T  G TPL +AS++ ++D   L+
Sbjct:  429 NASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKD-DQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELL 553          

HSP 3 Score: 63.5438 bits (153), Expect = 9.342e-11
Identity = 37/140 (26.43%), Postives = 64/140 (45.71%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFN-LIKSAIDIVPLIRDNY 674
            N     G  P+H+A    NLD++K L++          N Y P H   K+  +E+ + LL+N          G+ P+H A  +G  ++V +LI     +++   +GLTPL + +Q   +   + L+K    +    R  Y
Sbjct:  561 NAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGY 700          

HSP 4 Score: 63.1586 bits (152), Expect = 1.428e-10
Identity = 40/123 (32.52%), Postives = 63/123 (51.22%), Query Frame = 3
Query:  258 INRKNDQGKLPIHIACMIENLDIIKFLINN--KCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            +N     G  P+HIA    N+ +++ L++   + D +  D    P H   + G++ II  LLE+   I+A    G+ PIH A    + + VR L+ Y  +ID  T D LTPL +A+   H R+
Sbjct:  230 VNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKD-ELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRM 351          

HSP 5 Score: 62.3882 bits (150), Expect = 2.366e-10
Identity = 35/124 (28.23%), Postives = 61/124 (49.19%), Query Frame = 3
Query:  273 DQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNY-PPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSA 641
            + G  P+H+A  + +L+I+K L+         +     P H   + G+ E+  +LL+N   ++A       P+H A   G+KE+V+LL+ +    D  T  G TPL IA++   I    ++  A
Sbjct:  400 ESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDA 523          

HSP 6 Score: 59.6918 bits (143), Expect = 1.790e-9
Identity = 38/157 (24.20%), Postives = 76/157 (48.41%), Query Frame = 3
Query:  246 KKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAI-DIVPLIRDNYEKDIREIIENYE 710
            K+  +N  N  G  P+H+     ++ I   L+             Y P H     GN++++ +LL+ +  + A   +G  P+H A  +G+ ++V LL+ +G   +  T++G +PL IA +   I   +++K    + V   R ++ + + EI++  E
Sbjct:  655 KQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVLKLVTEESVSTHRMSFPETVDEILDVSE 811          

HSP 7 Score: 56.225 bits (134), Expect = 2.401e-8
Identity = 35/125 (28.00%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  267 KNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDT-NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKS 638
            K+DQ   P+H A  + + +++K L+++K + +   T  + P H   ++G++  I  LL+           G  P+H A   G  +V  LL+  G   +    +GLTPL +A  H  +D   L+ S
Sbjct:  466 KDDQ--TPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVS 588          

HSP 8 Score: 55.0694 bits (131), Expect = 5.962e-8
Identity = 36/115 (31.30%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  282 KLP-IHIACMIENLDIIKFLINNKCDTELID-TNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ--HERI 614
            +LP +HIA   ++      L+ N  + +++  T + P H      N+ +   LL     +      G+ P+H A  +G   +VRLL+  G QID +T D LTPL  A++  H RI
Sbjct:  171 RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRI 285          

HSP 9 Score: 54.6842 bits (130), Expect = 8.071e-8
Identity = 32/114 (28.07%), Postives = 54/114 (47.37%), Query Frame = 3
Query:  279 GKLPIHIACMIENLDIIKFLINNKCD-TELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERID 617
            G  P+HIA    ++  I+ L++      ++    + P H   K G +++   LLE      AA   G+ P+H A      +VV+LL+  G        +G TPL IA++  +I+
Sbjct:  501 GHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIE 614          

HSP 10 Score: 52.373 bits (124), Expect = 3.858e-7
Identity = 31/115 (26.96%), Postives = 54/115 (46.96%), Query Frame = 3
Query:  261 NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELI-DTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQ 602
            N +   G  P+HIAC   ++  +  L+ +    E + ++   P H     G+L I+  LL+      A++     P+H A   G+ EV + L+    Q+D +  D  TPL  A++
Sbjct:  363 NARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAAR 477          

HSP 11 Score: 48.521 bits (114), Expect = 6.605e-6
Identity = 22/82 (26.83%), Postives = 46/82 (56.10%), Query Frame = 3
Query:  387 FHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
             H   K+G+++++  LL + + +EA    G   +H A L G ++VV  L+ YG  ++ +++ G +PL +A+Q   ++    +
Sbjct:   47 LHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFL 128          
BLAST of Phospholipase A2 group VI vs. Ensembl Medaka
Match: ENSORLT00000036647.1 (pep primary_assembly:ASM223467v1:1:12524058:12528344:1 gene:ENSORLG00000029230.1 transcript:ENSORLT00000036647.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 1.273e-13
Identity = 37/121 (30.58%), Postives = 60/121 (49.59%), Query Frame = 3
Query:  282 KLPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDL-GMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKS 638
            + P+HIA  +   DI++ L+ +    +   TN Y P H   ++G +E    LLE      A+  L G  P+H A  K    +   L+ YG + ++ T  G++PL +ASQ    +  NL+ S
Sbjct:   17 QTPLHIASRLGKTDIVQLLLQHMAHPDAATTNGYTPLHISAREGQVETAAVLLE----AGASHSLNGYTPLHIAAKKNQTNIASALLQYGAETNVLTKQGVSPLHLASQEGHAEMVNLLLS 133          
BLAST of Phospholipase A2 group VI vs. Planmine SMEST
Match: SMESG000024845.1 (SMESG000024845.1)

HSP 1 Score: 491.5 bits (1264), Expect = 9.317e-178
Identity = 240/242 (99.17%), Postives = 242/242 (100.00%), Query Frame = 3
Query:  150 MNFLRKLFGYGGYEKFMEAIASGDVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPLIRDNYEKDIREIIENYEKIVKANKKICAVCLDNEIDCVLNCGHSFCMGCGRKFVECPNCRSKPTNPKRLYLD 875
            MNFLRKLFGYGGYEKFMEAIA+GDVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPLIRDNYEKDIR+IIENYEKIVKANKKICAVCLDNEIDCVLNCGHSFCMGCGRKFVECPNCRSKPTNPKRLYLD
Sbjct:    1 MNFLRKLFGYGGYEKFMEAIANGDVMNTTVYYKKDFINRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPLIRDNYEKDIRQIIENYEKIVKANKKICAVCLDNEIDCVLNCGHSFCMGCGRKFVECPNCRSKPTNPKRLYLD 242          
BLAST of Phospholipase A2 group VI vs. Planmine SMEST
Match: SMESG000024844.1 (SMESG000024844.1)

HSP 1 Score: 217.238 bits (552), Expect = 1.206e-69
Identity = 101/245 (41.22%), Postives = 158/245 (64.49%), Query Frame = 3
Query:  150 MNFLRKLFGYGGYEKFMEAIASGDVMNTTVYYKKDFINRKNDQGK--LPIHIACMIENLDIIKFLINNKCDTELIDTN-YPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPLIRDNYEKDIREIIENYEKIVKANKKICAVCLDNEIDCVLNCGHSFCMGCGRKFVECPNCRSKPTNPKRLYLD 875
            MN+      YGG+EKF+ A+  G+V    VYYK++F+N+ +++     PIH AC+  +  +++FLI+ +CD E  D N +PP H  YK G+ EI+  L+ NK GIE+ D  GMRPIH ACL  + ++++LL+  GC +D K+    +PLDI   +   +C +++K AI+++P IR+ ++ +I++I E +E + + N+++C++C   E+ CVL+CGH FC GC  KF ECP C  K    KRL LD
Sbjct:    1 MNYFLTYLNYGGFEKFLRAVIDGNVKAVKVYYKEEFLNKADERNNEYRPIHFACLNGHCAVVEFLIDKRCDAETCDKNGFPPLHLAYKNGHYEIVKILINNKCGIESFDKFGMRPIHLACLYSHIDILKLLLVIGCDLDSKSKMEESPLDICIHYRHQECIDIMKFAIELLPKIRELHKNEIKQIFEKFEILNRKNRQMCSICCRKELSCVLDCGHPFCTGCASKFKECPKCNMKIKFLKRLILD 245          
BLAST of Phospholipase A2 group VI vs. Planmine SMEST
Match: SMESG000021295.1 (SMESG000021295.1)

HSP 1 Score: 144.05 bits (362), Expect = 6.279e-40
Identity = 77/210 (36.67%), Postives = 119/210 (56.67%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCDTELIDT-NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDI----VPLIRDNYEKDIREIIENYEKI---------VKANKKICAVCLDNEIDCVLNCGHSFCMGCGRKFVECPNCRSKPTNPKRLYLD 875
            PIH+AC+  ++DI+K L+ N C TE  D     P H   K G++EI+  L+EN    E+ +    RPIH+AC  G+ ++V+ LI   C ++++  DG TPLD+A ++    C ++I + I+     +  +R  +    R      E++          K  + IC +C D E+DCVL+CGH FCM CG++F  CP CR+K TN  R++LD
Sbjct:  171 PIHVACVYGHVDILKLLLENNCTTETEDKYKTRPIHYACKTGHVEIVRILVENNCNFESQNIEKRRPIHYACKSGHVDIVKFLIHNKCNLEVEDIDGKTPLDLALENNNEICVDMILTEIEARKKKISEMRQAFVDAPRPGPSTKERMKVTVKARIETKPERNICKICYDREVDCVLSCGHVFCMLCGKRFSICPVCRTKSTNHIRMFLD 380          

HSP 2 Score: 68.9366 bits (167), Expect = 6.594e-13
Identity = 51/190 (26.84%), Postives = 81/190 (42.63%), Query Frame = 3
Query:  150 MNFLRKLFGYGGYEKFMEAIASGDVMNTTVYYKKDFINRKNDQGKL--PIHIACMIENLDIIKFLINNKCDTEL-IDTNYPPFHSVYKKGNLEIITYLL--------------------------ENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLI 632
            M  ++K    G +EK    + SG+VM      KK+F++   +       IH+AC    ++++K LIN KC+ E  +  N  P H     GN+EI+  L+                          EN   I     +  RPIH AC KG+  +V+L+I   C +     D   P+ +A  +  +D   L+
Sbjct:    1 MEVVKKNNNLGVFEK---VVKSGNVMEVKKRLKKEFLHSDFNPFTQCQAIHVACKQGFVEVVKILINKKCNIEQEMIWNIKPVHITCLVGNIEILRLLIAYRCDLESIANIPTDENFEKLFDIDSENSESISTMKTVQTRPIHIACWKGHCNIVKLMIDNDCNLQTNDKDNWKPIHVACVYGHVDILKLL 187          

HSP 3 Score: 55.8398 bits (133), Expect = 1.534e-8
Identity = 32/130 (24.62%), Postives = 59/130 (45.38%), Query Frame = 3
Query:  288 PIHIACMIENLDIIKFLINNKCDTELI-----DTNYP----------------------PFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIA 596
            P+HI C++ N++I++ LI  +CD E I     D N+                       P H    KG+  I+  +++N   ++  D    +PIH AC+ G+ ++++LL+   C  + +      P+  A
Sbjct:   79 PVHITCLVGNIEILRLLIAYRCDLESIANIPTDENFEKLFDIDSENSESISTMKTVQTRPIHIACWKGHCNIVKLMIDNDCNLQTNDKDNWKPIHVACVYGHVDILKLLLENNCTTETEDKYKTRPIHYA 208          
BLAST of Phospholipase A2 group VI vs. Planmine SMEST
Match: SMESG000076390.1 (SMESG000076390.1)

HSP 1 Score: 102.834 bits (255), Expect = 2.328e-26
Identity = 54/162 (33.33%), Postives = 89/162 (54.94%), Query Frame = 3
Query:  180 GGYEKFMEAIASGDVMNTTVYYKKDFINRKND-QGKLPIHIACMIENLDIIKFLINNKCDTELIDT-NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPL 659
            G Y+ FME +  G+    +    + F+N K+D +GKLPIHIAC      I++ L+ + C+ E  D     P H     G+ +++  L++    IE  +D   RPIH+A   G+ E+++LL+   CQI+ KT DG TPLD+A    ++DC   + +   ++ +
Sbjct:    2 GDYKCFMECLIKGNAEGVSNNISERFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDKWQNRPIHWASWNGHADVVRLLIDRNCNIECENDGQWRPIHYASWNGHAEIIQLLMLNKCQIECKTKDGETPLDLARFSNKMDCAEFLSNGKTLIKV 163          
BLAST of Phospholipase A2 group VI vs. Planmine SMEST
Match: SMESG000076390.1 (SMESG000076390.1)

HSP 1 Score: 102.449 bits (254), Expect = 2.531e-26
Identity = 54/162 (33.33%), Postives = 89/162 (54.94%), Query Frame = 3
Query:  180 GGYEKFMEAIASGDVMNTTVYYKKDFINRKND-QGKLPIHIACMIENLDIIKFLINNKCDTELIDT-NYPPFHSVYKKGNLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDIKTNDGLTPLDIASQHERIDCFNLIKSAIDIVPL 659
            G Y+ FME +  G+    +    + F+N K+D +GKLPIHIAC      I++ L+ + C+ E  D     P H     G+ +++  L++    IE  +D   RPIH+A   G+ E+++LL+   CQI+ KT DG TPLD+A    ++DC   + +   ++ +
Sbjct:    2 GDYKCFMECLIKGNAEGVSNNISERFVNVKSDAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDKWQTRPIHYASVNGHADVVRLLIDRNCNIECENDGQWRPIHYASWNGHAEIIQLLMLNKCQIECKTKDGETPLDLARFSNKMDCAEFLSNGKTLIKV 163          
The following BLAST results are available for this feature:
BLAST of Phospholipase A2 group VI vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK25.008e-1530.50ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK25.088e-1530.50ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK25.278e-1530.50ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK25.433e-1530.50ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK25.445e-1530.50ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of Phospholipase A2 group VI vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-445.271e-1130.91AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.271e-1130.91AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.280e-1130.91AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.280e-1130.91AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.289e-1130.91AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Phospholipase A2 group VI vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank21.618e-1434.17gene:FBgn0261788 transcript:FBtr0334062[more]
Ank21.723e-1434.45gene:FBgn0261788 transcript:FBtr0303120[more]
Ank21.956e-1335.96gene:FBgn0261788 transcript:FBtr0303119[more]
Ank22.005e-1335.96gene:FBgn0261788 transcript:FBtr0334061[more]
Ank22.177e-1335.96gene:FBgn0261788 transcript:FBtr0303118[more]
back to top
BLAST of Phospholipase A2 group VI vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX469921.12.496e-1631.78ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
ank3a2.496e-1631.78ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
BX511162.15.676e-1629.58ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926][more]
BX511162.17.352e-1629.58ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926][more]
BX511162.18.765e-1629.79ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926][more]
back to top
BLAST of Phospholipase A2 group VI vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm42.511e-1531.01tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
ANK25.293e-1530.50ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK25.295e-1530.50ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK25.297e-1530.50ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK25.350e-1530.50ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
back to top
BLAST of Phospholipase A2 group VI vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank21.453e-1529.58ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank21.614e-1529.79ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank21.863e-1529.58ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank34.655e-1530.23ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank11.711e-1430.25ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
back to top
BLAST of Phospholipase A2 group VI vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O70511|ANK3_RAT2.811e-1430.23Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|Q01484|ANK2_HUMAN2.816e-1430.50Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=... [more]
sp|Q8C8R3|ANK2_MOUSE2.712e-1329.79Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV... [more]
sp|P16157|ANK1_HUMAN5.858e-1330.25Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
sp|Q02357|ANK1_MOUSE7.220e-1330.25Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV... [more]
back to top
BLAST of Phospholipase A2 group VI vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A429GFV76.019e-1830.67Ankyrin repeat domain-containing protein (Fragment... [more]
A0A0F2NPH81.517e-1736.52ANK_REP_REGION domain-containing protein OS=Peptoc... [more]
W4XEP41.870e-1734.59ANK_REP_REGION domain-containing protein OS=Strong... [more]
J9HSB71.148e-1631.15AAEL017480-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
Q16FI95.410e-1631.78AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
back to top
BLAST of Phospholipase A2 group VI vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000037173.13.429e-1429.63pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ank3b5.571e-1430.89ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a5.774e-1430.08ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a6.937e-1431.09ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a7.415e-1431.09ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of Phospholipase A2 group VI vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.14.494e-1528.87pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000007071.19.685e-1423.74pep scaffold:Pmarinus_7.0:GL486086:7043:13224:-1 g... [more]
ENSPMAT00000000095.11.979e-1329.55pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007449.11.126e-1126.40pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000007446.11.184e-1126.40pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
back to top
BLAST of Phospholipase A2 group VI vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NAS62.429e-828.18Evolutionarily conserved 19S regulatory particle a... [more]
back to top
BLAST of Phospholipase A2 group VI vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387252.637e-1227.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348238.233e-1024.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460991.116e-931.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436901.231e-831.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277491.394e-829.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phospholipase A2 group VI vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000039903.11.091e-1530.89pep primary_assembly:ASM223467v1:15:18469388:18484... [more]
ENSORLT00000040233.11.206e-1532.77pep primary_assembly:ASM223467v1:19:16412534:16434... [more]
ENSORLT00000006308.21.656e-1429.63pep primary_assembly:ASM223467v1:1:12516834:125306... [more]
ank1b9.343e-1429.57ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000036647.11.273e-1330.58pep primary_assembly:ASM223467v1:1:12524058:125283... [more]
back to top
BLAST of Phospholipase A2 group VI vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024845.19.317e-17899.17SMESG000024845.1[more]
SMESG000024844.11.206e-6941.22SMESG000024844.1[more]
SMESG000021295.16.279e-4036.67SMESG000021295.1[more]
SMESG000076390.12.328e-2633.33SMESG000076390.1[more]
SMESG000076390.12.531e-2633.33SMESG000076390.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012121 ID=SMED30012121|Name=Phospholipase A2 group VI|organism=Schmidtea mediterranea sexual|type=transcript|length=951bp
CTTTGGGATATTTTCCAAATTGCATAAACAAAATAAAATTTTAATTTATC
GTCTTATTTGTTACCTGAACAATGTTCGCGACATTCTACTAATACCATTT
TTAAAAATTTATGATCAATTTCTTCATTTGTATAATAATACTTCTTTCGA
TGAATTTTTTGAGAAAATTATTTGGATATGGAGGCTATGAAAAATTTATG
GAAGCGATTGCTAGCGGAGATGTAATGAACACTACAGTTTATTATAAAAA
AGATTTCATTAATAGGAAAAACGATCAAGGAAAATTACCGATTCATATTG
CATGCATGATTGAAAATCTAGATATTATCAAATTCCTGATAAATAATAAA
TGCGATACAGAATTAATTGATACAAATTATCCACCATTTCATTCTGTTTA
TAAAAAAGGTAATTTAGAAATAATTACCTATTTGTTAGAAAACAAATTGG
GAATTGAAGCAGCCGATGATTTAGGAATGCGCCCGATTCACTGGGCTTGT
TTGAAAGGTTACAAGGAAGTTGTTAGATTATTGATTGGTTATGGTTGTCA
AATTGATATTAAAACAAATGATGGACTGACTCCTCTTGATATTGCTAGCC
AACACGAACGAATTGACTGTTTTAATCTAATTAAATCTGCCATTGATATT
GTTCCGTTGATCAGAGATAACTATGAAAAGGATATCAGAGAAATCATTGA
AAATTATGAAAAAATAGTTAAAGCCAACAAAAAGATCTGCGCAGTTTGTT
TGGATAACGAAATCGACTGCGTTCTTAATTGTGGGCATTCATTTTGTATG
GGTTGTGGCAGGAAATTTGTTGAATGCCCAAATTGTAGATCTAAGCCCAC
GAACCCCAAACGACTTTATCTTGATTAAAAACTTTCATTTTTTACAATAA
TGTTTATTGGGAAAGCTTATTTTTAAATACATATATTGAGTAATCAAAAA
A
back to top

protein sequence of SMED30012121-orf-1

>SMED30012121-orf-1 ID=SMED30012121-orf-1|Name=SMED30012121-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=256bp
MINFFICIIILLSMNFLRKLFGYGGYEKFMEAIASGDVMNTTVYYKKDFI
NRKNDQGKLPIHIACMIENLDIIKFLINNKCDTELIDTNYPPFHSVYKKG
NLEIITYLLENKLGIEAADDLGMRPIHWACLKGYKEVVRLLIGYGCQIDI
KTNDGLTPLDIASQHERIDCFNLIKSAIDIVPLIRDNYEKDIREIIENYE
KIVKANKKICAVCLDNEIDCVLNCGHSFCMGCGRKFVECPNCRSKPTNPK
RLYLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0016042lipid catabolic process
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0005515protein binding
GO:0008270zinc ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR001841Znf_RING
IPR020683Ankyrin_rpt-contain_dom
IPR013083Znf_RING/FYVE/PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 185..205
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 207..245
e-value: 2.8E-6
score: 27.1
NoneNo IPR availablePANTHERPTHR24121:SF2NO MECHANORECEPTOR POTENTIAL C, ISOFORM Hcoord: 129..174
NoneNo IPR availablePANTHERPTHR24121NO MECHANORECEPTOR POTENTIAL C, ISOFORM D-RELATEDcoord: 129..174
NoneNo IPR availablePANTHERPTHR24121:SF2NO MECHANORECEPTOR POTENTIAL C, ISOFORM Hcoord: 21..142
NoneNo IPR availablePANTHERPTHR24121NO MECHANORECEPTOR POTENTIAL C, ISOFORM D-RELATEDcoord: 21..142
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.731
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 199..247
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 154..183
e-value: 190.0
score: 10.4
coord: 88..117
e-value: 16.0
score: 14.5
coord: 56..85
e-value: 0.012
score: 24.8
coord: 121..150
e-value: 0.0046
score: 26.2
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 121..153
score: 11.033
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 56..88
score: 10.179
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 210..242
e-value: 0.0013
score: 28.0
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 210..243
score: 12.017
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 61..151
e-value: 7.3E-15
score: 55.3
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 50..174
score: 24.984
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 32..90
e-value: 3.2E-6
score: 28.9
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 91..180
e-value: 1.0E-21
score: 79.4
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 8..174
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 186..255
e-value: 1.7E-10
score: 42.2